F385666

General Info

Members Datasets Scaffolds Average Seq Length
283 144 550 598

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10018703|Ga0265314_100187033
Length 707
Sequence MARRELQTEDCKELLPVVLRISMCQQNAHYFALFSLEPDRLNLITEVSLMEMMRMQRSTVLTAIQRAAALILAATLVPVGWAQDASQMPSAPSGQVPAQRAVSSSQPFDVREYSKPVSPFPNPIGPYKARHVAPPNIANTPRIDQLMHDGKLYISMNDAVALALENNLDIAIARYNLNIADTDVWRAKAGYNTILGVNSGVVQNTPGSGVGGLGVQSTLGSGPTITSFDPILTGTFQVDRLKSNCATPFCGSSQNTTTANFGYSQGFQWGTNMALSFNNSRTTSNNQYTNESPALNSSFKLQLTQHLLQGFGFAPNTRFIQIAKNNREISDVAFRLQIITTVDQIENMYWDLVYAYENVRVQQEQLAFAQKTLSDNQKQVEIGTLAPIEVVRAQSTVATDQQTLTVALTNLELQQLLMKNALSRTLVDPVLADAEVIPTSTMELPAQAPVVPIQDLVNDALAHRPELAESRINLSNTEISNKAIRSALLPSVDLFAYYGGSGLGGKLNPIANCRPTCTFPTTSYSDTLDQLINSTAPDKGVGLTLNIPLRNRAAQSVQVRGELEYRQSQLLLQQTENRVRIEVRNAQFGXXXNRASVASAQAAVDLAHQSLDAEQKKYALGASTSTLVLQNQAAMTQAEVTLVSAKALYEKAEVELDRAIGLLLDHAGIVIADAERGEVTHAPNIPHVVARPADQPVPTKPPAQPQQ

Samples

Sample ID Description Type Environment
1 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
94 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
98 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
143 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
144 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.59
Metatranscriptomes 1.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.36
Rhizosphere 92.58
Stem 0
Stem Tuber 0
Unclassified 17.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265314_10018703 3300031711 Bacteria 5393
2 LJNas_1000034 3300000546 Bacteria 18444
3 LJNas_1000317 3300000546 Bacteria 8418
4 Ga0070683_100034958 3300005329 Unclassified 4593
5 Ga0068869_100026364 3300005334 Bacteria 4045
6 Ga0068868_100023835 3300005338 Unclassified 4636
7 Ga0070661_100002546 3300005344 Bacteria 12487
8 Ga0070709_10004874 3300005434 Bacteria 7252
9 Ga0070709_10005448 3300005434 Bacteria 6895
10 Ga0070709_10045867 3300005434 Unclassified 2715
11 Ga0070714_100001161 3300005435 Bacteria 18973
12 Ga0070714_100010691 3300005435 Bacteria 7263
13 Ga0070714_100012233 3300005435 Bacteria 6845
14 Ga0070714_100035987 3300005435 Unclassified 4150
15 Ga0070714_100074647 3300005435 Bacteria 2940
16 Ga0070714_100104966 3300005435 Bacteria 2494
17 Ga0070713_100000421 3300005436 Bacteria 27054
18 Ga0070713_100009606 3300005436 Bacteria 6940
19 Ga0070713_100027060 3300005436 Bacteria 4512
20 Ga0070713_100031416 3300005436 Bacteria 4229
21 Ga0070713_100073365 3300005436 Bacteria 2897
22 Ga0070710_10001081 3300005437 Bacteria 12903
23 Ga0070710_10010310 3300005437 Bacteria 4589
24 Ga0070711_100006171 3300005439 Bacteria 7207
25 Ga0070711_100007897 3300005439 Bacteria 6486
26 Ga0070708_100001001 3300005445 Bacteria 21596
27 Ga0070708_100004911 3300005445 Bacteria 10565
28 Ga0070708_100048321 3300005445 Bacteria 3760
29 Ga0070708_100072486 3300005445 Bacteria 3103
30 Ga0070678_100014072 3300005456 Bacteria 5034
31 Ga0070706_100001647 3300005467 Bacteria 23233
32 Ga0070706_100005862 3300005467 Bacteria 11650
33 Ga0070706_100028367 3300005467 Bacteria 5154
34 Ga0070707_100001854 3300005468 Bacteria 20311
35 Ga0070707_100033314 3300005468 Bacteria 4912
36 Ga0070707_100061589 3300005468 Bacteria 3599
37 Ga0070698_100000131 3300005471 Bacteria 65450
38 Ga0070698_100000411 3300005471 Bacteria 45572
39 Ga0070698_100060413 3300005471 Unclassified 3825
40 Ga0070699_100000032 3300005518 Bacteria 136937
41 Ga0070699_100005608 3300005518 Bacteria 11008
42 Ga0070699_100009134 3300005518 Bacteria 8596
43 Ga0070699_100036398 3300005518 Bacteria 4258
44 Ga0070697_100000138 3300005536 Bacteria 58927
45 Ga0070697_100001982 3300005536 Bacteria 15677
46 Ga0070697_100005420 3300005536 Bacteria 9827
47 Ga0070697_100007117 3300005536 Bacteria 8698
48 Ga0068853_100001564 3300005539 Bacteria 16664
49 Ga0068853_100025667 3300005539 Unclassified 4945
50 Ga0068855_100013176 3300005563 Bacteria 9973
51 Ga0068855_100067793 3300005563 Bacteria 4155
52 Ga0068856_100006900 3300005614 Bacteria 11105
53 Ga0068852_100000298 3300005616 Bacteria 33369
54 Ga0068852_100019668 3300005616 Bacteria 5350
55 Ga0068852_100022848 3300005616 Bacteria 5023
56 Ga0068859_100020599 3300005617 Bacteria 6617
57 Ga0068863_100035003 3300005841 Bacteria 4784
58 Ga0068860_100037542 3300005843 Unclassified 4638
59 Ga0068860_100133713 3300005843 Unclassified 2381
60 Ga0070717_10000475 3300006028 Bacteria 25585
61 Ga0070717_10006305 3300006028 Bacteria 8712
62 Ga0070717_10014662 3300006028 Bacteria 6031
63 Ga0070717_10027043 3300006028 Bacteria 4583
64 Ga0070717_10033016 3300006028 Bacteria 4173
65 Ga0070717_10036021 3300006028 Bacteria 4011
66 Ga0070717_10077612 3300006028 Unclassified 2782
67 Ga0070715_10023497 3300006163 Bacteria 2416
68 Ga0070716_100001991 3300006173 Bacteria 9310
69 Ga0070716_100006440 3300006173 Bacteria 5736
70 Ga0070716_100021731 3300006173 Unclassified 3384
71 Ga0070716_100037714 3300006173 Bacteria 2672
72 Ga0070712_100000160 3300006175 Bacteria 36252
73 Ga0070712_100001480 3300006175 Bacteria 14328
74 Ga0070712_100006613 3300006175 Bacteria 7203
75 Ga0097621_100023030 3300006237 Bacteria 4843
76 Ga0097621_100037650 3300006237 Bacteria 3878
77 Ga0068871_100041658 3300006358 Bacteria 3683
78 Ga0068871_100056397 3300006358 Bacteria 3193
79 Ga0075436_100002347 3300006914 Bacteria 13060
80 Ga0075436_100008378 3300006914 Bacteria 7070
81 Ga0075436_100015117 3300006914 Bacteria 5290
82 Ga0075436_100071662 3300006914 Unclassified 2396
83 Ga0097620_100020596 3300006931 Bacteria 6617
84 Ga0075435_100005304 3300007076 Bacteria 8979
85 Ga0075435_100063469 3300007076 Unclassified 3000
86 Ga0105240_10058068 3300009093 Bacteria 4831
87 Ga0105245_10000848 3300009098 Bacteria 27707
88 Ga0105245_10037346 3300009098 Bacteria 4318
89 Ga0105245_10065548 3300009098 Unclassified 3285
90 Ga0105241_10000130 3300009174 Bacteria 54301
91 Ga0105241_10006237 3300009174 Bacteria 8789
92 Ga0105248_10001175 3300009177 Bacteria 29272
93 Ga0105248_10024446 3300009177 Bacteria 6716
94 Ga0105248_10116406 3300009177 Unclassified 3015
95 Ga0105237_10009558 3300009545 Bacteria 10382
96 Ga0105237_10052087 3300009545 Bacteria 4110
97 Ga0105238_10000404 3300009551 Bacteria 45968
98 Ga0105246_10021585 3300011119 Unclassified 4145
99 Ga0157369_10006231 3300013105 Bacteria 13844
100 Ga0157374_10022054 3300013296 Bacteria 5676
101 Ga0157374_10057740 3300013296 Unclassified 3625
102 Ga0157378_10005797 3300013297 Bacteria 10826
103 Ga0163162_10011163 3300013306 Bacteria 8751
104 Ga0157372_10002804 3300013307 Bacteria 18824
105 Ga0157372_10006274 3300013307 Bacteria 12646
106 Ga0157372_10008633 3300013307 Bacteria 10824
107 Ga0157372_10017362 3300013307 Bacteria 7725
108 Ga0157372_10038163 3300013307 Bacteria 5301
109 Ga0157372_10067402 3300013307 Bacteria 4022
110 Ga0163163_10092257 3300014325 Bacteria 3043
111 Ga0157379_10009246 3300014968 Bacteria 8584
112 Ga0157379_10048733 3300014968 Bacteria 3782
113 Ga0157376_10040261 3300014969 Unclassified 3818
114 Ga0157376_10075324 3300014969 Bacteria 2880
115 Ga0182007_10005271 3300015262 Bacteria 5706
116 Ga0163161_10022871 3300017792 Unclassified 4404
117 Ga0224572_1000087 3300024225 Bacteria 6660
118 Ga0207692_10000164 3300025898 Bacteria 21214
119 Ga0207647_10000903 3300025904 Bacteria 22977
120 Ga0207699_10053022 3300025906 Unclassified 2403
121 Ga0207645_10049792 3300025907 Unclassified 2675
122 Ga0207705_10025216 3300025909 Bacteria 4245
123 Ga0207684_10000755 3300025910 Bacteria 37749
124 Ga0207684_10002273 3300025910 Bacteria 19563
125 Ga0207684_10002498 3300025910 Bacteria 18498
126 Ga0207654_10000085 3300025911 Bacteria 61970
127 Ga0207654_10021363 3300025911 Bacteria 3442
128 Ga0207707_10086761 3300025912 Unclassified 2735
129 Ga0207695_10001091 3300025913 Bacteria 47315
130 Ga0207695_10002785 3300025913 Bacteria 25452
131 Ga0207695_10011014 3300025913 Bacteria 10987
132 Ga0207671_10004442 3300025914 Bacteria 13403
133 Ga0207671_10047852 3300025914 Bacteria 3165
134 Ga0207693_10000271 3300025915 Bacteria 47827
135 Ga0207693_10002268 3300025915 Bacteria 16728
136 Ga0207693_10005312 3300025915 Bacteria 10761
137 Ga0207693_10008009 3300025915 Bacteria 8677
138 Ga0207663_10001322 3300025916 Bacteria 11454
139 Ga0207663_10001723 3300025916 Bacteria 10272
140 Ga0207657_10013260 3300025919 Bacteria 8086
141 Ga0207649_10003758 3300025920 Bacteria 8282
142 Ga0207646_10000073 3300025922 Bacteria 140267
143 Ga0207646_10000299 3300025922 Bacteria 67366
144 Ga0207694_10000288 3300025924 Bacteria 47464
145 Ga0207687_10081134 3300025927 Unclassified 2343
146 Ga0207700_10000187 3300025928 Bacteria 37186
147 Ga0207700_10045768 3300025928 Bacteria 3232
148 Ga0207700_10078100 3300025928 Unclassified 2574
149 Ga0207664_10010051 3300025929 Bacteria 6668
150 Ga0207664_10010798 3300025929 Bacteria 6463
151 Ga0207664_10015343 3300025929 Bacteria 5555
152 Ga0207664_10042950 3300025929 Unclassified 3533
153 Ga0207664_10080786 3300025929 Unclassified 2643
154 Ga0207664_10098216 3300025929 Bacteria 2414
155 Ga0207644_10065854 3300025931 Bacteria 2636
156 Ga0207706_10021502 3300025933 Bacteria 5794
157 Ga0207706_10028797 3300025933 Bacteria 4958
158 Ga0207704_10019157 3300025938 Bacteria 3589
159 Ga0207665_10002774 3300025939 Bacteria 11737
160 Ga0207665_10012399 3300025939 Bacteria 5599
161 Ga0207665_10016952 3300025939 Unclassified 4783
162 Ga0207665_10025187 3300025939 Unclassified 3925
163 Ga0207665_10027126 3300025939 Bacteria 3784
164 Ga0207691_10019141 3300025940 Bacteria 6481
165 Ga0207711_10034143 3300025941 Unclassified 4308
166 Ga0207689_10000788 3300025942 Bacteria 30435
167 Ga0207661_10077062 3300025944 Unclassified 2741
168 Ga0207667_10017145 3300025949 Bacteria 8164
169 Ga0207667_10025439 3300025949 Bacteria 6477
170 Ga0207640_10058466 3300025981 Bacteria 2540
171 Ga0207703_10027294 3300026035 Bacteria 4496
172 Ga0207639_10000189 3300026041 Bacteria 47705
173 Ga0207639_10029019 3300026041 Unclassified 4046
174 Ga0207702_10012905 3300026078 Bacteria 6948
175 Ga0207702_10074734 3300026078 Unclassified 2926
176 Ga0207641_10016755 3300026088 Bacteria 6002
177 Ga0207676_10097483 3300026095 Unclassified 2429
178 Ga0207683_10003776 3300026121 Bacteria 13134
179 Ga0207698_10000232 3300026142 Bacteria 34820
180 Ga0268264_10014350 3300028381 Bacteria 6515
181 Ga0265338_10011771 3300028800 Bacteria 10058
182 Ga0265338_10033069 3300028800 Bacteria 5028
183 Ga0265338_10034698 3300028800 Unclassified 4870
184 Ga0265338_10050535 3300028800 Bacteria 3757
185 Ga0265338_10062204 3300028800 Bacteria 3264
186 Ga0265762_1000240 3300030760 Bacteria 8904
187 Ga0265762_1002349 3300030760 Unclassified 3423
188 Ga0265760_10002224 3300031090 Bacteria 5672
189 Ga0265760_10004301 3300031090 Unclassified 4090
190 Ga0265330_10002350 3300031235 Bacteria 10358
191 Ga0265330_10002564 3300031235 Bacteria 9866
192 Ga0265325_10000836 3300031241 Bacteria 22274
193 Ga0265325_10010866 3300031241 Bacteria 5248
194 Ga0265325_10010996 3300031241 Bacteria 5212
195 Ga0265316_10001986 3300031344 Bacteria 21534
196 Ga0265316_10003140 3300031344 Bacteria 16813
197 Ga0265316_10003399 3300031344 Bacteria 16107
198 Ga0265316_10031537 3300031344 Bacteria 4332
199 Ga0307408_100010291 3300031548 Bacteria 6168
200 Ga0265313_10010579 3300031595 Bacteria 5815
201 Ga0265314_10003793 3300031711 Bacteria 14434
202 Ga0265314_10054873 3300031711 Unclassified 2755
203 Ga0265342_10002685 3300031712 Bacteria 15134
204 Ga0307410_10001993 3300031852 Bacteria 9615
205 Ga0307410_10038180 3300031852 Unclassified 3144
206 Ga0307407_10066276 3300031903 Bacteria 2129
207 Ga0307409_100000691 3300031995 Bacteria 14984
208 Ga0307416_100002276 3300032002 Bacteria 10943
209 Ga0307411_10053102 3300032005 Bacteria 2653
210 Ga0307415_100009157 3300032126 Bacteria 5530
211 Ga0307415_100012852 3300032126 Bacteria 4860
212 Ga0373923_0022333 3300035111 Bacteria 2480
213 Ga0373945_0019171 3300035116 Unclassified 2333
214 Ga0373955_0030642 3300035172 Unclassified 2811
215 Ga0373924_0000071 3300035410 Bacteria 27188
216 Ga0373935_0004009 3300035692 Bacteria 8603
217 Ga0373935_0045963 3300035692 Bacteria 2756
218 Ga0373935_0064387 3300035692 Unclassified 2351
219 Ga0373947_0015643 3300035725 Unclassified 4359
220 Ga0373947_0025976 3300035725 Bacteria 3417
221 Ga0373947_0069621 3300035725 Bacteria 2154
222 Ga0373947_0081658 3300035725 Bacteria 2002
223 Ga0373937_0013791 3300036401 Bacteria 7121
224 Ga0373937_0038333 3300036401 Unclassified 4367
225 Ga0373937_0100533 3300036401 Bacteria 2684
226 Ga0373925_0014720 3300037068 Bacteria 5651
227 Ga0373925_0035015 3300037068 Unclassified 3702
228 Ga0395905_0022514 3300037471 Bacteria 5960
229 Ga0436364_0343074 3300037853 Unclassified 2972
230 Ga0436363_0319499 3300039450 Bacteria 2869
231 Ga0453684_0000480 3300044712 Bacteria 158630
232 Ga0451576_0002875 3300045051 Bacteria 24636
233 Ga0451576_0063680 3300045051 Unclassified 3843
234 Ga0466967_0020498 3300045976 Bacteria 5347
235 Ga0495629_0029755 3300046459 Bacteria 3872
236 Ga0495580_0000958 3300046472 Bacteria 25283
237 Ga0495580_0001336 3300046472 Bacteria 21734
238 Ga0495580_0002375 3300046472 Bacteria 16435
239 Ga0495582_0000143 3300046473 Bacteria 38449
240 Ga0495582_0002689 3300046473 Bacteria 9924
241 Ga0495639_0018282 3300046475 Unclassified 3050
242 Ga0495664_0022117 3300046477 Bacteria 3681
243 Ga0495594_0013245 3300046499 Bacteria 4303
244 Ga0495665_0001194 3300046531 Bacteria 13831
245 Ga0495586_0035559 3300046535 Bacteria 2676
246 Ga0495586_0061964 3300046535 Bacteria 2036
247 Ga0495635_0038770 3300046663 Bacteria 3298
248 Ga0495674_0003157 3300047319 Bacteria 16005
249 Ga0496101_0030030 3300048904 Bacteria 3806
250 Ga0496102_0064231 3300048905 Unclassified 3362
251 Ga0496104_0045027 3300048907 Unclassified 4148
252 Ga0496104_0064649 3300048907 Bacteria 3470
253 Ga0496105_0079866 3300048908 Bacteria 2701
254 Ga0496108_0006184 3300048911 Bacteria 9689
255 Ga0496108_0081891 3300048911 Bacteria 2736
256 Ga0496109_0044894 3300048912 Bacteria 4010
257 Ga0496111_0008420 3300048914 Bacteria 6825
258 Ga0496111_0033382 3300048914 Unclassified 3670
259 Ga0496112_0023044 3300048915 Bacteria 5942
260 Ga0496112_0030866 3300048915 Bacteria 5192
261 Ga0496112_0035388 3300048915 Bacteria 4864
262 Ga0496112_0035822 3300048915 Bacteria 4836
263 Ga0496113_0001559 3300048916 Bacteria 12865
264 Ga0496113_0046616 3300048916 Bacteria 3218
265 Ga0496114_0021626 3300048917 Bacteria 5235
266 Ga0496115_0028171 3300048918 Bacteria 4401
267 Ga0496126_0003712 3300048929 Bacteria 19041
268 nmdc:mga0n895_151326_c1 3300050512 Bacteria 2351
269 nmdc:mga0rr50_10285_c1 3300050513 Bacteria 5930
270 nmdc:mga0rr50_3575_c1 3300050513 Bacteria 8979
271 nmdc:mga08x19_10173_c1 3300050514 Bacteria 5645
272 nmdc:mga08x19_22258_c1 3300050514 Bacteria 3924
273 nmdc:mga08x19_25008_c1 3300050514 Bacteria 3717
274 nmdc:mga08x19_44380_c1 3300050514 Bacteria 2838
275 Ga0495619_0054406 3300053085 Bacteria 2649
276 Ga0265314_10018703
277 LJNas_1000034
278 LJNas_1000317
279 Ga0070683_100034958
280 Ga0068869_100026364
281 Ga0068868_100023835
282 Ga0070661_100002546
283 Ga0070709_10004874
284 Ga0070709_10005448
285 Ga0070709_10045867
286 Ga0070714_100001161
287 Ga0070714_100010691
288 Ga0070714_100012233
289 Ga0070714_100035987
290 Ga0070714_100074647
291 Ga0070714_100104966
292 Ga0070713_100000421
293 Ga0070713_100009606
294 Ga0070713_100027060
295 Ga0070713_100031416
296 Ga0070713_100073365
297 Ga0070710_10001081
298 Ga0070710_10010310
299 Ga0070711_100006171
300 Ga0070711_100007897
301 Ga0070708_100001001
302 Ga0070708_100004911
303 Ga0070708_100048321
304 Ga0070708_100072486
305 Ga0070678_100014072
306 Ga0070706_100001647
307 Ga0070706_100005862
308 Ga0070706_100028367
309 Ga0070707_100001854
310 Ga0070707_100033314
311 Ga0070707_100061589
312 Ga0070698_100000131
313 Ga0070698_100000411
314 Ga0070698_100060413
315 Ga0070699_100000032
316 Ga0070699_100005608
317 Ga0070699_100009134
318 Ga0070699_100036398
319 Ga0070697_100000138
320 Ga0070697_100001982
321 Ga0070697_100005420
322 Ga0070697_100007117
323 Ga0068853_100001564
324 Ga0068853_100025667
325 Ga0068855_100013176
326 Ga0068855_100067793
327 Ga0068856_100006900
328 Ga0068852_100000298
329 Ga0068852_100019668
330 Ga0068852_100022848
331 Ga0068859_100020599
332 Ga0068863_100035003
333 Ga0068860_100037542
334 Ga0068860_100133713
335 Ga0070717_10000475
336 Ga0070717_10006305
337 Ga0070717_10014662
338 Ga0070717_10027043
339 Ga0070717_10033016
340 Ga0070717_10036021
341 Ga0070717_10077612
342 Ga0070715_10023497
343 Ga0070716_100001991
344 Ga0070716_100006440
345 Ga0070716_100021731
346 Ga0070716_100037714
347 Ga0070712_100000160
348 Ga0070712_100001480
349 Ga0070712_100006613
350 Ga0097621_100023030
351 Ga0097621_100037650
352 Ga0068871_100041658
353 Ga0068871_100056397
354 Ga0075436_100002347
355 Ga0075436_100008378
356 Ga0075436_100015117
357 Ga0075436_100071662
358 Ga0097620_100020596
359 Ga0075435_100005304
360 Ga0075435_100063469
361 Ga0105240_10058068
362 Ga0105245_10000848
363 Ga0105245_10037346
364 Ga0105245_10065548
365 Ga0105241_10000130
366 Ga0105241_10006237
367 Ga0105248_10001175
368 Ga0105248_10024446
369 Ga0105248_10116406
370 Ga0105237_10009558
371 Ga0105237_10052087
372 Ga0105238_10000404
373 Ga0105246_10021585
374 Ga0157369_10006231
375 Ga0157374_10022054
376 Ga0157374_10057740
377 Ga0157378_10005797
378 Ga0163162_10011163
379 Ga0157372_10002804
380 Ga0157372_10006274
381 Ga0157372_10008633
382 Ga0157372_10017362
383 Ga0157372_10038163
384 Ga0157372_10067402
385 Ga0163163_10092257
386 Ga0157379_10009246
387 Ga0157379_10048733
388 Ga0157376_10040261
389 Ga0157376_10075324
390 Ga0182007_10005271
391 Ga0163161_10022871
392 Ga0224572_1000087
393 Ga0207692_10000164
394 Ga0207647_10000903
395 Ga0207699_10053022
396 Ga0207645_10049792
397 Ga0207705_10025216
398 Ga0207684_10000755
399 Ga0207684_10002273
400 Ga0207684_10002498
401 Ga0207654_10000085
402 Ga0207654_10021363
403 Ga0207707_10086761
404 Ga0207695_10001091
405 Ga0207695_10002785
406 Ga0207695_10011014
407 Ga0207671_10004442
408 Ga0207671_10047852
409 Ga0207693_10000271
410 Ga0207693_10002268
411 Ga0207693_10005312
412 Ga0207693_10008009
413 Ga0207663_10001322
414 Ga0207663_10001723
415 Ga0207657_10013260
416 Ga0207649_10003758
417 Ga0207646_10000073
418 Ga0207646_10000299
419 Ga0207694_10000288
420 Ga0207687_10081134
421 Ga0207700_10000187
422 Ga0207700_10045768
423 Ga0207700_10078100
424 Ga0207664_10010051
425 Ga0207664_10010798
426 Ga0207664_10015343
427 Ga0207664_10042950
428 Ga0207664_10080786
429 Ga0207664_10098216
430 Ga0207644_10065854
431 Ga0207706_10021502
432 Ga0207706_10028797
433 Ga0207704_10019157
434 Ga0207665_10002774
435 Ga0207665_10012399
436 Ga0207665_10016952
437 Ga0207665_10025187
438 Ga0207665_10027126
439 Ga0207691_10019141
440 Ga0207711_10034143
441 Ga0207689_10000788
442 Ga0207661_10077062
443 Ga0207667_10017145
444 Ga0207667_10025439
445 Ga0207640_10058466
446 Ga0207703_10027294
447 Ga0207639_10000189
448 Ga0207639_10029019
449 Ga0207702_10012905
450 Ga0207702_10074734
451 Ga0207641_10016755
452 Ga0207676_10097483
453 Ga0207683_10003776
454 Ga0207698_10000232
455 Ga0268264_10014350
456 Ga0265338_10011771
457 Ga0265338_10033069
458 Ga0265338_10034698
459 Ga0265338_10050535
460 Ga0265338_10062204
461 Ga0265762_1000240
462 Ga0265762_1002349
463 Ga0265760_10002224
464 Ga0265760_10004301
465 Ga0265330_10002350
466 Ga0265330_10002564
467 Ga0265325_10000836
468 Ga0265325_10010866
469 Ga0265325_10010996
470 Ga0265316_10001986
471 Ga0265316_10003140
472 Ga0265316_10003399
473 Ga0265316_10031537
474 Ga0307408_100010291
475 Ga0265313_10010579
476 Ga0265314_10003793
477 Ga0265314_10054873
478 Ga0265342_10002685
479 Ga0307410_10001993
480 Ga0307410_10038180
481 Ga0307407_10066276
482 Ga0307409_100000691
483 Ga0307416_100002276
484 Ga0307411_10053102
485 Ga0307415_100009157
486 Ga0307415_100012852
487 Ga0373923_0022333
488 Ga0373945_0019171
489 Ga0373955_0030642
490 Ga0373924_0000071
491 Ga0373935_0004009
492 Ga0373935_0045963
493 Ga0373935_0064387
494 Ga0373947_0015643
495 Ga0373947_0025976
496 Ga0373947_0069621
497 Ga0373947_0081658
498 Ga0373937_0013791
499 Ga0373937_0038333
500 Ga0373937_0100533
501 Ga0373925_0014720
502 Ga0373925_0035015
503 Ga0395905_0022514
504 Ga0436364_0343074
505 Ga0436363_0319499
506 Ga0453684_0000480
507 Ga0451576_0002875
508 Ga0451576_0063680
509 Ga0466967_0020498
510 Ga0495629_0029755
511 Ga0495580_0000958
512 Ga0495580_0001336
513 Ga0495580_0002375
514 Ga0495582_0000143
515 Ga0495582_0002689
516 Ga0495639_0018282
517 Ga0495664_0022117
518 Ga0495594_0013245
519 Ga0495665_0001194
520 Ga0495586_0035559
521 Ga0495586_0061964
522 Ga0495635_0038770
523 Ga0495674_0003157
524 Ga0496101_0030030
525 Ga0496102_0064231
526 Ga0496104_0045027
527 Ga0496104_0064649
528 Ga0496105_0079866
529 Ga0496108_0006184
530 Ga0496108_0081891
531 Ga0496109_0044894
532 Ga0496111_0008420
533 Ga0496111_0033382
534 Ga0496112_0023044
535 Ga0496112_0030866
536 Ga0496112_0035388
537 Ga0496112_0035822
538 Ga0496113_0001559
539 Ga0496113_0046616
540 Ga0496114_0021626
541 Ga0496115_0028171
542 Ga0496126_0003712
543 nmdc:mga0n895_151326_c1
544 nmdc:mga0rr50_10285_c1
545 nmdc:mga0rr50_3575_c1
546 nmdc:mga08x19_10173_c1
547 nmdc:mga08x19_22258_c1
548 nmdc:mga08x19_25008_c1
549 nmdc:mga08x19_44380_c1
550 Ga0495619_0054406

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02321

OEP

Outer membrane efflux protein

453

661

0.96

PF02321

OEP

Outer membrane efflux protein

254

423

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wp1-assembly2.cif.gz_B crystal structure of the drug-discharge outer membrane protein, oprm 0.783 107 577
4mh6-assembly1.cif.gz_A 2.8 angstrom crystal structure of type iii secretion protein ysco from vibrio parahaemolyticus 0.7634 227 332
6wxh-assembly1.cif.gz_B colicin e1 fragment in nanodisc-embedded tolc 0.7387 105 591
7ng9-assembly1.cif.gz_A trimeric efflux pump klebsiella tolc 0.7211 107 592
1ek9-assembly1.cif.gz_A 2.1a x-ray structure of tolc: an integral outer membrane protein and efflux pump component from escherichia coli 0.7209 105 592
ID Description Score Start End Superfamily
3mxzA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8072 252 343 1.20.58.90
4k7rA01 Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.7999 229 576 1.20.1600.10
5azsA01 Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.7866 226 576 1.20.1600.10
1wp1B01 Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.7838 107 577 1.20.1600.10
af_O04350_1_113_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7668 256 343 1.20.58.90
ID Description Score Start End GO Terms
AF-S7VUJ9-F1-model_v4 Multidrug efflux protein, outer membrane component 0.8603 382 575 GO:0015562
AF-A0A257U572-F1-model_v4 Transporter 0.8526 374 575 GO:0015562
AF-A0A1G1HZX6-F1-model_v4 Transporter 0.8486 227 586 GO:0009279
GO:0015562
AF-A0A3S0CAC0-F1-model_v4 Efflux transporter outer membrane subunit 0.8239 227 578 GO:0005886
GO:0015562
AF-A0A0J6YV16-F1-model_v4 deleted 0.8104 228 577

Map