F385561

General Info

Members Datasets Scaffolds Average Seq Length
283 144 566 532

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10031466|Ga0157369_100314664
Length 566
Sequence MTIETIRSHLSVPEEKRMATAVATLPEKASSPPKPSARKLAPRRTVNPWVIAGTVTLATFMELLDTSIANVSLPYIAGGLGRSFDEVTWILTTYLVANAVVLPMSAWLSRAFGRKNYYMACVALFTVTSFFCGIAPSLTAMLIARVLQGIGGGGLAPVEQAILVDTFPPEKRASAFALYTVAIVTAPAIGPVLGGWITDNFNWRWVFLINIPIGLLSIFLTSRVVHDPESFAEERKTIRDERGKLRMDGVGISLIALGSAALEVLLDRGQIDDWFGSNFILWMFVVAVVCLTAAVFWELRSPDPVVDFRLLKIPNFAIANFFYFLFGVGLFASTTSIPQILQSLYGYRAIDAGLVLGPGAFVITLLAPVGAQLVQRGVIHPKKLMFGAVIVVGMSFLHFGRMTLQADYSHYAWARAYQGLGYAFFFVPLTVIAYSQLTPEQNNKASSLTNFFRNWGGSFGIALATTVSERRQNFHQTTVGATISGSSSWLQSNVQQASAYLQAHGYSAADAAKLAYARYYAQLEAQTRFLGFMDCFWVIGVLTLVAAPIVLLTRNFKVSGGPAGGH

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
54 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
83 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
84 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
89 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
90 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
91 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
92 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
93 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
94 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
95 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
96 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
97 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
106 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
107 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
110 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
111 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
120 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
125 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
141 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
142 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
143 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
144 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.77
Nodule 0
Rhizoplane 1.77
Rhizosphere 90.81
Stem 0
Stem Tuber 0
Unclassified 7.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10031466 3300013105 Bacteria 5842
2 rootH2_10063688 3300003320 Bacteria 4289
3 Ga0070658_10000004 3300005327 Bacteria 402230
4 Ga0070658_10003306 3300005327 Bacteria 13298
5 Ga0070658_10124760 3300005327 Bacteria 2142
6 Ga0070670_100180778 3300005331 Bacteria 1831
7 Ga0070666_10007672 3300005335 Bacteria 6661
8 Ga0070660_100011634 3300005339 Bacteria 6263
9 Ga0070671_100012190 3300005355 Bacteria 6918
10 Ga0070671_100038793 3300005355 Bacteria 3953
11 Ga0070671_100042146 3300005355 Bacteria 3794
12 Ga0070667_100053361 3300005367 Bacteria 3412
13 Ga0070709_10001995 3300005434 Bacteria 11109
14 Ga0070709_10035330 3300005434 Bacteria 3037
15 Ga0070714_100036741 3300005435 Bacteria 4110
16 Ga0070713_100007513 3300005436 Bacteria 7658
17 Ga0070713_100056116 3300005436 Bacteria 3276
18 Ga0070711_100020927 3300005439 Bacteria 4224
19 Ga0070708_100037162 3300005445 Bacteria 4247
20 Ga0070708_100066859 3300005445 Unclassified 3226
21 Ga0070663_100002026 3300005455 Bacteria 11321
22 Ga0070681_10030595 3300005458 Bacteria 5402
23 Ga0070706_100002043 3300005467 Bacteria 20684
24 Ga0070706_100022296 3300005467 Bacteria 5831
25 Ga0070706_100032212 3300005467 Unclassified 4835
26 Ga0070706_100104563 3300005467 Unclassified 2634
27 Ga0070707_100005186 3300005468 Bacteria 12207
28 Ga0070707_100012114 3300005468 Bacteria 8049
29 Ga0070707_100015865 3300005468 Bacteria 7071
30 Ga0070698_100003345 3300005471 Bacteria 17652
31 Ga0070698_100004313 3300005471 Bacteria 15642
32 Ga0070698_100005186 3300005471 Bacteria 14250
33 Ga0070698_100008268 3300005471 Bacteria 11251
34 Ga0070698_100064350 3300005471 Bacteria 3695
35 Ga0070699_100006498 3300005518 Bacteria 10181
36 Ga0070699_100074918 3300005518 Unclassified 2945
37 Ga0070699_100090825 3300005518 Bacteria 2670
38 Ga0070679_100001643 3300005530 Bacteria 20136
39 Ga0070697_100012078 3300005536 Bacteria 6761
40 Ga0070697_100022660 3300005536 Bacteria 4988
41 Ga0070697_100047918 3300005536 Unclassified 3465
42 Ga0070697_100096046 3300005536 Bacteria 2458
43 Ga0068853_100014590 3300005539 Bacteria 6443
44 Ga0068853_100067244 3300005539 Bacteria 3113
45 Ga0070665_100010120 3300005548 Bacteria 9539
46 Ga0070665_100016008 3300005548 Bacteria 7529
47 Ga0070665_100056808 3300005548 Bacteria 3924
48 Ga0070665_100189741 3300005548 Unclassified 2056
49 Ga0068855_100002110 3300005563 Bacteria 24594
50 Ga0068855_100003064 3300005563 Bacteria 20447
51 Ga0068855_100061603 3300005563 Bacteria 4383
52 Ga0068855_100095107 3300005563 Bacteria 3434
53 Ga0068857_100023049 3300005577 Bacteria 5476
54 Ga0068852_100042298 3300005616 Bacteria 3857
55 Ga0068859_100063085 3300005617 Bacteria 3736
56 Ga0068864_100003705 3300005618 Bacteria 12618
57 Ga0068863_100002405 3300005841 Bacteria 18588
58 Ga0068863_100019192 3300005841 Bacteria 6545
59 Ga0081540_1000965 3300005983 Bacteria 25934
60 Ga0081540_1012004 3300005983 Bacteria 5738
61 Ga0081540_1014357 3300005983 Bacteria 5076
62 Ga0070717_10014351 3300006028 Bacteria 6094
63 Ga0070712_100050941 3300006175 Bacteria 2883
64 Ga0070712_100088146 3300006175 Bacteria 2266
65 Ga0097620_100063085 3300006931 Bacteria 3736
66 Ga0075435_100034337 3300007076 Unclassified 4018
67 Ga0099794_10004763 3300007265 Bacteria 5378
68 Ga0099794_10015180 3300007265 Unclassified 3394
69 Ga0099794_10015503 3300007265 Bacteria 3366
70 Ga0105240_10000025 3300009093 Bacteria 367124
71 Ga0105240_10004838 3300009093 Bacteria 20291
72 Ga0105240_10006560 3300009093 Bacteria 17087
73 Ga0105240_10015597 3300009093 Bacteria 10324
74 Ga0105240_10279649 3300009093 Bacteria 1918
75 Ga0105241_10023286 3300009174 Bacteria 4592
76 Ga0105248_10000004 3300009177 Bacteria 695244
77 Ga0105248_10001175 3300009177 Bacteria 29272
78 Ga0105248_10005278 3300009177 Bacteria 14219
79 Ga0105248_10012456 3300009177 Bacteria 9381
80 Ga0105248_10014812 3300009177 Bacteria 8589
81 Ga0105237_10036097 3300009545 Bacteria 5000
82 Ga0105237_10115280 3300009545 Bacteria 2680
83 Ga0105238_10001313 3300009551 Bacteria 24953
84 Ga0105238_10012040 3300009551 Bacteria 8714
85 Ga0105238_10134973 3300009551 Bacteria 2445
86 Ga0105239_10002247 3300010375 Bacteria 24690
87 Ga0157371_10095418 3300013102 Bacteria 2108
88 Ga0157370_10023828 3300013104 Bacteria 6073
89 Ga0157370_10033762 3300013104 Bacteria 4987
90 Ga0157370_10042673 3300013104 Bacteria 4369
91 Ga0157370_10134516 3300013104 Bacteria 2305
92 Ga0157369_10008459 3300013105 Bacteria 11803
93 Ga0157369_10019549 3300013105 Bacteria 7578
94 Ga0157369_10027533 3300013105 Bacteria 6299
95 Ga0157369_10049285 3300013105 Bacteria 4567
96 Ga0157369_10237841 3300013105 Bacteria 1902
97 Ga0157374_10007351 3300013296 Bacteria 9391
98 Ga0157374_10011652 3300013296 Bacteria 7624
99 Ga0157374_10094294 3300013296 Unclassified 2860
100 Ga0157374_10194183 3300013296 Bacteria 1986
101 Ga0157374_10207991 3300013296 Bacteria 1918
102 Ga0157378_10003911 3300013297 Bacteria 13200
103 Ga0163162_10000119 3300013306 Bacteria 69465
104 Ga0157372_10029931 3300013307 Bacteria 5950
105 Ga0157372_10033948 3300013307 Bacteria 5606
106 Ga0157372_10079608 3300013307 Bacteria 3706
107 Ga0157372_10322694 3300013307 Bacteria 1798
108 Ga0163163_10047668 3300014325 Bacteria 4212
109 Ga0157379_10011182 3300014968 Bacteria 7822
110 Ga0157379_10087009 3300014968 Bacteria 2802
111 Ga0157379_10101935 3300014968 Bacteria 2576
112 Ga0213872_10000353 3300021361 Bacteria 38783
113 Ga0213872_10010549 3300021361 Bacteria 4393
114 Ga0213876_10002113 3300021384 Bacteria 11753
115 Ga0213875_10002766 3300021388 Bacteria 10354
116 Ga0213871_10002375 3300021441 Bacteria 3456
117 Ga0213871_10011092 3300021441 Unclassified 2060
118 Ga0228598_1004893 3300024227 Bacteria 2819
119 Ga0209233_1000895 3300025261 Bacteria 13010
120 Ga0207647_10001625 3300025904 Bacteria 17285
121 Ga0207647_10024764 3300025904 Bacteria 3954
122 Ga0207699_10006684 3300025906 Bacteria 5595
123 Ga0207705_10000024 3300025909 Bacteria 259977
124 Ga0207705_10006332 3300025909 Bacteria 8785
125 Ga0207705_10011501 3300025909 Bacteria 6400
126 Ga0207705_10014549 3300025909 Bacteria 5661
127 Ga0207684_10004495 3300025910 Bacteria 13113
128 Ga0207684_10029521 3300025910 Unclassified 4669
129 Ga0207684_10046570 3300025910 Unclassified 3679
130 Ga0207684_10047203 3300025910 Bacteria 3653
131 Ga0207684_10072533 3300025910 Bacteria 2924
132 Ga0207684_10125458 3300025910 Bacteria 2203
133 Ga0207684_10134238 3300025910 Unclassified 2125
134 Ga0207695_10000025 3300025913 Bacteria 627211
135 Ga0207695_10000242 3300025913 Bacteria 142011
136 Ga0207695_10003177 3300025913 Bacteria 23406
137 Ga0207695_10035167 3300025913 Bacteria 5437
138 Ga0207663_10003160 3300025916 Bacteria 8007
139 Ga0207646_10002126 3300025922 Bacteria 23685
140 Ga0207646_10003273 3300025922 Bacteria 18450
141 Ga0207646_10124830 3300025922 Bacteria 2314
142 Ga0207694_10001321 3300025924 Bacteria 21324
143 Ga0207694_10014377 3300025924 Bacteria 5966
144 Ga0207700_10005277 3300025928 Bacteria 7707
145 Ga0207700_10032158 3300025928 Bacteria 3738
146 Ga0207664_10010997 3300025929 Bacteria 6409
147 Ga0207644_10020995 3300025931 Bacteria 4446
148 Ga0207665_10005351 3300025939 Bacteria 8572
149 Ga0207665_10034761 3300025939 Bacteria 3344
150 Ga0207665_10038053 3300025939 Unclassified 3202
151 Ga0207711_10000008 3300025941 Bacteria 597686
152 Ga0207711_10000010 3300025941 Bacteria 557970
153 Ga0207711_10007960 3300025941 Bacteria 8865
154 Ga0207711_10030977 3300025941 Bacteria 4512
155 Ga0207711_10098218 3300025941 Bacteria 2587
156 Ga0207711_10172074 3300025941 Bacteria 1965
157 Ga0207661_10060565 3300025944 Bacteria 3055
158 Ga0207667_10001688 3300025949 Bacteria 27790
159 Ga0207667_10003562 3300025949 Bacteria 19246
160 Ga0207667_10217712 3300025949 Bacteria 1957
161 Ga0207639_10005821 3300026041 Bacteria 8353
162 Ga0207678_10007131 3300026067 Bacteria 9914
163 Ga0207674_10012446 3300026116 Bacteria 9507
164 Ga0209179_1001751 3300027512 Bacteria 2760
165 Ga0209588_1013090 3300027671 Unclassified 2526
166 Ga0209588_1015808 3300027671 Bacteria 2323
167 Ga0268266_10009120 3300028379 Bacteria 8753
168 Ga0268266_10032008 3300028379 Bacteria 4468
169 Ga0268266_10144794 3300028379 Bacteria 2135
170 Ga0268266_10155522 3300028379 Unclassified 2065
171 Ga0265314_10000737 3300031711 Bacteria 39300
172 Ga0373926_0006824 3300035083 Bacteria 3795
173 Ga0373927_0013760 3300035695 Bacteria 5371
174 Ga0373925_0000166 3300037068 Bacteria 71445
175 Ga0436364_0034772 3300037853 Bacteria 3985
176 Ga0436364_0471780 3300037853 Bacteria 2655
177 Ga0436365_0194972 3300039437 Bacteria 39396
178 Ga0436365_0889692 3300039437 Bacteria 98713
179 Ga0436365_1332416 3300039437 Bacteria 4615
180 Ga0436360_0034275 3300039438 Bacteria 5145
181 Ga0436360_0243486 3300039438 Bacteria 5027
182 Ga0436360_0904054 3300039438 Bacteria 2241
183 Ga0436360_1010263 3300039438 Bacteria 5535
184 Ga0436361_0006608 3300039447 Bacteria 13614
185 Ga0436361_0067543 3300039447 Bacteria 3299
186 Ga0436361_0216966 3300039447 Bacteria 8008
187 Ga0436361_0304268 3300039447 Bacteria 1587
188 Ga0436361_0340895 3300039447 Bacteria 2353
189 Ga0436361_0458299 3300039447 Bacteria 5998
190 Ga0436361_0697882 3300039447 Bacteria 3129
191 Ga0436361_0844091 3300039447 Bacteria 4893
192 Ga0436361_0850643 3300039447 Bacteria 10567
193 Ga0436361_0935981 3300039447 Bacteria 10356
194 Ga0436361_1089336 3300039447 Bacteria 150546
195 Ga0436361_1207349 3300039447 Bacteria 3476
196 Ga0436363_1111989 3300039450 Bacteria 9915
197 Ga0436363_1227360 3300039450 Bacteria 7344
198 Ga0466966_0024887 3300044684 Bacteria 3915
199 Ga0495629_0027457 3300046459 Bacteria 4041
200 Ga0495650_0000029 3300046471 Bacteria 453466
201 Ga0495580_0063653 3300046472 Bacteria 2586
202 Ga0495582_0047130 3300046473 Unclassified 2373
203 Ga0495662_0002513 3300046476 Bacteria 9253
204 Ga0495664_0000339 3300046477 Bacteria 22610
205 Ga0495664_0053177 3300046477 Bacteria 2408
206 Ga0495594_0000318 3300046499 Bacteria 23849
207 Ga0495594_0001061 3300046499 Bacteria 14320
208 Ga0495594_0003124 3300046499 Bacteria 8568
209 Ga0495583_0019984 3300046506 Bacteria 3482
210 Ga0495644_0000137 3300046523 Bacteria 35150
211 Ga0495666_0043585 3300046526 Bacteria 2167
212 Ga0495642_0008241 3300046528 Bacteria 3986
213 Ga0495652_0110238 3300046529 Bacteria 2214
214 Ga0495665_0000571 3300046531 Bacteria 18738
215 Ga0495640_0018964 3300046533 Bacteria 5088
216 Ga0495640_0024385 3300046533 Bacteria 4401
217 Ga0495586_0004528 3300046535 Bacteria 7426
218 Ga0495645_0014200 3300046543 Bacteria 5647
219 Ga0495645_0086500 3300046543 Bacteria 2243
220 Ga0495667_0003151 3300046559 Bacteria 11065
221 Ga0495625_0003947 3300046660 Bacteria 14258
222 Ga0495625_0092987 3300046660 Bacteria 2083
223 Ga0495635_0023494 3300046663 Unclassified 4295
224 Ga0495599_0068229 3300046678 Bacteria 2220
225 Ga0495646_0011709 3300046680 Bacteria 5576
226 Ga0495646_0016572 3300046680 Unclassified 4678
227 Ga0495613_0014085 3300046689 Bacteria 5932
228 Ga0495613_0130021 3300046689 Bacteria 1803
229 Ga0495624_0084170 3300046690 Bacteria 1966
230 Ga0495600_0008096 3300046809 Bacteria 6448
231 Ga0495600_0099178 3300046809 Bacteria 1899
232 Ga0495581_0017224 3300047315 Unclassified 4198
233 Ga0495581_0061098 3300047315 Bacteria 2177
234 Ga0495604_0030345 3300047317 Bacteria 4293
235 Ga0495674_0017015 3300047319 Bacteria 6776
236 Ga0495674_0038497 3300047319 Bacteria 4291
237 Ga0495672_0001374 3300047320 Bacteria 24058
238 Ga0495676_0029387 3300047321 Unclassified 4680
239 Ga0495680_0134705 3300047322 Bacteria 1812
240 Ga0495675_0027703 3300047444 Bacteria 3612
241 Ga0495675_0028160 3300047444 Bacteria 3582
242 Ga0495686_0000027 3300047472 Bacteria 382657
243 Ga0495686_0003474 3300047472 Bacteria 13624
244 Ga0495686_0004394 3300047472 Bacteria 11616
245 Ga0495686_0008074 3300047472 Bacteria 7790
246 Ga0495686_0014720 3300047472 Bacteria 5376
247 Ga0495686_0016969 3300047472 Bacteria 4918
248 Ga0495593_0034366 3300047673 Bacteria 2758
249 Ga0495614_0001004 3300048089 Bacteria 12038
250 Ga0496104_0000053 3300048907 Bacteria 135895
251 Ga0496104_0000788 3300048907 Bacteria 27146
252 Ga0496104_0090923 3300048907 Bacteria 2917
253 Ga0496113_0100995 3300048916 Bacteria 2236
254 Ga0496115_0021196 3300048918 Bacteria 5018
255 Ga0496126_0000063 3300048929 Bacteria 256841
256 Ga0496126_0000092 3300048929 Bacteria 209156
257 Ga0496126_0000820 3300048929 Bacteria 55350
258 Ga0496126_0003596 3300048929 Bacteria 19416
259 Ga0496126_0019959 3300048929 Bacteria 6585
260 Ga0496126_0048854 3300048929 Bacteria 3864
261 Ga0501032_0008837 3300049569 Bacteria 7325
262 Ga0501033_0002857 3300049570 Bacteria 14475
263 Ga0501034_0005077 3300049571 Bacteria 14458
264 Ga0501036_0001201 3300049572 Bacteria 19757
265 Ga0501037_0001601 3300049573 Bacteria 16447
266 Ga0501038_0017384 3300049574 Bacteria 6500
267 Ga0501039_0053192 3300049575 Bacteria 3133
268 Ga0501043_0005208 3300049579 Bacteria 10521
269 Ga0501046_0000278 3300049580 Bacteria 51928
270 Ga0501047_0000362 3300049581 Bacteria 51540
271 Ga0501047_0087802 3300049581 Bacteria 2987
272 Ga0501073_0003228 3300049589 Bacteria 12237
273 Ga0501080_0007310 3300049742 Bacteria 9964
274 Ga0501035_0003493 3300049822 Bacteria 15034
275 Ga0501044_0008955 3300049823 Bacteria 10940
276 Ga0501044_0250610 3300049823 Bacteria 1712
277 nmdc:mga00v17_52668_c1 3300050491 Bacteria 2168
278 nmdc:mga08x19_105900_c1 3300050514 Bacteria 1871
279 Ga0495601_0072268 3300053077 Bacteria 2204
280 Ga0500651_0000134 3300053093 Bacteria 46013
281 Ga0500595_000014 3300053119 Bacteria 247996
282 Ga0500595_013532 3300053119 Bacteria 3123
283 2884215954 2884215851 Bacteria 4554841
284 Ga0157369_10031466
285 rootH2_10063688
286 Ga0070658_10000004
287 Ga0070658_10003306
288 Ga0070658_10124760
289 Ga0070670_100180778
290 Ga0070666_10007672
291 Ga0070660_100011634
292 Ga0070671_100012190
293 Ga0070671_100038793
294 Ga0070671_100042146
295 Ga0070667_100053361
296 Ga0070709_10001995
297 Ga0070709_10035330
298 Ga0070714_100036741
299 Ga0070713_100007513
300 Ga0070713_100056116
301 Ga0070711_100020927
302 Ga0070708_100037162
303 Ga0070708_100066859
304 Ga0070663_100002026
305 Ga0070681_10030595
306 Ga0070706_100002043
307 Ga0070706_100022296
308 Ga0070706_100032212
309 Ga0070706_100104563
310 Ga0070707_100005186
311 Ga0070707_100012114
312 Ga0070707_100015865
313 Ga0070698_100003345
314 Ga0070698_100004313
315 Ga0070698_100005186
316 Ga0070698_100008268
317 Ga0070698_100064350
318 Ga0070699_100006498
319 Ga0070699_100074918
320 Ga0070699_100090825
321 Ga0070679_100001643
322 Ga0070697_100012078
323 Ga0070697_100022660
324 Ga0070697_100047918
325 Ga0070697_100096046
326 Ga0068853_100014590
327 Ga0068853_100067244
328 Ga0070665_100010120
329 Ga0070665_100016008
330 Ga0070665_100056808
331 Ga0070665_100189741
332 Ga0068855_100002110
333 Ga0068855_100003064
334 Ga0068855_100061603
335 Ga0068855_100095107
336 Ga0068857_100023049
337 Ga0068852_100042298
338 Ga0068859_100063085
339 Ga0068864_100003705
340 Ga0068863_100002405
341 Ga0068863_100019192
342 Ga0081540_1000965
343 Ga0081540_1012004
344 Ga0081540_1014357
345 Ga0070717_10014351
346 Ga0070712_100050941
347 Ga0070712_100088146
348 Ga0097620_100063085
349 Ga0075435_100034337
350 Ga0099794_10004763
351 Ga0099794_10015180
352 Ga0099794_10015503
353 Ga0105240_10000025
354 Ga0105240_10004838
355 Ga0105240_10006560
356 Ga0105240_10015597
357 Ga0105240_10279649
358 Ga0105241_10023286
359 Ga0105248_10000004
360 Ga0105248_10001175
361 Ga0105248_10005278
362 Ga0105248_10012456
363 Ga0105248_10014812
364 Ga0105237_10036097
365 Ga0105237_10115280
366 Ga0105238_10001313
367 Ga0105238_10012040
368 Ga0105238_10134973
369 Ga0105239_10002247
370 Ga0157371_10095418
371 Ga0157370_10023828
372 Ga0157370_10033762
373 Ga0157370_10042673
374 Ga0157370_10134516
375 Ga0157369_10008459
376 Ga0157369_10019549
377 Ga0157369_10027533
378 Ga0157369_10049285
379 Ga0157369_10237841
380 Ga0157374_10007351
381 Ga0157374_10011652
382 Ga0157374_10094294
383 Ga0157374_10194183
384 Ga0157374_10207991
385 Ga0157378_10003911
386 Ga0163162_10000119
387 Ga0157372_10029931
388 Ga0157372_10033948
389 Ga0157372_10079608
390 Ga0157372_10322694
391 Ga0163163_10047668
392 Ga0157379_10011182
393 Ga0157379_10087009
394 Ga0157379_10101935
395 Ga0213872_10000353
396 Ga0213872_10010549
397 Ga0213876_10002113
398 Ga0213875_10002766
399 Ga0213871_10002375
400 Ga0213871_10011092
401 Ga0228598_1004893
402 Ga0209233_1000895
403 Ga0207647_10001625
404 Ga0207647_10024764
405 Ga0207699_10006684
406 Ga0207705_10000024
407 Ga0207705_10006332
408 Ga0207705_10011501
409 Ga0207705_10014549
410 Ga0207684_10004495
411 Ga0207684_10029521
412 Ga0207684_10046570
413 Ga0207684_10047203
414 Ga0207684_10072533
415 Ga0207684_10125458
416 Ga0207684_10134238
417 Ga0207695_10000025
418 Ga0207695_10000242
419 Ga0207695_10003177
420 Ga0207695_10035167
421 Ga0207663_10003160
422 Ga0207646_10002126
423 Ga0207646_10003273
424 Ga0207646_10124830
425 Ga0207694_10001321
426 Ga0207694_10014377
427 Ga0207700_10005277
428 Ga0207700_10032158
429 Ga0207664_10010997
430 Ga0207644_10020995
431 Ga0207665_10005351
432 Ga0207665_10034761
433 Ga0207665_10038053
434 Ga0207711_10000008
435 Ga0207711_10000010
436 Ga0207711_10007960
437 Ga0207711_10030977
438 Ga0207711_10098218
439 Ga0207711_10172074
440 Ga0207661_10060565
441 Ga0207667_10001688
442 Ga0207667_10003562
443 Ga0207667_10217712
444 Ga0207639_10005821
445 Ga0207678_10007131
446 Ga0207674_10012446
447 Ga0209179_1001751
448 Ga0209588_1013090
449 Ga0209588_1015808
450 Ga0268266_10009120
451 Ga0268266_10032008
452 Ga0268266_10144794
453 Ga0268266_10155522
454 Ga0265314_10000737
455 Ga0373926_0006824
456 Ga0373927_0013760
457 Ga0373925_0000166
458 Ga0436364_0034772
459 Ga0436364_0471780
460 Ga0436365_0194972
461 Ga0436365_0889692
462 Ga0436365_1332416
463 Ga0436360_0034275
464 Ga0436360_0243486
465 Ga0436360_0904054
466 Ga0436360_1010263
467 Ga0436361_0006608
468 Ga0436361_0067543
469 Ga0436361_0216966
470 Ga0436361_0304268
471 Ga0436361_0340895
472 Ga0436361_0458299
473 Ga0436361_0697882
474 Ga0436361_0844091
475 Ga0436361_0850643
476 Ga0436361_0935981
477 Ga0436361_1089336
478 Ga0436361_1207349
479 Ga0436363_1111989
480 Ga0436363_1227360
481 Ga0466966_0024887
482 Ga0495629_0027457
483 Ga0495650_0000029
484 Ga0495580_0063653
485 Ga0495582_0047130
486 Ga0495662_0002513
487 Ga0495664_0000339
488 Ga0495664_0053177
489 Ga0495594_0000318
490 Ga0495594_0001061
491 Ga0495594_0003124
492 Ga0495583_0019984
493 Ga0495644_0000137
494 Ga0495666_0043585
495 Ga0495642_0008241
496 Ga0495652_0110238
497 Ga0495665_0000571
498 Ga0495640_0018964
499 Ga0495640_0024385
500 Ga0495586_0004528
501 Ga0495645_0014200
502 Ga0495645_0086500
503 Ga0495667_0003151
504 Ga0495625_0003947
505 Ga0495625_0092987
506 Ga0495635_0023494
507 Ga0495599_0068229
508 Ga0495646_0011709
509 Ga0495646_0016572
510 Ga0495613_0014085
511 Ga0495613_0130021
512 Ga0495624_0084170
513 Ga0495600_0008096
514 Ga0495600_0099178
515 Ga0495581_0017224
516 Ga0495581_0061098
517 Ga0495604_0030345
518 Ga0495674_0017015
519 Ga0495674_0038497
520 Ga0495672_0001374
521 Ga0495676_0029387
522 Ga0495680_0134705
523 Ga0495675_0027703
524 Ga0495675_0028160
525 Ga0495686_0000027
526 Ga0495686_0003474
527 Ga0495686_0004394
528 Ga0495686_0008074
529 Ga0495686_0014720
530 Ga0495686_0016969
531 Ga0495593_0034366
532 Ga0495614_0001004
533 Ga0496104_0000053
534 Ga0496104_0000788
535 Ga0496104_0090923
536 Ga0496113_0100995
537 Ga0496115_0021196
538 Ga0496126_0000063
539 Ga0496126_0000092
540 Ga0496126_0000820
541 Ga0496126_0003596
542 Ga0496126_0019959
543 Ga0496126_0048854
544 Ga0501032_0008837
545 Ga0501033_0002857
546 Ga0501034_0005077
547 Ga0501036_0001201
548 Ga0501037_0001601
549 Ga0501038_0017384
550 Ga0501039_0053192
551 Ga0501043_0005208
552 Ga0501046_0000278
553 Ga0501047_0000362
554 Ga0501047_0087802
555 Ga0501073_0003228
556 Ga0501080_0007310
557 Ga0501035_0003493
558 Ga0501044_0008955
559 Ga0501044_0250610
560 nmdc:mga00v17_52668_c1
561 nmdc:mga08x19_105900_c1
562 Ga0495601_0072268
563 Ga0500651_0000134
564 Ga0500595_000014
565 Ga0500595_013532
566 2884215954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

55

461

0.88

PF00083

Sugar_tr

Sugar (and other) transporter

50

257

0.86

PF06609

TRI12

Fungal trichothecene efflux pump (TRI12)

9

312

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.8688 10 532
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.8574 10 532
7ckr-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. 0.8566 23 527
8pnl-assembly1.cif.gz_A outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.8538 22 529
8pnl-assembly1.cif.gz_A outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.8489 22 529
ID Description Score Start End Superfamily
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9733 27 203 1.20.1250.20
af_Q04301_34_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9457 21 199 1.20.1250.20
af_Q04301_34_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9407 21 199 1.20.1250.20
af_P76269_18_258_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.939 27 278 1.20.1250.20
af_P9WG89_46_282_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.937 28 270 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3C0UV67-F1-model_v4 MFS transporter 0.9571 22 249 GO:0005886
GO:0022857
AF-A0A2K2TJ46-F1-model_v4 MFS transporter 0.9508 22 160 GO:0005886
GO:0022857
AF-A0A3C0UV67-F1-model_v4 MFS transporter 0.9446 22 249 GO:0005886
GO:0022857
AF-A0A132T9A8-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9441 24 196 GO:0016020
GO:0022857
AF-A0A377BKL3-F1-model_v4 Bcr/CflA family efflux transporter 0.9402 25 196 GO:0005886
GO:0042910
GO:1990961

Map