F385351

General Info

Members Datasets Scaffolds Average Seq Length
283 151 566 151

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100388555|Ga0070683_1003885552
Length 154
Sequence VGLFPFFKKKPFFSAEENEKIVHSIQEAEKQTSGEIRFFAEGHCKYVDALDRAKEIFTNLQMEKTELRNAVLFYVAIKDKQLAIFADEGIHKAAGGDRYWKNTVKEILSVFSKDSVVAGITTTIYKIGEALKTHFPYDKDVDKNELPDEIIFGK

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
118 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
128 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
129 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
130 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
133 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
134 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
135 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
151 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.83
Nodule 0
Rhizoplane 0.71
Rhizosphere 93.29
Stem 0
Stem Tuber 0
Unclassified 12.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100388555 3300005329 Bacteria 1330
2 MRS1b_contig_5166380 2162886011 Bacteria 1769
3 MBSR1b_contig_8174311 2162886012 Bacteria 2632
4 JGI24740J21852_10083578 3300001979 Bacteria 833
5 JGI24743J22301_10026253 3300001991 Unclassified 1133
6 Ga0070658_10039679 3300005327 Bacteria 3798
7 Ga0070658_10065085 3300005327 Unclassified 2974
8 Ga0070658_10121181 3300005327 Bacteria 2173
9 Ga0070658_10145693 3300005327 Unclassified 1980
10 Ga0070658_10410105 3300005327 Bacteria 1164
11 Ga0070676_10045793 3300005328 Bacteria 2548
12 Ga0070683_100085148 3300005329 Bacteria 2963
13 Ga0070683_101080939 3300005329 Unclassified 770
14 Ga0070670_100089976 3300005331 Bacteria 2638
15 Ga0070670_100113929 3300005331 Bacteria 2331
16 Ga0070670_100233768 3300005331 Bacteria 1600
17 Ga0070670_100400821 3300005331 Unclassified 1211
18 Ga0070670_100876729 3300005331 Unclassified 813
19 Ga0070670_101287076 3300005331 Bacteria 669
20 Ga0068869_100067215 3300005334 Bacteria 2644
21 Ga0068869_100653594 3300005334 Bacteria 893
22 Ga0070680_100002384 3300005336 Bacteria 13903
23 Ga0070680_100517845 3300005336 Unclassified 1021
24 Ga0070680_100578437 3300005336 Bacteria 963
25 Ga0070680_100876418 3300005336 Bacteria 774
26 Ga0068868_100006299 3300005338 Bacteria 8387
27 Ga0070660_100191426 3300005339 Bacteria 1657
28 Ga0070660_100289481 3300005339 Bacteria 1341
29 Ga0070660_101709747 3300005339 Unclassified 536
30 Ga0070689_100216857 3300005340 Bacteria 1568
31 Ga0070687_100123713 3300005343 Bacteria 1483
32 Ga0070692_10146611 3300005345 Bacteria 1341
33 Ga0070668_100041724 3300005347 Bacteria 3516
34 Ga0070668_100902223 3300005347 Bacteria 790
35 Ga0070675_100106374 3300005354 Bacteria 2368
36 Ga0070671_100178382 3300005355 Bacteria 1798
37 Ga0070673_100013159 3300005364 Bacteria 5711
38 Ga0070673_100127457 3300005364 Bacteria 2131
39 Ga0070688_100009159 3300005365 Bacteria 5400
40 Ga0070688_100387004 3300005365 Bacteria 1032
41 Ga0070659_100021644 3300005366 Bacteria 4900
42 Ga0070659_100052231 3300005366 Bacteria 3214
43 Ga0070659_100090177 3300005366 Unclassified 2457
44 Ga0070659_100318370 3300005366 Bacteria 1300
45 Ga0070667_100047428 3300005367 Bacteria 3614
46 Ga0070667_101154845 3300005367 Bacteria 724
47 Ga0070714_100389656 3300005435 Bacteria 1315
48 Ga0070701_10290536 3300005438 Bacteria 1001
49 Ga0070700_100121977 3300005441 Bacteria 1748
50 Ga0070663_100028505 3300005455 Bacteria 3802
51 Ga0070663_100072732 3300005455 Bacteria 2506
52 Ga0070663_100471042 3300005455 Bacteria 1038
53 Ga0070662_100095660 3300005457 Bacteria 2239
54 Ga0070662_101334543 3300005457 Bacteria 617
55 Ga0070681_10019095 3300005458 Bacteria 6860
56 Ga0070681_10044979 3300005458 Bacteria 4419
57 Ga0070681_10638495 3300005458 Bacteria 979
58 Ga0070679_100001254 3300005530 Bacteria 22385
59 Ga0070679_100151497 3300005530 Bacteria 2295
60 Ga0070679_101528976 3300005530 Bacteria 614
61 Ga0070684_100188857 3300005535 Bacteria 1874
62 Ga0068853_100406283 3300005539 Unclassified 1275
63 Ga0070672_100032354 3300005543 Bacteria 3946
64 Ga0070665_100803858 3300005548 Bacteria 953
65 Ga0068855_100000998 3300005563 Bacteria 35254
66 Ga0068855_100002978 3300005563 Bacteria 20697
67 Ga0068855_100032383 3300005563 Bacteria 6243
68 Ga0068855_100770938 3300005563 Bacteria 1024
69 Ga0068857_100009057 3300005577 Bacteria 8635
70 Ga0068857_100086673 3300005577 Bacteria 2800
71 Ga0068854_100103972 3300005578 Bacteria 2133
72 Ga0068856_100034363 3300005614 Bacteria 4965
73 Ga0068856_100656915 3300005614 Unclassified 1069
74 Ga0068852_100374150 3300005616 Bacteria 1396
75 Ga0068852_102274133 3300005616 Bacteria 563
76 Ga0068859_100045840 3300005617 Bacteria 4391
77 Ga0068859_100257068 3300005617 Bacteria 1837
78 Ga0068864_100083365 3300005618 Bacteria 2807
79 Ga0068864_100190596 3300005618 Bacteria 1879
80 Ga0068866_10286196 3300005718 Bacteria 1023
81 Ga0068861_100001269 3300005719 Bacteria 15760
82 Ga0068861_100083497 3300005719 Bacteria 2506
83 Ga0068870_10007588 3300005840 Bacteria 4846
84 Ga0068860_100013193 3300005843 Bacteria 8108
85 Ga0068860_100098160 3300005843 Bacteria 2794
86 Ga0068860_100215922 3300005843 Bacteria 1861
87 Ga0068862_100010773 3300005844 Bacteria 7548
88 Ga0068862_101330145 3300005844 Bacteria 720
89 Ga0081539_10321481 3300005985 Bacteria 658
90 Ga0075366_10018570 3300006195 Bacteria 4016
91 Ga0075366_10019245 3300006195 Bacteria 3947
92 Ga0097621_100380937 3300006237 Bacteria 1260
93 Ga0075370_10415258 3300006353 Bacteria 808
94 Ga0068871_100461927 3300006358 Bacteria 1139
95 Ga0075434_101103064 3300006871 Bacteria 807
96 Ga0097620_100045841 3300006931 Bacteria 4391
97 Ga0097620_100257058 3300006931 Bacteria 1837
98 Ga0111539_10033749 3300009094 Bacteria 6211
99 Ga0111539_11909965 3300009094 Bacteria 688
100 Ga0105247_10002818 3300009101 Bacteria 11608
101 Ga0105247_10372125 3300009101 Unclassified 1010
102 Ga0105241_10099443 3300009174 Bacteria 2310
103 Ga0105242_10715381 3300009176 Bacteria 981
104 Ga0105249_10040875 3300009553 Bacteria 4213
105 Ga0105249_10084077 3300009553 Bacteria 2964
106 Ga0105249_12562180 3300009553 Bacteria 582
107 Ga0157373_10012945 3300013100 Bacteria 6125
108 Ga0157373_10156062 3300013100 Unclassified 1605
109 Ga0157373_10431335 3300013100 Bacteria 947
110 Ga0157373_10460375 3300013100 Bacteria 916
111 Ga0157373_10926429 3300013100 Unclassified 647
112 Ga0157371_10000724 3300013102 Bacteria 38696
113 Ga0157371_10001349 3300013102 Bacteria 25843
114 Ga0157371_10006056 3300013102 Bacteria 10063
115 Ga0157371_10006631 3300013102 Bacteria 9493
116 Ga0157371_10010626 3300013102 Bacteria 7151
117 Ga0157371_10046417 3300013102 Bacteria 3090
118 Ga0157371_10662493 3300013102 Bacteria 779
119 Ga0157370_10000408 3300013104 Bacteria 54355
120 Ga0157370_10021683 3300013104 Bacteria 6400
121 Ga0157370_10163410 3300013104 Bacteria 2071
122 Ga0157370_10404349 3300013104 Bacteria 1256
123 Ga0157370_11480458 3300013104 Bacteria 610
124 Ga0157369_10071744 3300013105 Bacteria 3717
125 Ga0157369_10166199 3300013105 Bacteria 2327
126 Ga0157369_10305241 3300013105 Unclassified 1655
127 Ga0157374_10038864 3300013296 Bacteria 4377
128 Ga0157374_11787986 3300013296 Unclassified 640
129 Ga0157378_10019505 3300013297 Bacteria 5961
130 Ga0163162_10507407 3300013306 Bacteria 1336
131 Ga0157372_10008676 3300013307 Bacteria 10797
132 Ga0157372_10063361 3300013307 Bacteria 4145
133 Ga0157372_10232766 3300013307 Bacteria 2136
134 Ga0157372_10402665 3300013307 Bacteria 1595
135 Ga0157372_10876284 3300013307 Unclassified 1042
136 Ga0157372_11269822 3300013307 Bacteria 850
137 Ga0157372_11490652 3300013307 Bacteria 779
138 Ga0157375_10510846 3300013308 Bacteria 1365
139 Ga0157375_11773564 3300013308 Bacteria 731
140 Ga0163163_10048018 3300014325 Bacteria 4196
141 Ga0163163_11172516 3300014325 Bacteria 831
142 Ga0157380_10002159 3300014326 Bacteria 13202
143 Ga0157380_10517563 3300014326 Bacteria 1163
144 Ga0157380_10660273 3300014326 Bacteria 1044
145 Ga0157377_10312790 3300014745 Unclassified 1041
146 Ga0157379_11372171 3300014968 Bacteria 684
147 Ga0157376_10070631 3300014969 Bacteria 2964
148 Ga0213876_10019938 3300021384 Bacteria 3542
149 Ga0207666_1002339 3300025271 Bacteria 2278
150 Ga0207710_10005817 3300025900 Bacteria 5289
151 Ga0207647_10026097 3300025904 Bacteria 3826
152 Ga0207645_10023279 3300025907 Bacteria 4026
153 Ga0207643_10017537 3300025908 Bacteria 3916
154 Ga0207705_10067782 3300025909 Bacteria 2583
155 Ga0207705_10093379 3300025909 Bacteria 2206
156 Ga0207705_10680001 3300025909 Bacteria 800
157 Ga0207707_10103636 3300025912 Bacteria 2487
158 Ga0207707_11119032 3300025912 Bacteria 641
159 Ga0207660_10060915 3300025917 Bacteria 2715
160 Ga0207660_11068189 3300025917 Unclassified 658
161 Ga0207660_11130286 3300025917 Bacteria 638
162 Ga0207660_11143000 3300025917 Bacteria 634
163 Ga0207662_10145369 3300025918 Bacteria 1504
164 Ga0207657_10023605 3300025919 Bacteria 5722
165 Ga0207657_10110347 3300025919 Bacteria 2272
166 Ga0207649_11310173 3300025920 Bacteria 573
167 Ga0207652_10000337 3300025921 Bacteria 48786
168 Ga0207652_10001233 3300025921 Bacteria 22917
169 Ga0207652_10050301 3300025921 Bacteria 3570
170 Ga0207652_10152557 3300025921 Bacteria 2069
171 Ga0207652_10494688 3300025921 Bacteria 1101
172 Ga0207652_11568056 3300025921 Bacteria 563
173 Ga0207681_10039683 3300025923 Bacteria 3127
174 Ga0207650_10120148 3300025925 Bacteria 2045
175 Ga0207659_10184098 3300025926 Bacteria 1657
176 Ga0207664_10352088 3300025929 Bacteria 1304
177 Ga0207644_10462264 3300025931 Unclassified 1043
178 Ga0207690_10017256 3300025932 Bacteria 4404
179 Ga0207706_10015732 3300025933 Bacteria 6838
180 Ga0207670_10816875 3300025936 Bacteria 777
181 Ga0207670_11302619 3300025936 Unclassified 616
182 Ga0207704_10290846 3300025938 Unclassified 1247
183 Ga0207691_10064656 3300025940 Bacteria 3313
184 Ga0207689_10016484 3300025942 Bacteria 6254
185 Ga0207661_10136369 3300025944 Bacteria 2108
186 Ga0207661_10404605 3300025944 Bacteria 1238
187 Ga0207667_10000630 3300025949 Bacteria 45583
188 Ga0207667_10044879 3300025949 Bacteria 4682
189 Ga0207667_10244952 3300025949 Unclassified 1834
190 Ga0207667_10820746 3300025949 Bacteria 926
191 Ga0207651_10079799 3300025960 Bacteria 2352
192 Ga0207651_10246756 3300025960 Bacteria 1458
193 Ga0207712_10104954 3300025961 Bacteria 2108
194 Ga0207712_10106023 3300025961 Bacteria 2099
195 Ga0207712_10182950 3300025961 Bacteria 1648
196 Ga0207668_10064674 3300025972 Bacteria 2586
197 Ga0207668_10870890 3300025972 Bacteria 800
198 Ga0207640_10369774 3300025981 Bacteria 1158
199 Ga0207640_10531951 3300025981 Bacteria 984
200 Ga0207640_11702017 3300025981 Bacteria 569
201 Ga0207658_10096431 3300025986 Bacteria 2306
202 Ga0207658_10220234 3300025986 Bacteria 1596
203 Ga0207677_10062867 3300026023 Bacteria 2578
204 Ga0207639_10532254 3300026041 Unclassified 1077
205 Ga0207678_10030589 3300026067 Bacteria 4699
206 Ga0207678_10106623 3300026067 Bacteria 2390
207 Ga0207678_10665172 3300026067 Bacteria 915
208 Ga0207708_10135466 3300026075 Bacteria 1929
209 Ga0207702_10099592 3300026078 Bacteria 2562
210 Ga0207641_10169913 3300026088 Unclassified 1989
211 Ga0207676_10026096 3300026095 Bacteria 4342
212 Ga0207676_10035585 3300026095 Bacteria 3781
213 Ga0207676_11163346 3300026095 Bacteria 764
214 Ga0207674_10049904 3300026116 Bacteria 4277
215 Ga0207674_11792165 3300026116 Bacteria 581
216 Ga0207675_100007946 3300026118 Bacteria 10005
217 Ga0207675_100106145 3300026118 Bacteria 2648
218 Ga0207675_100418565 3300026118 Bacteria 1323
219 Ga0207698_10148263 3300026142 Unclassified 2032
220 Ga0207698_10270933 3300026142 Bacteria 1565
221 Ga0207428_10067578 3300027907 Bacteria 2814
222 Ga0268265_10049710 3300028380 Bacteria 3155
223 Ga0268265_11123297 3300028380 Bacteria 781
224 Ga0268264_10012620 3300028381 Bacteria 6959
225 Ga0268264_10026714 3300028381 Bacteria 4717
226 Ga0268264_12048628 3300028381 Bacteria 581
227 Ga0307513_10126514 3300031456 Bacteria 2510
228 Ga0307509_10237280 3300031507 Bacteria 1620
229 Ga0307508_10010822 3300031616 Bacteria 8344
230 Ga0307508_10249304 3300031616 Bacteria 1372
231 Ga0307508_10343594 3300031616 Bacteria 1084
232 Ga0307413_10427714 3300031824 Bacteria 1045
233 Ga0307406_11087272 3300031901 Unclassified 690
234 Ga0395899_0006794 3300037312 Bacteria 8865
235 Ga0395899_0016549 3300037312 Bacteria 5625
236 Ga0395900_0005501 3300037418 Bacteria 13258
237 Ga0395900_0018022 3300037418 Bacteria 7209
238 Ga0395900_0252202 3300037418 Bacteria 1765
239 Ga0395900_0261607 3300037418 Bacteria 1728
240 Ga0395900_0329300 3300037418 Unclassified 1506
241 Ga0395900_0368808 3300037418 Bacteria 1406
242 Ga0395900_0924828 3300037418 Bacteria 794
243 Ga0395898_0006620 3300037466 Bacteria 12349
244 Ga0395898_0009433 3300037466 Bacteria 10251
245 Ga0395898_0033659 3300037466 Bacteria 5111
246 Ga0395898_0373138 3300037466 Unclassified 1360
247 Ga0395898_0550943 3300037466 Bacteria 1095
248 Ga0395905_0253873 3300037471 Unclassified 1642
249 Ga0395905_0403859 3300037471 Bacteria 1261
250 Ga0395901_0003324 3300038443 Bacteria 16201
251 Ga0395901_0037308 3300038443 Bacteria 5026
252 Ga0395901_0090114 3300038443 Bacteria 3210
253 Ga0395901_0213540 3300038443 Bacteria 2018
254 Ga0436365_0126548 3300039437 Bacteria 13381
255 Ga0436365_0814770 3300039437 Bacteria 785
256 Ga0439439_0112204 3300041406 Bacteria 756
257 Ga0439466_0097619 3300041411 Bacteria 918
258 Ga0451791_1537376 3300041451 Bacteria 649
259 Ga0451800_1455789 3300041459 Unclassified 607
260 Ga0451853_1288524 3300041512 Bacteria 635
261 Ga0439445_0090759 3300042004 Bacteria 860
262 Ga0439449_0098141 3300042007 Bacteria 1082
263 Ga0439462_0090694 3300042015 Bacteria 838
264 Ga0439434_0084779 3300042435 Bacteria 1008
265 Ga0495638_0262865 3300046460 Bacteria 946
266 Ga0495645_0151598 3300046543 Bacteria 1610
267 Ga0495686_0016471 3300047472 Bacteria 5012
268 Ga0495686_0056510 3300047472 Unclassified 2452
269 Ga0501032_0188637 3300049569 Bacteria 1348
270 Ga0501034_0026052 3300049571 Bacteria 5956
271 Ga0501034_0243031 3300049571 Bacteria 1746
272 Ga0501037_0361557 3300049573 Bacteria 1000
273 Ga0501038_0556777 3300049574 Bacteria 871
274 Ga0501070_0383004 3300049586 Bacteria 1139
275 Ga0501035_0423510 3300049822 Bacteria 1105
276 Ga0501044_0760106 3300049823 Unclassified 851
277 nmdc:mga0k408_350817_c1 3300050493 Unclassified 880
278 nmdc:mga0k408_46251_c1 3300050493 Bacteria 2513
279 nmdc:mga07m45_172767_c1 3300050496 Bacteria 1256
280 nmdc:mga08y16_71614_c1 3300050511 Bacteria 3612
281 nmdc:mga0n895_886022_c1 3300050512 Bacteria 878
282 Ga0500566_0259547 3300053094 Bacteria 840
283 Ga0500568_0003496 3300053139 Bacteria 8728
284 Ga0070683_100388555
285 MRS1b_contig_5166380
286 MBSR1b_contig_8174311
287 JGI24740J21852_10083578
288 JGI24743J22301_10026253
289 Ga0070658_10039679
290 Ga0070658_10065085
291 Ga0070658_10121181
292 Ga0070658_10145693
293 Ga0070658_10410105
294 Ga0070676_10045793
295 Ga0070683_100085148
296 Ga0070683_101080939
297 Ga0070670_100089976
298 Ga0070670_100113929
299 Ga0070670_100233768
300 Ga0070670_100400821
301 Ga0070670_100876729
302 Ga0070670_101287076
303 Ga0068869_100067215
304 Ga0068869_100653594
305 Ga0070680_100002384
306 Ga0070680_100517845
307 Ga0070680_100578437
308 Ga0070680_100876418
309 Ga0068868_100006299
310 Ga0070660_100191426
311 Ga0070660_100289481
312 Ga0070660_101709747
313 Ga0070689_100216857
314 Ga0070687_100123713
315 Ga0070692_10146611
316 Ga0070668_100041724
317 Ga0070668_100902223
318 Ga0070675_100106374
319 Ga0070671_100178382
320 Ga0070673_100013159
321 Ga0070673_100127457
322 Ga0070688_100009159
323 Ga0070688_100387004
324 Ga0070659_100021644
325 Ga0070659_100052231
326 Ga0070659_100090177
327 Ga0070659_100318370
328 Ga0070667_100047428
329 Ga0070667_101154845
330 Ga0070714_100389656
331 Ga0070701_10290536
332 Ga0070700_100121977
333 Ga0070663_100028505
334 Ga0070663_100072732
335 Ga0070663_100471042
336 Ga0070662_100095660
337 Ga0070662_101334543
338 Ga0070681_10019095
339 Ga0070681_10044979
340 Ga0070681_10638495
341 Ga0070679_100001254
342 Ga0070679_100151497
343 Ga0070679_101528976
344 Ga0070684_100188857
345 Ga0068853_100406283
346 Ga0070672_100032354
347 Ga0070665_100803858
348 Ga0068855_100000998
349 Ga0068855_100002978
350 Ga0068855_100032383
351 Ga0068855_100770938
352 Ga0068857_100009057
353 Ga0068857_100086673
354 Ga0068854_100103972
355 Ga0068856_100034363
356 Ga0068856_100656915
357 Ga0068852_100374150
358 Ga0068852_102274133
359 Ga0068859_100045840
360 Ga0068859_100257068
361 Ga0068864_100083365
362 Ga0068864_100190596
363 Ga0068866_10286196
364 Ga0068861_100001269
365 Ga0068861_100083497
366 Ga0068870_10007588
367 Ga0068860_100013193
368 Ga0068860_100098160
369 Ga0068860_100215922
370 Ga0068862_100010773
371 Ga0068862_101330145
372 Ga0081539_10321481
373 Ga0075366_10018570
374 Ga0075366_10019245
375 Ga0097621_100380937
376 Ga0075370_10415258
377 Ga0068871_100461927
378 Ga0075434_101103064
379 Ga0097620_100045841
380 Ga0097620_100257058
381 Ga0111539_10033749
382 Ga0111539_11909965
383 Ga0105247_10002818
384 Ga0105247_10372125
385 Ga0105241_10099443
386 Ga0105242_10715381
387 Ga0105249_10040875
388 Ga0105249_10084077
389 Ga0105249_12562180
390 Ga0157373_10012945
391 Ga0157373_10156062
392 Ga0157373_10431335
393 Ga0157373_10460375
394 Ga0157373_10926429
395 Ga0157371_10000724
396 Ga0157371_10001349
397 Ga0157371_10006056
398 Ga0157371_10006631
399 Ga0157371_10010626
400 Ga0157371_10046417
401 Ga0157371_10662493
402 Ga0157370_10000408
403 Ga0157370_10021683
404 Ga0157370_10163410
405 Ga0157370_10404349
406 Ga0157370_11480458
407 Ga0157369_10071744
408 Ga0157369_10166199
409 Ga0157369_10305241
410 Ga0157374_10038864
411 Ga0157374_11787986
412 Ga0157378_10019505
413 Ga0163162_10507407
414 Ga0157372_10008676
415 Ga0157372_10063361
416 Ga0157372_10232766
417 Ga0157372_10402665
418 Ga0157372_10876284
419 Ga0157372_11269822
420 Ga0157372_11490652
421 Ga0157375_10510846
422 Ga0157375_11773564
423 Ga0163163_10048018
424 Ga0163163_11172516
425 Ga0157380_10002159
426 Ga0157380_10517563
427 Ga0157380_10660273
428 Ga0157377_10312790
429 Ga0157379_11372171
430 Ga0157376_10070631
431 Ga0213876_10019938
432 Ga0207666_1002339
433 Ga0207710_10005817
434 Ga0207647_10026097
435 Ga0207645_10023279
436 Ga0207643_10017537
437 Ga0207705_10067782
438 Ga0207705_10093379
439 Ga0207705_10680001
440 Ga0207707_10103636
441 Ga0207707_11119032
442 Ga0207660_10060915
443 Ga0207660_11068189
444 Ga0207660_11130286
445 Ga0207660_11143000
446 Ga0207662_10145369
447 Ga0207657_10023605
448 Ga0207657_10110347
449 Ga0207649_11310173
450 Ga0207652_10000337
451 Ga0207652_10001233
452 Ga0207652_10050301
453 Ga0207652_10152557
454 Ga0207652_10494688
455 Ga0207652_11568056
456 Ga0207681_10039683
457 Ga0207650_10120148
458 Ga0207659_10184098
459 Ga0207664_10352088
460 Ga0207644_10462264
461 Ga0207690_10017256
462 Ga0207706_10015732
463 Ga0207670_10816875
464 Ga0207670_11302619
465 Ga0207704_10290846
466 Ga0207691_10064656
467 Ga0207689_10016484
468 Ga0207661_10136369
469 Ga0207661_10404605
470 Ga0207667_10000630
471 Ga0207667_10044879
472 Ga0207667_10244952
473 Ga0207667_10820746
474 Ga0207651_10079799
475 Ga0207651_10246756
476 Ga0207712_10104954
477 Ga0207712_10106023
478 Ga0207712_10182950
479 Ga0207668_10064674
480 Ga0207668_10870890
481 Ga0207640_10369774
482 Ga0207640_10531951
483 Ga0207640_11702017
484 Ga0207658_10096431
485 Ga0207658_10220234
486 Ga0207677_10062867
487 Ga0207639_10532254
488 Ga0207678_10030589
489 Ga0207678_10106623
490 Ga0207678_10665172
491 Ga0207708_10135466
492 Ga0207702_10099592
493 Ga0207641_10169913
494 Ga0207676_10026096
495 Ga0207676_10035585
496 Ga0207676_11163346
497 Ga0207674_10049904
498 Ga0207674_11792165
499 Ga0207675_100007946
500 Ga0207675_100106145
501 Ga0207675_100418565
502 Ga0207698_10148263
503 Ga0207698_10270933
504 Ga0207428_10067578
505 Ga0268265_10049710
506 Ga0268265_11123297
507 Ga0268264_10012620
508 Ga0268264_10026714
509 Ga0268264_12048628
510 Ga0307513_10126514
511 Ga0307509_10237280
512 Ga0307508_10010822
513 Ga0307508_10249304
514 Ga0307508_10343594
515 Ga0307413_10427714
516 Ga0307406_11087272
517 Ga0395899_0006794
518 Ga0395899_0016549
519 Ga0395900_0005501
520 Ga0395900_0018022
521 Ga0395900_0252202
522 Ga0395900_0261607
523 Ga0395900_0329300
524 Ga0395900_0368808
525 Ga0395900_0924828
526 Ga0395898_0006620
527 Ga0395898_0009433
528 Ga0395898_0033659
529 Ga0395898_0373138
530 Ga0395898_0550943
531 Ga0395905_0253873
532 Ga0395905_0403859
533 Ga0395901_0003324
534 Ga0395901_0037308
535 Ga0395901_0090114
536 Ga0395901_0213540
537 Ga0436365_0126548
538 Ga0436365_0814770
539 Ga0439439_0112204
540 Ga0439466_0097619
541 Ga0451791_1537376
542 Ga0451800_1455789
543 Ga0451853_1288524
544 Ga0439445_0090759
545 Ga0439449_0098141
546 Ga0439462_0090694
547 Ga0439434_0084779
548 Ga0495638_0262865
549 Ga0495645_0151598
550 Ga0495686_0016471
551 Ga0495686_0056510
552 Ga0501032_0188637
553 Ga0501034_0026052
554 Ga0501034_0243031
555 Ga0501037_0361557
556 Ga0501038_0556777
557 Ga0501070_0383004
558 Ga0501035_0423510
559 Ga0501044_0760106
560 nmdc:mga0k408_350817_c1
561 nmdc:mga0k408_46251_c1
562 nmdc:mga07m45_172767_c1
563 nmdc:mga08y16_71614_c1
564 nmdc:mga0n895_886022_c1
565 Ga0500566_0259547
566 Ga0500568_0003496

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04536

TPM_phosphatase

TPM domain

7

130

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lt2-assembly1.cif.gz_A nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov. 0.8934 9 152
2lt2-assembly1.cif.gz_A nmr structure of ba42 protein from the psychrophilic bacteria bizionia argentinensis sp. nov. 0.8706 9 152
5anp-assembly1.cif.gz_A crystal structure of the ba41 protein from bizionia argentinensis 0.8178 10 136
5anp-assembly2.cif.gz_B crystal structure of the ba41 protein from bizionia argentinensis 0.7938 10 136
7tbr-assembly1.cif.gz_A crystal structure of the tpm domain from the rhodothermus marinus protein rhom172_1776 0.753 13 136
ID Description Score Start End Superfamily
2lt2A00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8934 9 152 3.10.310.50
2lt2A00 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8706 9 152 3.10.310.50
af_P55140_17_164_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8234 9 130 3.10.310.50
af_Q9XVA8_42_196_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.8154 13 133 3.10.310.50
af_Q8I456_91_239_3.10.310.50 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1; 0.794 12 130 3.10.310.50
ID Description Score Start End GO Terms
AF-A0A0P7C1I6-F1-model_v4 TPM domain-containing protein 0.9325 11 153 GO:0016020
AF-A0A1S2VG70-F1-model_v4 TPM domain-containing protein 0.9301 9 152 GO:0016020
AF-A0A6L9LGJ8-F1-model_v4 TPM domain-containing protein 0.9295 10 152 GO:0016020
AF-A0A1G1JL65-F1-model_v4 TPM domain-containing protein 0.9278 11 152 GO:0016020
AF-A0A7Y5ERW7-F1-model_v4 TPM domain-containing protein 0.9254 11 152 GO:0016020

Map