F385409

General Info

Members Datasets Scaffolds Average Seq Length
283 200 280 245

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100622522|Ga0070714_1006225221
Length 291
Sequence MNLFRVQFHLLTGSECGAAQRNSPETPLITTWQRALALIYRTHEGRTVMGKLEGKVAVITAATSGMALATAKLFVKEGAYVFITGRRKDKLHEAVKLIGKNATGVQGDASNLADLDRLYDTVKREKGKIDILFASAGQGELAKLEEVTEAHFDKTFDLNVRGNLFTVQKALPLFNDNGSIFLNGSIASIKGFPAFGVYSASKAAVRSFARTWLVELKERRIRVNILSPGTIDTPILDPLGPDAKEFFKSQIPRGEMGHPEEIATVALFLASSDSSFVNGIELFVDGGTAQI

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
3 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
94 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
95 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
96 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
97 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
144 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
145 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
146 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
150 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
158 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
172 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
173 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
183 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
200 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.88
Metatranscriptomes 1.06
Isolates 1.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.77
Nodule 0
Rhizoplane 3.89
Rhizosphere 90.46
Stem 0
Stem Tuber 0
Unclassified 3.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000059 3300002773 Bacteria 73065
2 rootH1_10111830 3300003316 Bacteria 6029
3 Ga0065712_10070220 3300005290 Bacteria 6193
4 Ga0065715_10004694 3300005293 Unclassified 3709
5 Ga0065715_10116063 3300005293 Unclassified 2393
6 Ga0070683_100119373 3300005329 Bacteria 2490
7 Ga0070666_10136693 3300005335 Bacteria 1705
8 Ga0070680_100462823 3300005336 Bacteria 1083
9 Ga0070682_100082118 3300005337 Unclassified 2088
10 Ga0068868_100285764 3300005338 Bacteria 1397
11 Ga0070660_100084905 3300005339 Bacteria 2489
12 Ga0070660_100390088 3300005339 Bacteria 1150
13 Ga0070689_100201866 3300005340 Bacteria 1624
14 Ga0070691_10057459 3300005341 Unclassified 1866
15 Ga0070687_100339934 3300005343 Bacteria 965
16 Ga0070661_100050821 3300005344 Unclassified 3033
17 Ga0070668_100017128 3300005347 Bacteria 5422
18 Ga0070669_100446643 3300005353 Bacteria 1065
19 Ga0070675_100492321 3300005354 Bacteria 1104
20 Ga0070667_100008196 3300005367 Bacteria 8661
21 Ga0070667_100382682 3300005367 Bacteria 1278
22 Ga0070709_10298056 3300005434 Bacteria 1177
23 Ga0070709_10380148 3300005434 Bacteria 1050
24 Ga0070714_100164068 3300005435 Bacteria 2012
25 Ga0070714_100622522 3300005435 Bacteria 1038
26 Ga0070714_100918309 3300005435 Bacteria 850
27 Ga0070713_100325757 3300005436 Bacteria 1420
28 Ga0070713_100650148 3300005436 Unclassified 1004
29 Ga0070710_10266840 3300005437 Bacteria 1105
30 Ga0070711_100104233 3300005439 Bacteria 2069
31 Ga0070711_100149824 3300005439 Bacteria 1758
32 Ga0070711_100232388 3300005439 Unclassified 1438
33 Ga0070711_100324300 3300005439 Bacteria 1231
34 Ga0070705_100214548 3300005440 Bacteria 1329
35 Ga0070708_100066803 3300005445 Bacteria 3228
36 Ga0070708_100150760 3300005445 Bacteria 2162
37 Ga0070678_100124171 3300005456 Unclassified 2040
38 Ga0070662_100008915 3300005457 Bacteria 6539
39 Ga0068867_100051414 3300005459 Unclassified 3039
40 Ga0068867_100445806 3300005459 Bacteria 1102
41 Ga0070685_10150416 3300005466 Bacteria 1475
42 Ga0070706_100002010 3300005467 Bacteria 20888
43 Ga0070706_100220759 3300005467 Unclassified 1769
44 Ga0070706_100247782 3300005467 Bacteria 1663
45 Ga0070706_100444473 3300005467 Bacteria 1207
46 Ga0070707_100535474 3300005468 Bacteria 1133
47 Ga0070698_100000420 3300005471 Bacteria 45329
48 Ga0070698_100761235 3300005471 Bacteria 912
49 Ga0070699_100013093 3300005518 Bacteria 7148
50 Ga0070699_100392039 3300005518 Bacteria 1255
51 Ga0070684_100139981 3300005535 Unclassified 2188
52 Ga0070697_100240926 3300005536 Bacteria 1544
53 Ga0068853_100497991 3300005539 Bacteria 1150
54 Ga0068853_100584557 3300005539 Bacteria 1060
55 Ga0070695_100094279 3300005545 Unclassified 2004
56 Ga0070693_100028934 3300005547 Bacteria 3017
57 Ga0070665_100018815 3300005548 Bacteria 6924
58 Ga0070665_100033389 3300005548 Bacteria 5177
59 Ga0068855_100324357 3300005563 Bacteria 1701
60 Ga0070664_100068382 3300005564 Unclassified 3036
61 Ga0068857_100123081 3300005577 Unclassified 2336
62 Ga0068854_100106056 3300005578 Unclassified 2113
63 Ga0068856_100062890 3300005614 Bacteria 3666
64 Ga0068859_100034058 3300005617 Bacteria 5113
65 Ga0068864_100400550 3300005618 Bacteria 1304
66 Ga0068864_100492891 3300005618 Bacteria 1178
67 Ga0068866_10059909 3300005718 Unclassified 1972
68 Ga0068866_10335176 3300005718 Bacteria 956
69 Ga0068851_10025114 3300005834 Unclassified 2921
70 Ga0068863_100197251 3300005841 Unclassified 1935
71 Ga0068858_100423288 3300005842 Bacteria 1281
72 Ga0068860_100084250 3300005843 Unclassified 3024
73 Ga0068862_100069460 3300005844 Bacteria 3041
74 Ga0081455_10030952 3300005937 Bacteria 4850
75 Ga0070717_10108350 3300006028 Bacteria 2367
76 Ga0070717_10158885 3300006028 Bacteria 1960
77 Ga0070715_10147495 3300006163 Bacteria 1149
78 Ga0070716_100218646 3300006173 Bacteria 1278
79 Ga0070716_100564425 3300006173 Bacteria 851
80 Ga0070712_100111650 3300006175 Bacteria 2041
81 Ga0070712_100429405 3300006175 Bacteria 1096
82 Ga0075369_10076984 3300006186 Bacteria 1475
83 Ga0068871_100086367 3300006358 Bacteria 2607
84 Ga0075433_10226999 3300006852 Bacteria 1658
85 Ga0097620_100034058 3300006931 Bacteria 5113
86 Ga0099794_10035138 3300007265 Bacteria 2364
87 Ga0099795_10181930 3300007788 Bacteria 878
88 Ga0105240_10167700 3300009093 Bacteria 2603
89 Ga0105240_10243960 3300009093 Unclassified 2081
90 Ga0105240_10283250 3300009093 Unclassified 1903
91 Ga0111539_10085087 3300009094 Bacteria 3717
92 Ga0105245_10507719 3300009098 Bacteria 1223
93 Ga0105247_10181900 3300009101 Bacteria 1403
94 Ga0105243_10006647 3300009148 Bacteria 8926
95 Ga0105241_10018038 3300009174 Bacteria 5188
96 Ga0105241_10454033 3300009174 Bacteria 1134
97 Ga0105242_10049985 3300009176 Bacteria 3403
98 Ga0105242_10130292 3300009176 Unclassified 2170
99 Ga0105248_10007328 3300009177 Bacteria 12106
100 Ga0105248_10131042 3300009177 Bacteria 2829
101 Ga0105248_10178843 3300009177 Bacteria 2391
102 Ga0105248_10228298 3300009177 Unclassified 2095
103 Ga0105237_10231011 3300009545 Unclassified 1851
104 Ga0105238_10096266 3300009551 Bacteria 2946
105 Ga0105238_10284701 3300009551 Bacteria 1635
106 Ga0105249_10095222 3300009553 Bacteria 2791
107 Ga0099796_10120242 3300010159 Bacteria 1008
108 Ga0105239_10154462 3300010375 Bacteria 2562
109 Ga0105239_10706980 3300010375 Bacteria 1152
110 Ga0105246_10048468 3300011119 Bacteria 2904
111 Ga0157371_10014890 3300013102 Bacteria 5854
112 Ga0157370_10263832 3300013104 Bacteria 1591
113 Ga0157369_10008312 3300013105 Bacteria 11895
114 Ga0157374_10033397 3300013296 Bacteria 4694
115 Ga0157374_10039593 3300013296 Bacteria 4338
116 Ga0157378_10083865 3300013297 Bacteria 2885
117 Ga0157378_10260497 3300013297 Bacteria 1664
118 Ga0163162_10049798 3300013306 Bacteria 4200
119 Ga0163162_10186405 3300013306 Bacteria 2202
120 Ga0163162_10253548 3300013306 Bacteria 1891
121 Ga0163162_11096450 3300013306 Bacteria 902
122 Ga0157372_10190502 3300013307 Unclassified 2376
123 Ga0157375_10247046 3300013308 Bacteria 1945
124 Ga0163163_10571666 3300014325 Bacteria 1193
125 Ga0157379_10006617 3300014968 Bacteria 9997
126 Ga0157379_10133784 3300014968 Bacteria 2233
127 Ga0157376_10005814 3300014969 Bacteria 8647
128 Ga0157376_10210250 3300014969 Bacteria 1796
129 Ga0213872_10000783 3300021361 Bacteria 23253
130 Ga0213872_10002015 3300021361 Bacteria 12344
131 Ga0213872_10003912 3300021361 Bacteria 8076
132 Ga0213872_10069901 3300021361 Bacteria 1583
133 Ga0213871_10010587 3300021441 Bacteria 2095
134 Ga0224569_103746 3300022732 Bacteria 1181
135 Ga0224572_1000512 3300024225 Bacteria 4678
136 Ga0228598_1024805 3300024227 Bacteria 1179
137 Ga0209646_1001021 3300025246 Bacteria 8544
138 Ga0209050_1003096 3300025298 Bacteria 12763
139 Ga0207692_10190527 3300025898 Bacteria 1200
140 Ga0207692_10272197 3300025898 Bacteria 1022
141 Ga0207710_10084399 3300025900 Bacteria 1478
142 Ga0207680_10135848 3300025903 Bacteria 1625
143 Ga0207647_10055969 3300025904 Unclassified 2421
144 Ga0207685_10136451 3300025905 Bacteria 1095
145 Ga0207699_10144131 3300025906 Bacteria 1568
146 Ga0207699_10237689 3300025906 Bacteria 1250
147 Ga0207699_10433653 3300025906 Viruses 940
148 Ga0207645_10036042 3300025907 Bacteria 3176
149 Ga0207684_10010340 3300025910 Bacteria 8213
150 Ga0207684_10202067 3300025910 Bacteria 1714
151 Ga0207654_10007934 3300025911 Bacteria 5354
152 Ga0207695_10152793 3300025913 Bacteria 2246
153 Ga0207695_10207669 3300025913 Unclassified 1870
154 Ga0207671_10036729 3300025914 Bacteria 3634
155 Ga0207693_10172424 3300025915 Bacteria 1703
156 Ga0207663_10017172 3300025916 Bacteria 4026
157 Ga0207663_10325593 3300025916 Bacteria 1156
158 Ga0207649_10134288 3300025920 Bacteria 1685
159 Ga0207652_10029481 3300025921 Bacteria 4589
160 Ga0207646_10392810 3300025922 Bacteria 1253
161 Ga0207681_10126170 3300025923 Unclassified 1885
162 Ga0207694_10068240 3300025924 Unclassified 2776
163 Ga0207687_10033856 3300025927 Unclassified 3467
164 Ga0207700_10272635 3300025928 Viruses 1453
165 Ga0207664_10094058 3300025929 Bacteria 2463
166 Ga0207664_10744603 3300025929 Bacteria 881
167 Ga0207709_10225594 3300025935 Bacteria 1354
168 Ga0207665_10023105 3300025939 Bacteria 4096
169 Ga0207665_10079135 3300025939 Bacteria 2259
170 Ga0207665_10134747 3300025939 Bacteria 1756
171 Ga0207711_10016855 3300025941 Bacteria 6067
172 Ga0207711_10120570 3300025941 Bacteria 2341
173 Ga0207711_10170028 3300025941 Unclassified 1977
174 Ga0207689_10010353 3300025942 Bacteria 8035
175 Ga0207689_10304672 3300025942 Bacteria 1321
176 Ga0207661_10072871 3300025944 Bacteria 2811
177 Ga0207679_10052159 3300025945 Bacteria 2998
178 Ga0207667_10088975 3300025949 Unclassified 3192
179 Ga0207712_10151112 3300025961 Bacteria 1794
180 Ga0207712_10377718 3300025961 Bacteria 1185
181 Ga0207668_10266479 3300025972 Bacteria 1398
182 Ga0207668_10517874 3300025972 Bacteria 1028
183 Ga0207640_10099529 3300025981 Unclassified 2035
184 Ga0207677_10032682 3300026023 Bacteria 3347
185 Ga0207677_10450177 3300026023 Bacteria 1103
186 Ga0207703_10195807 3300026035 Bacteria 1793
187 Ga0207639_10212774 3300026041 Unclassified 1665
188 Ga0207678_10249232 3300026067 Bacteria 1521
189 Ga0207641_10546109 3300026088 Bacteria 1130
190 Ga0207641_10565690 3300026088 Bacteria 1110
191 Ga0207648_10021346 3300026089 Bacteria 5820
192 Ga0207648_10188541 3300026089 Bacteria 1827
193 Ga0207676_10164544 3300026095 Bacteria 1926
194 Ga0207674_10088859 3300026116 Bacteria 3082
195 Ga0207675_100138224 3300026118 Bacteria 2313
196 Ga0209588_1026918 3300027671 Bacteria 1828
197 Ga0265356_1001907 3300028017 Bacteria 2897
198 Ga0268266_10034325 3300028379 Bacteria 4315
199 Ga0268266_10067817 3300028379 Bacteria 3088
200 Ga0268266_10156403 3300028379 Unclassified 2059
201 Ga0268265_10063995 3300028380 Bacteria 2832
202 Ga0316176_1002742 3300030732 Bacteria 81202
203 Ga0316183_1128744 3300030742 Bacteria 48494
204 Ga0316181_1109246 3300030744 Bacteria 74541
205 Ga0265762_1014753 3300030760 Bacteria 1411
206 Ga0265762_1032454 3300030760 Unclassified 996
207 Ga0265760_10008999 3300031090 Bacteria 2853
208 Ga0265340_10065242 3300031247 Bacteria 1734
209 Ga0265340_10066360 3300031247 Bacteria 1717
210 Ga0373930_0009359 3300034816 Bacteria 1732
211 Ga0373926_0020695 3300035083 Bacteria 2273
212 Ga0373923_0025976 3300035111 Bacteria 2326
213 Ga0373939_0008118 3300035114 Bacteria 2568
214 Ga0373954_0003593 3300035118 Bacteria 6594
215 Ga0373956_0098145 3300035119 Bacteria 1356
216 Ga0373957_0086130 3300035120 Bacteria 1244
217 Ga0373955_0239252 3300035172 Bacteria 1087
218 Ga0373942_0029737 3300035207 Bacteria 1436
219 Ga0373962_0024675 3300035242 Unclassified 1610
220 Ga0373924_0106260 3300035410 Bacteria 1210
221 Ga0373931_0042919 3300035691 Bacteria 2379
222 Ga0373935_0299231 3300035692 Bacteria 1137
223 Ga0373927_0014777 3300035695 Bacteria 5163
224 Ga0373927_0104127 3300035695 Bacteria 1847
225 Ga0373933_0001695 3300035724 Bacteria 12815
226 Ga0373947_0234548 3300035725 Bacteria 1209
227 Ga0373937_0006148 3300036401 Bacteria 10338
228 Ga0373925_0801741 3300037068 Bacteria 776
229 Ga0436365_1814790 3300039437 Bacteria 33133
230 Ga0436360_0945494 3300039438 Bacteria 2404
231 Ga0436360_1118143 3300039438 Bacteria 18297
232 Ga0436361_0065098 3300039447 Bacteria 4858
233 Ga0436361_0244311 3300039447 Bacteria 59058
234 Ga0436361_0322060 3300039447 Bacteria 1742
235 Ga0436361_0390562 3300039447 Bacteria 1913
236 Ga0436361_0867577 3300039447 Viruses 2339
237 Ga0436361_1119869 3300039447 Bacteria 1710
238 Ga0436363_0133889 3300039450 Unclassified 1112
239 Ga0436363_1530840 3300039450 Bacteria 1781
240 Ga0436363_1641176 3300039450 Bacteria 3854
241 Ga0436362_0036945 3300039453 Bacteria 3743
242 Ga0436362_0220741 3300039453 Bacteria 1258
243 Ga0436362_0419134 3300039453 Bacteria 1107
244 Ga0436362_0771090 3300039453 Unclassified 2268
245 Ga0436362_1159136 3300039453 Bacteria 1904
246 Ga0451793_0814650 3300041452 Unclassified 847
247 Ga0466969_0071574 3300044656 Bacteria 1667
248 Ga0451576_0142460 3300045051 Bacteria 2500
249 Ga0495650_0025346 3300046471 Bacteria 2782
250 Ga0495585_0233560 3300046492 Bacteria 923
251 Ga0495594_0189366 3300046499 Bacteria 1172
252 Ga0495607_0175149 3300046501 Bacteria 1080
253 Ga0495606_0000179 3300046507 Bacteria 111712
254 Ga0495606_0000827 3300046507 Bacteria 46975
255 Ga0495642_0088135 3300046528 Bacteria 1312
256 Ga0495645_0044168 3300046543 Bacteria 3251
257 Ga0495625_0196174 3300046660 Bacteria 1335
258 Ga0495659_0164866 3300046664 Bacteria 896
259 Ga0495670_0072384 3300046691 Bacteria 1746
260 Ga0495660_0003324 3300046810 Bacteria 9974
261 Ga0495674_0434093 3300047319 Bacteria 1057
262 Ga0495672_0000432 3300047320 Bacteria 50120
263 Ga0495672_0015488 3300047320 Bacteria 5175
264 Ga0495686_0011744 3300047472 Bacteria 6166
265 Ga0496104_0142940 3300048907 Bacteria 2299
266 Ga0496106_0598006 3300048909 Bacteria 883
267 Ga0496107_0039387 3300048910 Bacteria 3391
268 Ga0496108_0277035 3300048911 Bacteria 1460
269 Ga0496109_0016705 3300048912 Bacteria 6421
270 Ga0496110_0016657 3300048913 Bacteria 6140
271 Ga0496112_0121461 3300048915 Unclassified 2582
272 Ga0496112_0173316 3300048915 Bacteria 2123
273 Ga0496113_0259779 3300048916 Bacteria 1387
274 Ga0496115_0618254 3300048918 Bacteria 860
275 Ga0496126_0000024 3300048929 Bacteria 462877
276 Ga0496126_0008382 3300048929 Bacteria 11154
277 Ga0496126_0081028 3300048929 Bacteria 2871
278 Ga0496126_0162126 3300048929 Bacteria 1910
279 nmdc:mga0sz30_95366_c1 3300050516 Bacteria 1297
280 Ga0500578_0000178 3300053086 Bacteria 76527

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005436 Ga0070713_100325757 Ga0070713_1003257572 224
2 3300006028 Ga0070717_10158885 Ga0070717_101588852 224
3 3300025906 Ga0207699_10433653 Ga0207699_104336532 224
4 3300025928 Ga0207700_10272635 Ga0207700_102726352 224
5 3300025939 Ga0207665_10134747 Ga0207665_101347471 224
6 3300003316 rootH1_10111830 rootH1_101118304 233
7 3300005338 Ga0068868_100285764 Ga0068868_1002857641 233
8 3300025246 Ga0209646_1001021 Ga0209646_10010216 233
9 3300025298 Ga0209050_1003096 Ga0209050_10030966 234
10 iso_pu_bacteria 2738541278 2738727719 237
11 iso_pu_bacteria 2881609920 2881613857 237
12 iso_pu_bacteria 2889415604 2889419699 238
13 3300046501 Ga0495607_0175149 Ga0495607_0175149_243_1013 239
14 3300048929 Ga0496126_0081028 Ga0496126_0081028_1692_2429 239
15 3300039438 Ga0436360_1118143 Ga0436360_1118143_17333_18073 240
16 3300005434 Ga0070709_10298056 Ga0070709_102980562 241
17 3300005435 Ga0070714_100164068 Ga0070714_1001640682 241
18 3300005459 Ga0068867_100445806 Ga0068867_1004458062 241
19 3300005467 Ga0070706_100220759 Ga0070706_1002207592 241
20 3300005536 Ga0070697_100240926 Ga0070697_1002409262 241
21 3300005618 Ga0068864_100400550 Ga0068864_1004005501 241
22 3300006173 Ga0070716_100564425 Ga0070716_1005644251 241
23 3300009177 Ga0105248_10131042 Ga0105248_101310424 241
24 3300010375 Ga0105239_10706980 Ga0105239_107069802 241
25 3300013296 Ga0157374_10039593 Ga0157374_100395934 241
26 3300021361 Ga0213872_10000783 Ga0213872_1000078336 241
27 3300021361 Ga0213872_10002015 Ga0213872_100020159 241
28 3300021361 Ga0213872_10003912 Ga0213872_100039129 241
29 3300021361 Ga0213872_10069901 Ga0213872_100699012 241
30 3300021441 Ga0213871_10010587 Ga0213871_100105873 241
31 3300025915 Ga0207693_10172424 Ga0207693_101724243 241
32 3300025921 Ga0207652_10029481 Ga0207652_100294816 241
33 3300025929 Ga0207664_10094058 Ga0207664_100940583 241
34 3300025939 Ga0207665_10023105 Ga0207665_100231053 241
35 3300026023 Ga0207677_10450177 Ga0207677_104501772 241
36 3300026095 Ga0207676_10164544 Ga0207676_101645442 241
37 3300030760 Ga0265762_1032454 Ga0265762_10324542 241
38 3300039437 Ga0436365_1814790 Ga0436365_1814790_2570_3313 241
39 3300039438 Ga0436360_0945494 Ga0436360_0945494_387_1130 241
40 3300039447 Ga0436361_0065098 Ga0436361_0065098_3027_3770 241
41 3300039447 Ga0436361_0244311 Ga0436361_0244311_38672_39415 241
42 3300039447 Ga0436361_0322060 Ga0436361_0322060_112_855 241
43 3300039447 Ga0436361_0390562 Ga0436361_0390562_256_999 241
44 3300039447 Ga0436361_0867577 Ga0436361_0867577_301_1044 241
45 3300039450 Ga0436363_0133889 Ga0436363_0133889_101_844 241
46 3300039450 Ga0436363_1530840 Ga0436363_1530840_542_1285 241
47 3300039450 Ga0436363_1641176 Ga0436363_1641176_2974_3717 241
48 3300039453 Ga0436362_0036945 Ga0436362_0036945_198_941 241
49 3300039453 Ga0436362_0220741 Ga0436362_0220741_291_1034 241
50 3300039453 Ga0436362_0419134 Ga0436362_0419134_53_796 241
51 3300039453 Ga0436362_0771090 Ga0436362_0771090_1144_1887 241
52 3300039453 Ga0436362_1159136 Ga0436362_1159136_323_1066 241
53 3300041452 Ga0451793_0814650 Ga0451793_0814650_10_777 241
54 3300044656 Ga0466969_0071574 Ga0466969_0071574_653_1420 241
55 3300053086 Ga0500578_0000178 Ga0500578_0000178_4663_5430 241
56 3300005290 Ga0065712_10070220 Ga0065712_100702207 242
57 3300005293 Ga0065715_10116063 Ga0065715_101160631 242
58 3300005329 Ga0070683_100119373 Ga0070683_1001193732 242
59 3300005335 Ga0070666_10136693 Ga0070666_101366931 242
60 3300005336 Ga0070680_100462823 Ga0070680_1004628231 242
61 3300005337 Ga0070682_100082118 Ga0070682_1000821182 242
62 3300005339 Ga0070660_100084905 Ga0070660_1000849052 242
63 3300005339 Ga0070660_100390088 Ga0070660_1003900881 242
64 3300005340 Ga0070689_100201866 Ga0070689_1002018662 242
65 3300005341 Ga0070691_10057459 Ga0070691_100574591 242
66 3300005343 Ga0070687_100339934 Ga0070687_1003399341 242
67 3300005344 Ga0070661_100050821 Ga0070661_1000508214 242
68 3300005347 Ga0070668_100017128 Ga0070668_1000171286 242
69 3300005353 Ga0070669_100446643 Ga0070669_1004466432 242
70 3300005354 Ga0070675_100492321 Ga0070675_1004923211 242
71 3300005367 Ga0070667_100008196 Ga0070667_1000081963 242
72 3300005367 Ga0070667_100382682 Ga0070667_1003826822 242
73 3300005434 Ga0070709_10380148 Ga0070709_103801482 242
74 3300005435 Ga0070714_100918309 Ga0070714_1009183091 242
75 3300005436 Ga0070713_100650148 Ga0070713_1006501481 242
76 3300005439 Ga0070711_100104233 Ga0070711_1001042332 242
77 3300005439 Ga0070711_100149824 Ga0070711_1001498241 242
78 3300005439 Ga0070711_100232388 Ga0070711_1002323881 242
79 3300005440 Ga0070705_100214548 Ga0070705_1002145481 242
80 3300005445 Ga0070708_100066803 Ga0070708_1000668032 242
81 3300005445 Ga0070708_100150760 Ga0070708_1001507603 242
82 3300005456 Ga0070678_100124171 Ga0070678_1001241712 242
83 3300005457 Ga0070662_100008915 Ga0070662_1000089154 242
84 3300005459 Ga0068867_100051414 Ga0068867_1000514144 242
85 3300005466 Ga0070685_10150416 Ga0070685_101504162 242
86 3300005467 Ga0070706_100002010 Ga0070706_10000201012 242
87 3300005467 Ga0070706_100247782 Ga0070706_1002477822 242
88 3300005467 Ga0070706_100444473 Ga0070706_1004444732 242
89 3300005468 Ga0070707_100535474 Ga0070707_1005354741 242
90 3300005471 Ga0070698_100000420 Ga0070698_10000042030 242
91 3300005471 Ga0070698_100761235 Ga0070698_1007612351 242
92 3300005518 Ga0070699_100013093 Ga0070699_1000130932 242
93 3300005518 Ga0070699_100392039 Ga0070699_1003920391 242
94 3300005535 Ga0070684_100139981 Ga0070684_1001399812 242
95 3300005539 Ga0068853_100497991 Ga0068853_1004979912 242
96 3300005539 Ga0068853_100584557 Ga0068853_1005845571 242
97 3300005545 Ga0070695_100094279 Ga0070695_1000942792 242
98 3300005547 Ga0070693_100028934 Ga0070693_1000289342 242
99 3300005548 Ga0070665_100018815 Ga0070665_1000188153 242
100 3300005548 Ga0070665_100033389 Ga0070665_1000333896 242
101 3300005563 Ga0068855_100324357 Ga0068855_1003243572 242
102 3300005564 Ga0070664_100068382 Ga0070664_1000683824 242
103 3300005577 Ga0068857_100123081 Ga0068857_1001230811 242
104 3300005578 Ga0068854_100106056 Ga0068854_1001060562 242
105 3300005614 Ga0068856_100062890 Ga0068856_1000628903 242
106 3300005617 Ga0068859_100034058 Ga0068859_1000340584 242
107 3300005618 Ga0068864_100492891 Ga0068864_1004928912 242
108 3300005718 Ga0068866_10059909 Ga0068866_100599091 242
109 3300005718 Ga0068866_10335176 Ga0068866_103351761 242
110 3300005834 Ga0068851_10025114 Ga0068851_100251143 242
111 3300005842 Ga0068858_100423288 Ga0068858_1004232882 242
112 3300005843 Ga0068860_100084250 Ga0068860_1000842502 242
113 3300005844 Ga0068862_100069460 Ga0068862_1000694603 242
114 3300005937 Ga0081455_10030952 Ga0081455_100309521 242
115 3300006028 Ga0070717_10108350 Ga0070717_101083502 242
116 3300006163 Ga0070715_10147495 Ga0070715_101474951 242
117 3300006186 Ga0075369_10076984 Ga0075369_100769842 242
118 3300006358 Ga0068871_100086367 Ga0068871_1000863672 242
119 3300006931 Ga0097620_100034058 Ga0097620_1000340584 242
120 3300007265 Ga0099794_10035138 Ga0099794_100351382 242
121 3300007788 Ga0099795_10181930 Ga0099795_101819301 242
122 3300009093 Ga0105240_10167700 Ga0105240_101677002 242
123 3300009093 Ga0105240_10243960 Ga0105240_102439601 242
124 3300009098 Ga0105245_10507719 Ga0105245_105077191 242
125 3300009101 Ga0105247_10181900 Ga0105247_101819001 242
126 3300009148 Ga0105243_10006647 Ga0105243_1000664710 242
127 3300009174 Ga0105241_10018038 Ga0105241_100180385 242
128 3300009174 Ga0105241_10454033 Ga0105241_104540332 242
129 3300009176 Ga0105242_10049985 Ga0105242_100499854 242
130 3300009176 Ga0105242_10130292 Ga0105242_101302922 242
131 3300009177 Ga0105248_10007328 Ga0105248_100073285 242
132 3300009177 Ga0105248_10178843 Ga0105248_101788432 242
133 3300009177 Ga0105248_10228298 Ga0105248_102282983 242
134 3300009545 Ga0105237_10231011 Ga0105237_102310112 242
135 3300009551 Ga0105238_10096266 Ga0105238_100962662 242
136 3300009551 Ga0105238_10284701 Ga0105238_102847012 242
137 3300009553 Ga0105249_10095222 Ga0105249_100952224 242
138 3300010159 Ga0099796_10120242 Ga0099796_101202421 242
139 3300010375 Ga0105239_10154462 Ga0105239_101544622 242
140 3300011119 Ga0105246_10048468 Ga0105246_100484683 242
141 3300013102 Ga0157371_10014890 Ga0157371_100148902 242
142 3300013104 Ga0157370_10263832 Ga0157370_102638322 242
143 3300013105 Ga0157369_10008312 Ga0157369_1000831213 242
144 3300013296 Ga0157374_10033397 Ga0157374_100333973 242
145 3300013297 Ga0157378_10083865 Ga0157378_100838652 242
146 3300013306 Ga0163162_10049798 Ga0163162_100497985 242
147 3300013306 Ga0163162_10186405 Ga0163162_101864053 242
148 3300013306 Ga0163162_10253548 Ga0163162_102535482 242
149 3300013306 Ga0163162_11096450 Ga0163162_110964502 242
150 3300013307 Ga0157372_10190502 Ga0157372_101905022 242
151 3300013308 Ga0157375_10247046 Ga0157375_102470462 242
152 3300014325 Ga0163163_10571666 Ga0163163_105716661 242
153 3300014968 Ga0157379_10006617 Ga0157379_100066177 242
154 3300014968 Ga0157379_10133784 Ga0157379_101337843 242
155 3300014969 Ga0157376_10005814 Ga0157376_1000581410 242
156 3300014969 Ga0157376_10210250 Ga0157376_102102502 242
157 3300022732 Ga0224569_103746 Ga0224569_1037461 242
158 3300024225 Ga0224572_1000512 Ga0224572_10005122 242
159 3300024227 Ga0228598_1024805 Ga0228598_10248051 242
160 3300025898 Ga0207692_10272197 Ga0207692_102721971 242
161 3300025900 Ga0207710_10084399 Ga0207710_100843991 242
162 3300025903 Ga0207680_10135848 Ga0207680_101358482 242
163 3300025904 Ga0207647_10055969 Ga0207647_100559693 242
164 3300025905 Ga0207685_10136451 Ga0207685_101364511 242
165 3300025906 Ga0207699_10144131 Ga0207699_101441312 242
166 3300025906 Ga0207699_10237689 Ga0207699_102376892 242
167 3300025907 Ga0207645_10036042 Ga0207645_100360423 242
168 3300025910 Ga0207684_10010340 Ga0207684_100103402 242
169 3300025910 Ga0207684_10202067 Ga0207684_102020672 242
170 3300025911 Ga0207654_10007934 Ga0207654_100079344 242
171 3300025913 Ga0207695_10152793 Ga0207695_101527932 242
172 3300025913 Ga0207695_10207669 Ga0207695_102076692 242
173 3300025914 Ga0207671_10036729 Ga0207671_100367292 242
174 3300025920 Ga0207649_10134288 Ga0207649_101342882 242
175 3300025923 Ga0207681_10126170 Ga0207681_101261702 242
176 3300025924 Ga0207694_10068240 Ga0207694_100682402 242
177 3300025927 Ga0207687_10033856 Ga0207687_100338562 242
178 3300025929 Ga0207664_10744603 Ga0207664_107446031 242
179 3300025935 Ga0207709_10225594 Ga0207709_102255941 242
180 3300025939 Ga0207665_10079135 Ga0207665_100791352 242
181 3300025941 Ga0207711_10016855 Ga0207711_100168555 242
182 3300025941 Ga0207711_10120570 Ga0207711_101205701 242
183 3300025941 Ga0207711_10170028 Ga0207711_101700281 242
184 3300025942 Ga0207689_10010353 Ga0207689_100103538 242
185 3300025942 Ga0207689_10304672 Ga0207689_103046721 242
186 3300025944 Ga0207661_10072871 Ga0207661_100728712 242
187 3300025945 Ga0207679_10052159 Ga0207679_100521592 242
188 3300025949 Ga0207667_10088975 Ga0207667_100889754 242
189 3300025961 Ga0207712_10151112 Ga0207712_101511121 242
190 3300025961 Ga0207712_10377718 Ga0207712_103777182 242
191 3300025972 Ga0207668_10266479 Ga0207668_102664791 242
192 3300025972 Ga0207668_10517874 Ga0207668_105178741 242
193 3300025981 Ga0207640_10099529 Ga0207640_100995292 242
194 3300026023 Ga0207677_10032682 Ga0207677_100326823 242
195 3300026035 Ga0207703_10195807 Ga0207703_101958072 242
196 3300026041 Ga0207639_10212774 Ga0207639_102127741 242
197 3300026067 Ga0207678_10249232 Ga0207678_102492322 242
198 3300026088 Ga0207641_10546109 Ga0207641_105461092 242
199 3300026088 Ga0207641_10565690 Ga0207641_105656901 242
200 3300026089 Ga0207648_10021346 Ga0207648_100213465 242
201 3300026089 Ga0207648_10188541 Ga0207648_101885411 242
202 3300026116 Ga0207674_10088859 Ga0207674_100888592 242
203 3300026118 Ga0207675_100138224 Ga0207675_1001382242 242
204 3300027671 Ga0209588_1026918 Ga0209588_10269182 242
205 3300028017 Ga0265356_1001907 Ga0265356_10019073 242
206 3300028379 Ga0268266_10034325 Ga0268266_100343252 242
207 3300028379 Ga0268266_10067817 Ga0268266_100678172 242
208 3300028379 Ga0268266_10156403 Ga0268266_101564032 242
209 3300028380 Ga0268265_10063995 Ga0268265_100639951 242
210 3300030732 Ga0316176_1002742 Ga0316176_100274278 242
211 3300030742 Ga0316183_1128744 Ga0316183_112874413 242
212 3300030744 Ga0316181_1109246 Ga0316181_11092467 242
213 3300030760 Ga0265762_1014753 Ga0265762_10147532 242
214 3300031090 Ga0265760_10008999 Ga0265760_100089993 242
215 3300031247 Ga0265340_10065242 Ga0265340_100652423 242
216 3300031247 Ga0265340_10066360 Ga0265340_100663601 242
217 3300034816 Ga0373930_0009359 Ga0373930_0009359_74_805 242
218 3300035111 Ga0373923_0025976 Ga0373923_0025976_805_1536 242
219 3300035114 Ga0373939_0008118 Ga0373939_0008118_477_1208 242
220 3300035118 Ga0373954_0003593 Ga0373954_0003593_696_1427 242
221 3300035119 Ga0373956_0098145 Ga0373956_0098145_496_1227 242
222 3300035120 Ga0373957_0086130 Ga0373957_0086130_146_877 242
223 3300035207 Ga0373942_0029737 Ga0373942_0029737_232_963 242
224 3300035242 Ga0373962_0024675 Ga0373962_0024675_452_1183 242
225 3300035410 Ga0373924_0106260 Ga0373924_0106260_147_878 242
226 3300035691 Ga0373931_0042919 Ga0373931_0042919_795_1526 242
227 3300035692 Ga0373935_0299231 Ga0373935_0299231_277_1008 242
228 3300035695 Ga0373927_0104127 Ga0373927_0104127_380_1111 242
229 3300035724 Ga0373933_0001695 Ga0373933_0001695_6362_7093 242
230 3300037068 Ga0373925_0801741 Ga0373925_0801741_11_742 242
231 3300045051 Ga0451576_0142460 Ga0451576_0142460_947_1678 242
232 3300046471 Ga0495650_0025346 Ga0495650_0025346_872_1603 242
233 3300046492 Ga0495585_0233560 Ga0495585_0233560_108_839 242
234 3300046499 Ga0495594_0189366 Ga0495594_0189366_252_983 242
235 3300046507 Ga0495606_0000179 Ga0495606_0000179_59504_60253 242
236 3300046507 Ga0495606_0000827 Ga0495606_0000827_13633_14382 242
237 3300046528 Ga0495642_0088135 Ga0495642_0088135_385_1116 242
238 3300046543 Ga0495645_0044168 Ga0495645_0044168_2221_2952 242
239 3300046660 Ga0495625_0196174 Ga0495625_0196174_65_796 242
240 3300046664 Ga0495659_0164866 Ga0495659_0164866_53_784 242
241 3300046691 Ga0495670_0072384 Ga0495670_0072384_578_1309 242
242 3300047319 Ga0495674_0434093 Ga0495674_0434093_23_754 242
243 3300047320 Ga0495672_0000432 Ga0495672_0000432_43351_44100 242
244 3300047320 Ga0495672_0015488 Ga0495672_0015488_220_951 242
245 3300047472 Ga0495686_0011744 Ga0495686_0011744_484_1215 242
246 3300048907 Ga0496104_0142940 Ga0496104_0142940_449_1180 242
247 3300048909 Ga0496106_0598006 Ga0496106_0598006_20_751 242
248 3300048910 Ga0496107_0039387 Ga0496107_0039387_2314_3045 242
249 3300048911 Ga0496108_0277035 Ga0496108_0277035_465_1196 242
250 3300048912 Ga0496109_0016705 Ga0496109_0016705_2325_3056 242
251 3300048913 Ga0496110_0016657 Ga0496110_0016657_18_749 242
252 3300048915 Ga0496112_0121461 Ga0496112_0121461_1596_2327 242
253 3300048915 Ga0496112_0173316 Ga0496112_0173316_497_1228 242
254 3300048916 Ga0496113_0259779 Ga0496113_0259779_90_821 242
255 3300048918 Ga0496115_0618254 Ga0496115_0618254_112_843 242
256 3300048929 Ga0496126_0000024 Ga0496126_0000024_84774_85505 242
257 3300048929 Ga0496126_0008382 Ga0496126_0008382_8963_9694 242
258 3300048929 Ga0496126_0162126 Ga0496126_0162126_104_838 242
259 3300050516 nmdc:mga0sz30_95366_c1 nmdc:mga0sz30_95366_c1_202_939 242
260 3300006852 Ga0075433_10226999 Ga0075433_102269992 243
261 3300009094 Ga0111539_10085087 Ga0111539_100850874 243
262 3300025922 Ga0207646_10392810 Ga0207646_103928101 243
263 3300046810 Ga0495660_0003324 Ga0495660_0003324_8634_9386 243
264 3300005293 Ga0065715_10004694 Ga0065715_100046941 244
265 3300009093 Ga0105240_10283250 Ga0105240_102832502 244
266 3300035172 Ga0373955_0239252 Ga0373955_0239252_292_1044 244
267 3300036401 Ga0373937_0006148 Ga0373937_0006148_7886_8638 244
268 3300039447 Ga0436361_1119869 Ga0436361_1119869_23_775 244
269 3300013297 Ga0157378_10260497 Ga0157378_102604972 248
270 3300035083 Ga0373926_0020695 Ga0373926_0020695_423_1205 248
271 3300035695 Ga0373927_0014777 Ga0373927_0014777_1011_1793 248
272 3300035725 Ga0373947_0234548 Ga0373947_0234548_252_1034 248
273 3300005437 Ga0070710_10266840 Ga0070710_102668401 249
274 3300005439 Ga0070711_100324300 Ga0070711_1003243002 249
275 3300006173 Ga0070716_100218646 Ga0070716_1002186462 249
276 3300006175 Ga0070712_100111650 Ga0070712_1001116503 249
277 3300006175 Ga0070712_100429405 Ga0070712_1004294051 249
278 3300025916 Ga0207663_10325593 Ga0207663_103255932 249
279 3300002773 JGI25152J39213_1000059 JGI25152J39213_100005971 252
280 3300005435 Ga0070714_100622522 Ga0070714_1006225221 252
281 3300005841 Ga0068863_100197251 Ga0068863_1001972511 252
282 3300025898 Ga0207692_10190527 Ga0207692_101905272 252
283 3300025916 Ga0207663_10017172 Ga0207663_100171722 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

55

244

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

60

289

0.96

PF08659

KR

KR domain

56

223

0.91

PF23441

49

291

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4i5f-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase mutant n15g, g37d, r38v, r39s 0.9916 12 251
4i5d-assembly1.cif.gz_A crystal structure of ralstonia sp. alcohol dehydrogenase in its apo form 0.9913 12 250
4fgs-assembly1.cif.gz_B crystal structure of a probable dehydrogenase protein 0.9908 12 251
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9904 10 250
4bmn-assembly1.cif.gz_D apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9893 11 250
ID Description Score Start End Superfamily
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9776 10 250 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9659 16 252 3.40.50.720
af_Q0JBH4_12_100_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9651 17 98 3.40.50.720
af_Q2FVE2_1_206_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9639 70 250 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.963 13 251 3.40.50.720
ID Description Score Start End GO Terms
AF-V5U2Q7-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase-like protein 0.9959 22 252 GO:0016491
AF-A0A7X2MLV7-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9942 11 172 GO:0016491
AF-A0A1M7T4P7-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.9917 11 251
AF-A0A436SAQ4-F1-model_v4 SDR family oxidoreductase 0.9913 11 251
AF-A0A4Q1JVQ9-F1-model_v4 SDR family oxidoreductase 0.9904 11 251

Feature Viewer

pLDDT pTM Quality
93.55 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map