F385302

General Info

Members Datasets Scaffolds Average Seq Length
283 148 283 241

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10000172|JGI24737J22298_100001723
Length 247
Sequence MRHIGILAHSFEGATLCFRTACLEGVGRLGAHMHPEITMTCSAMALVLDAWERGYNEQLRAFFTRDAQKLAAVGADFFVCPDNTAHIALESPGEAFPXPCLHIGEVVADRAQQDXRRKVXILGTKWTMTGPVYPGAFGRRGIGWAVPDEADRKTVDDIIFGELCLGIFTEESRAAYVRIIRKLADQGCDAVALVCTEIPLLISEEVSPLPMLDSTRLLARAAVTVAIGEWPMPQWRGGPVEERMATE

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
126 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
127 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
128 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
129 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
132 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
133 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
136 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
143 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
144 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 0
Rhizoplane 1.77
Rhizosphere 97.17
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10000172 3300001990 Bacteria 20869
2 rootL2_10323315 3300003322 Unclassified 1276
3 Ga0065715_10144951 3300005293 Bacteria 1801
4 Ga0065715_10266369 3300005293 Bacteria 1087
5 Ga0070676_10004149 3300005328 Bacteria 7608
6 Ga0070676_10154694 3300005328 Bacteria 1471
7 Ga0070670_100016706 3300005331 Bacteria 6300
8 Ga0070670_100021440 3300005331 Bacteria 5558
9 Ga0070670_100026671 3300005331 Bacteria 4971
10 Ga0070677_10074598 3300005333 Bacteria 1435
11 Ga0070660_100012018 3300005339 Bacteria 6178
12 Ga0070687_100173420 3300005343 Bacteria 1286
13 Ga0070661_100055957 3300005344 Bacteria 2889
14 Ga0070661_100062716 3300005344 Unclassified 2729
15 Ga0070661_100282989 3300005344 Bacteria 1287
16 Ga0070692_10091423 3300005345 Bacteria 1655
17 Ga0070668_100017695 3300005347 Bacteria 5345
18 Ga0070668_100035999 3300005347 Bacteria 3777
19 Ga0070668_100211828 3300005347 Bacteria 1594
20 Ga0070668_100445071 3300005347 Bacteria 1113
21 Ga0070669_100079860 3300005353 Bacteria 2433
22 Ga0070675_100025386 3300005354 Bacteria 4751
23 Ga0070675_100259183 3300005354 Bacteria 1523
24 Ga0070671_100032804 3300005355 Bacteria 4292
25 Ga0070671_100072240 3300005355 Bacteria 2881
26 Ga0070674_100005341 3300005356 Bacteria 7408
27 Ga0070674_100061440 3300005356 Bacteria 2622
28 Ga0070673_100006115 3300005364 Bacteria 7802
29 Ga0070673_100432282 3300005364 Bacteria 1182
30 Ga0070659_100005450 3300005366 Bacteria 9141
31 Ga0070659_100043964 3300005366 Bacteria 3495
32 Ga0070659_100109948 3300005366 Bacteria 2225
33 Ga0070667_100000836 3300005367 Bacteria 28641
34 Ga0070667_100274374 3300005367 Bacteria 1513
35 Ga0070700_100127984 3300005441 Bacteria 1710
36 Ga0070694_100016746 3300005444 Bacteria 4617
37 Ga0070663_100040135 3300005455 Bacteria 3275
38 Ga0070678_100559475 3300005456 Bacteria 1016
39 Ga0070662_100020818 3300005457 Bacteria 4472
40 Ga0070662_100026063 3300005457 Bacteria 4045
41 Ga0070662_100379351 3300005457 Bacteria 1163
42 Ga0068867_100018897 3300005459 Bacteria 4904
43 Ga0068853_100291208 3300005539 Unclassified 1507
44 Ga0068853_100853049 3300005539 Bacteria 874
45 Ga0070672_100006161 3300005543 Bacteria 8028
46 Ga0070672_100053047 3300005543 Bacteria 3169
47 Ga0070672_100059833 3300005543 Bacteria 2998
48 Ga0070665_100046219 3300005548 Bacteria 4373
49 Ga0068855_100079951 3300005563 Bacteria 3791
50 Ga0068855_100121820 3300005563 Bacteria 2985
51 Ga0070664_100080231 3300005564 Bacteria 2810
52 Ga0070664_100088920 3300005564 Unclassified 2671
53 Ga0070664_100176161 3300005564 Bacteria 1899
54 Ga0068857_100000424 3300005577 Bacteria 29783
55 Ga0068857_100074034 3300005577 Unclassified 3035
56 Ga0068857_100541878 3300005577 Bacteria 1095
57 Ga0068857_100670029 3300005577 Bacteria 984
58 Ga0068854_100233620 3300005578 Bacteria 1461
59 Ga0068854_100245168 3300005578 Bacteria 1428
60 Ga0068854_100282596 3300005578 Bacteria 1337
61 Ga0068856_100093104 3300005614 Bacteria 2999
62 Ga0068852_100550747 3300005616 Bacteria 1154
63 Ga0068859_100020263 3300005617 Bacteria 6676
64 Ga0068864_100144852 3300005618 Bacteria 2147
65 Ga0068864_100176448 3300005618 Bacteria 1951
66 Ga0068864_100279478 3300005618 Bacteria 1558
67 Ga0068863_100036602 3300005841 Bacteria 4675
68 Ga0068863_100045878 3300005841 Bacteria 4148
69 Ga0068863_100123087 3300005841 Bacteria 2474
70 Ga0068858_100169444 3300005842 Unclassified 2058
71 Ga0068858_100249557 3300005842 Bacteria 1685
72 Ga0068860_100011501 3300005843 Bacteria 8721
73 Ga0068860_100041476 3300005843 Bacteria 4396
74 Ga0068860_100392907 3300005843 Bacteria 1371
75 Ga0068862_100027510 3300005844 Bacteria 4787
76 Ga0068862_100227064 3300005844 Bacteria 1692
77 Ga0075366_10029492 3300006195 Bacteria 3223
78 Ga0097621_100340449 3300006237 Unclassified 1332
79 Ga0068871_100146472 3300006358 Unclassified 2011
80 Ga0075431_100428669 3300006847 Bacteria 1321
81 Ga0075431_100548233 3300006847 Bacteria 1144
82 Ga0075433_10050455 3300006852 Bacteria 3622
83 Ga0097620_100020262 3300006931 Bacteria 6676
84 Ga0105251_10037700 3300009011 Unclassified 2370
85 Ga0105240_10071809 3300009093 Bacteria 4280
86 Ga0111539_10092401 3300009094 Bacteria 3556
87 Ga0105245_10047515 3300009098 Bacteria 3838
88 Ga0114129_10328511 3300009147 Bacteria 2031
89 Ga0105243_11201472 3300009148 Bacteria 771
90 Ga0105248_10198050 3300009177 Unclassified 2263
91 Ga0105237_10571004 3300009545 Bacteria 1138
92 Ga0105249_10009708 3300009553 Bacteria 8433
93 Ga0105249_10017605 3300009553 Bacteria 6345
94 Ga0105239_10112137 3300010375 Bacteria 3024
95 Ga0157373_10305333 3300013100 Bacteria 1130
96 Ga0157371_10386842 3300013102 Bacteria 1022
97 Ga0163162_10151193 3300013306 Bacteria 2439
98 Ga0157375_10442180 3300013308 Bacteria 1466
99 Ga0163163_10046357 3300014325 Bacteria 4270
100 Ga0157380_10002756 3300014326 Bacteria 11931
101 Ga0157380_10039563 3300014326 Bacteria 3668
102 Ga0157380_10068268 3300014326 Bacteria 2865
103 Ga0157380_10170093 3300014326 Bacteria 1903
104 Ga0182008_10038133 3300014497 Unclassified 2404
105 Ga0157377_10053544 3300014745 Bacteria 2282
106 Ga0207697_10017971 3300025315 Bacteria 2902
107 Ga0207656_10073666 3300025321 Unclassified 1522
108 Ga0207682_10000595 3300025893 Bacteria 16781
109 Ga0207682_10005520 3300025893 Bacteria 5151
110 Ga0207688_10065719 3300025901 Bacteria 2050
111 Ga0207647_10001281 3300025904 Bacteria 19328
112 Ga0207647_10028524 3300025904 Bacteria 3623
113 Ga0207645_10016164 3300025907 Bacteria 4944
114 Ga0207645_10230621 3300025907 Bacteria 1222
115 Ga0207643_10153782 3300025908 Bacteria 1380
116 Ga0207671_10195133 3300025914 Unclassified 1580
117 Ga0207657_10006333 3300025919 Bacteria 12295
118 Ga0207657_10012453 3300025919 Bacteria 8398
119 Ga0207649_10199607 3300025920 Unclassified 1412
120 Ga0207681_10002684 3300025923 Bacteria 11269
121 Ga0207681_10026132 3300025923 Bacteria 3763
122 Ga0207681_10521014 3300025923 Bacteria 975
123 Ga0207650_10002108 3300025925 Bacteria 13901
124 Ga0207650_10021386 3300025925 Bacteria 4571
125 Ga0207650_10040826 3300025925 Bacteria 3397
126 Ga0207650_10214032 3300025925 Bacteria 1548
127 Ga0207659_10006537 3300025926 Bacteria 7151
128 Ga0207659_10024122 3300025926 Bacteria 4071
129 Ga0207687_10054429 3300025927 Bacteria 2799
130 Ga0207644_10058819 3300025931 Bacteria 2779
131 Ga0207644_10070362 3300025931 Bacteria 2557
132 Ga0207644_10085244 3300025931 Bacteria 2343
133 Ga0207690_10001514 3300025932 Bacteria 14537
134 Ga0207690_10203331 3300025932 Bacteria 1506
135 Ga0207706_10005097 3300025933 Bacteria 12267
136 Ga0207706_10005104 3300025933 Bacteria 12257
137 Ga0207706_10014997 3300025933 Bacteria 7016
138 Ga0207706_10283062 3300025933 Bacteria 1446
139 Ga0207709_10133207 3300025935 Bacteria 1697
140 Ga0207669_10002484 3300025937 Bacteria 7865
141 Ga0207669_10005318 3300025937 Bacteria 5764
142 Ga0207691_10000693 3300025940 Bacteria 33328
143 Ga0207691_10009544 3300025940 Bacteria 9312
144 Ga0207711_10007895 3300025941 Bacteria 8900
145 Ga0207689_10029526 3300025942 Bacteria 4578
146 Ga0207679_10014498 3300025945 Bacteria 5185
147 Ga0207679_10105804 3300025945 Bacteria 2210
148 Ga0207667_10020343 3300025949 Bacteria 7386
149 Ga0207651_10056502 3300025960 Bacteria 2701
150 Ga0207712_10001363 3300025961 Bacteria 16740
151 Ga0207712_10046624 3300025961 Bacteria 3005
152 Ga0207668_10002686 3300025972 Bacteria 10410
153 Ga0207668_10031530 3300025972 Bacteria 3492
154 Ga0207668_10050442 3300025972 Bacteria 2868
155 Ga0207668_10123453 3300025972 Bacteria 1965
156 Ga0207640_10306580 3300025981 Bacteria 1258
157 Ga0207658_10051725 3300025986 Bacteria 3028
158 Ga0207677_10693519 3300026023 Bacteria 903
159 Ga0207703_10010867 3300026035 Bacteria 7099
160 Ga0207703_10719261 3300026035 Unclassified 950
161 Ga0207639_10131995 3300026041 Bacteria 2069
162 Ga0207639_10133811 3300026041 Bacteria 2056
163 Ga0207639_10159444 3300026041 Unclassified 1900
164 Ga0207639_10494752 3300026041 Bacteria 1116
165 Ga0207639_10685884 3300026041 Bacteria 950
166 Ga0207678_10029856 3300026067 Bacteria 4760
167 Ga0207678_10059121 3300026067 Bacteria 3298
168 Ga0207641_10159529 3300026088 Bacteria 2049
169 Ga0207648_10388841 3300026089 Bacteria 1262
170 Ga0207676_10081577 3300026095 Bacteria 2628
171 Ga0207676_10143775 3300026095 Bacteria 2045
172 Ga0207676_10385252 3300026095 Bacteria 1306
173 Ga0207674_10000725 3300026116 Bacteria 43126
174 Ga0207674_10002909 3300026116 Bacteria 21260
175 Ga0207675_100028302 3300026118 Bacteria 5218
176 Ga0207683_10239098 3300026121 Bacteria 1657
177 Ga0207698_10577171 3300026142 Bacteria 1106
178 Ga0209970_1017155 3300027614 Bacteria 1211
179 Ga0268266_10149733 3300028379 Bacteria 2102
180 Ga0268265_10055853 3300028380 Bacteria 3002
181 Ga0268265_10244123 3300028380 Bacteria 1586
182 Ga0268265_10280943 3300028380 Bacteria 1489
183 Ga0268265_10350691 3300028380 Bacteria 1347
184 Ga0268264_10001863 3300028381 Bacteria 19178
185 Ga0268264_10103455 3300028381 Bacteria 2480
186 Ga0268264_10270923 3300028381 Bacteria 1586
187 Ga0307408_100087178 3300031548 Bacteria 2348
188 Ga0307408_100373917 3300031548 Unclassified 1216
189 Ga0307408_100540828 3300031548 Bacteria 1026
190 Ga0307405_10005323 3300031731 Bacteria 6194
191 Ga0307405_10176928 3300031731 Bacteria 1528
192 Ga0307413_10005309 3300031824 Bacteria 5731
193 Ga0307413_10028289 3300031824 Bacteria 3119
194 Ga0307413_10230525 3300031824 Bacteria 1360
195 Ga0307413_10289316 3300031824 Bacteria 1237
196 Ga0307413_10312040 3300031824 Unclassified 1197
197 Ga0307413_10498206 3300031824 Bacteria 977
198 Ga0307410_10002694 3300031852 Bacteria 8669
199 Ga0307410_10047036 3300031852 Bacteria 2881
200 Ga0307410_10144069 3300031852 Bacteria 1766
201 Ga0307410_10191936 3300031852 Bacteria 1554
202 Ga0307410_10253591 3300031852 Bacteria 1369
203 Ga0307410_10353660 3300031852 Bacteria 1174
204 Ga0307406_10006508 3300031901 Bacteria 6455
205 Ga0307406_10234791 3300031901 Bacteria 1372
206 Ga0307406_10326274 3300031901 Bacteria 1190
207 Ga0307407_10047487 3300031903 Bacteria 2437
208 Ga0307407_10060101 3300031903 Bacteria 2216
209 Ga0307412_10374917 3300031911 Bacteria 1150
210 Ga0307409_100001792 3300031995 Bacteria 10852
211 Ga0307409_100081848 3300031995 Bacteria 2611
212 Ga0307409_100167482 3300031995 Bacteria 1930
213 Ga0307409_100389018 3300031995 Bacteria 1328
214 Ga0307409_100554503 3300031995 Bacteria 1129
215 Ga0307409_100765979 3300031995 Bacteria 970
216 Ga0307409_100984174 3300031995 Bacteria 861
217 Ga0307414_10012961 3300032004 Bacteria 4950
218 Ga0307414_10062051 3300032004 Bacteria 2650
219 Ga0307414_10301604 3300032004 Bacteria 1355
220 Ga0307414_10771191 3300032004 Bacteria 875
221 Ga0307411_10002842 3300032005 Bacteria 7815
222 Ga0307411_10099884 3300032005 Bacteria 2049
223 Ga0307411_10331464 3300032005 Bacteria 1233
224 Ga0307411_10376551 3300032005 Bacteria 1166
225 Ga0307415_100001700 3300032126 Bacteria 10692
226 Ga0373929_0077001 3300035085 Bacteria 807
227 Ga0395899_0082547 3300037312 Bacteria 2338
228 Ga0395899_0161101 3300037312 Bacteria 1585
229 Ga0395899_0200640 3300037312 Bacteria 1391
230 Ga0395899_0510067 3300037312 Bacteria 779
231 Ga0395900_0001673 3300037418 Bacteria 25854
232 Ga0395900_0007137 3300037418 Bacteria 11577
233 Ga0395900_0033551 3300037418 Bacteria 5282
234 Ga0395900_0036528 3300037418 Bacteria 5065
235 Ga0395900_0069408 3300037418 Bacteria 3622
236 Ga0395900_0489098 3300037418 Bacteria 1182
237 Ga0395898_0103904 3300037466 Plasmid 2725
238 Ga0395898_0413965 3300037466 Bacteria 1285
239 Ga0395898_0428078 3300037466 Bacteria 1261
240 Ga0395898_0555672 3300037466 Bacteria 1090
241 Ga0395905_0000218 3300037471 Bacteria 87745
242 Ga0395905_0004444 3300037471 Bacteria 14575
243 Ga0395905_0006999 3300037471 Bacteria 11275
244 Ga0395905_0014490 3300037471 Bacteria 7523
245 Ga0395905_0092797 3300037471 Bacteria 2831
246 Ga0395905_0171272 3300037471 Bacteria 2039
247 Ga0395905_0192752 3300037471 Unclassified 1911
248 Ga0395905_0227705 3300037471 Bacteria 1744
249 Ga0395905_0273355 3300037471 Bacteria 1575
250 Ga0395901_0002884 3300038443 Bacteria 17345
251 Ga0395901_0006441 3300038443 Bacteria 11897
252 Ga0395901_0016093 3300038443 Bacteria 7619
253 Ga0395901_0054333 3300038443 Bacteria 4163
254 Ga0395901_0208111 3300038443 Bacteria 2048
255 Ga0395901_0265133 3300038443 Bacteria 1787
256 Ga0439445_0001396 3300042004 Bacteria 5243
257 Ga0439432_058375 3300042006 Bacteria 1193
258 Ga0439434_0010760 3300042435 Bacteria 2699
259 Ga0495663_0048346 3300046525 Bacteria 1311
260 Ga0495621_0000168 3300046539 Bacteria 14780
261 Ga0495621_0000939 3300046539 Bacteria 7419
262 Ga0495621_0001375 3300046539 Bacteria 6304
263 Ga0495668_0100999 3300046616 Bacteria 1578
264 Ga0495659_0044318 3300046664 Bacteria 1599
265 Ga0495661_0104338 3300046665 Bacteria 1590
266 Ga0495669_0267895 3300046684 Bacteria 821
267 Ga0495670_0003974 3300046691 Bacteria 7260
268 Ga0495670_0093624 3300046691 Bacteria 1540
269 Ga0495636_0160451 3300047318 Bacteria 1013
270 Ga0495677_0090013 3300047445 Bacteria 1156
271 Ga0496102_0069149 3300048905 Bacteria 3241
272 Ga0496103_0069596 3300048906 Unclassified 2200
273 Ga0496106_0311696 3300048909 Bacteria 1263
274 Ga0496107_0008043 3300048910 Bacteria 7282
275 Ga0496112_0060166 3300048915 Bacteria 3742
276 Ga0501216_030791 3300049660 Bacteria 990
277 Ga0501268_029970 3300049765 Bacteria 980
278 nmdc:mga0k408_71146_c1 3300050493 Bacteria 2030
279 nmdc:mga05p37_715086_c1 3300050507 Unclassified 1110
280 nmdc:mga06r32_34710_c1 3300050510 Bacteria 4757
281 nmdc:mga06r32_413392_c1 3300050510 Bacteria 1330
282 nmdc:mga0n895_478754_c1 3300050512 Bacteria 1255
283 nmdc:mga0a205_2308_c1 3300050515 Bacteria 16838

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025972 Ga0207668_10123453 Ga0207668_101234533 208
2 3300046691 Ga0495670_0093624 Ga0495670_0093624_291_995 221
3 3300026023 Ga0207677_10693519 Ga0207677_106935192 230
4 3300005344 Ga0070661_100055957 Ga0070661_1000559572 240
5 3300005345 Ga0070692_10091423 Ga0070692_100914232 240
6 3300005366 Ga0070659_100043964 Ga0070659_1000439642 240
7 3300005548 Ga0070665_100046219 Ga0070665_1000462192 240
8 3300005564 Ga0070664_100080231 Ga0070664_1000802313 240
9 3300005577 Ga0068857_100670029 Ga0068857_1006700292 240
10 3300005578 Ga0068854_100245168 Ga0068854_1002451682 240
11 3300025919 Ga0207657_10012453 Ga0207657_100124539 240
12 3300025932 Ga0207690_10203331 Ga0207690_102033312 240
13 3300025933 Ga0207706_10283062 Ga0207706_102830622 240
14 3300025941 Ga0207711_10007895 Ga0207711_100078954 240
15 3300025945 Ga0207679_10014498 Ga0207679_100144986 240
16 3300026041 Ga0207639_10494752 Ga0207639_104947522 240
17 3300026041 Ga0207639_10685884 Ga0207639_106858842 240
18 3300026067 Ga0207678_10059121 Ga0207678_100591213 240
19 3300028379 Ga0268266_10149733 Ga0268266_101497332 240
20 3300031548 Ga0307408_100087178 Ga0307408_1000871782 240
21 3300031731 Ga0307405_10005323 Ga0307405_100053233 240
22 3300031824 Ga0307413_10005309 Ga0307413_100053092 240
23 3300031824 Ga0307413_10230525 Ga0307413_102305252 240
24 3300031824 Ga0307413_10498206 Ga0307413_104982061 240
25 3300031852 Ga0307410_10144069 Ga0307410_101440692 240
26 3300031852 Ga0307410_10353660 Ga0307410_103536601 240
27 3300031901 Ga0307406_10234791 Ga0307406_102347912 240
28 3300031995 Ga0307409_100389018 Ga0307409_1003890182 240
29 3300032126 Ga0307415_100001700 Ga0307415_1000017006 240
30 3300037312 Ga0395899_0510067 Ga0395899_0510067_31_753 240
31 3300037418 Ga0395900_0069408 Ga0395900_0069408_2646_3368 240
32 3300038443 Ga0395901_0006441 Ga0395901_0006441_5633_6355 240
33 3300046539 Ga0495621_0000939 Ga0495621_0000939_5430_6152 240
34 3300046664 Ga0495659_0044318 Ga0495659_0044318_534_1256 240
35 3300046665 Ga0495661_0104338 Ga0495661_0104338_265_987 240
36 3300047445 Ga0495677_0090013 Ga0495677_0090013_74_796 240
37 3300048909 Ga0496106_0311696 Ga0496106_0311696_256_1002 240
38 3300048910 Ga0496107_0008043 Ga0496107_0008043_194_916 240
39 3300049765 Ga0501268_029970 Ga0501268_029970_245_967 240
40 3300003322 rootL2_10323315 rootL2_103233152 241
41 3300005293 Ga0065715_10144951 Ga0065715_101449512 241
42 3300005293 Ga0065715_10266369 Ga0065715_102663691 241
43 3300005328 Ga0070676_10004149 Ga0070676_100041493 241
44 3300005328 Ga0070676_10154694 Ga0070676_101546942 241
45 3300005331 Ga0070670_100016706 Ga0070670_1000167067 241
46 3300005331 Ga0070670_100021440 Ga0070670_1000214404 241
47 3300005331 Ga0070670_100026671 Ga0070670_1000266714 241
48 3300005333 Ga0070677_10074598 Ga0070677_100745982 241
49 3300005339 Ga0070660_100012018 Ga0070660_1000120184 241
50 3300005343 Ga0070687_100173420 Ga0070687_1001734201 241
51 3300005344 Ga0070661_100062716 Ga0070661_1000627162 241
52 3300005344 Ga0070661_100282989 Ga0070661_1002829892 241
53 3300005347 Ga0070668_100017695 Ga0070668_1000176953 241
54 3300005347 Ga0070668_100035999 Ga0070668_1000359993 241
55 3300005347 Ga0070668_100211828 Ga0070668_1002118282 241
56 3300005347 Ga0070668_100445071 Ga0070668_1004450712 241
57 3300005353 Ga0070669_100079860 Ga0070669_1000798602 241
58 3300005354 Ga0070675_100025386 Ga0070675_1000253864 241
59 3300005354 Ga0070675_100259183 Ga0070675_1002591832 241
60 3300005355 Ga0070671_100032804 Ga0070671_1000328043 241
61 3300005355 Ga0070671_100072240 Ga0070671_1000722402 241
62 3300005356 Ga0070674_100005341 Ga0070674_1000053411 241
63 3300005356 Ga0070674_100061440 Ga0070674_1000614402 241
64 3300005364 Ga0070673_100006115 Ga0070673_1000061152 241
65 3300005364 Ga0070673_100432282 Ga0070673_1004322822 241
66 3300005366 Ga0070659_100005450 Ga0070659_1000054504 241
67 3300005366 Ga0070659_100109948 Ga0070659_1001099483 241
68 3300005367 Ga0070667_100000836 Ga0070667_10000083629 241
69 3300005367 Ga0070667_100274374 Ga0070667_1002743742 241
70 3300005441 Ga0070700_100127984 Ga0070700_1001279842 241
71 3300005444 Ga0070694_100016746 Ga0070694_1000167464 241
72 3300005455 Ga0070663_100040135 Ga0070663_1000401352 241
73 3300005456 Ga0070678_100559475 Ga0070678_1005594751 241
74 3300005457 Ga0070662_100020818 Ga0070662_1000208182 241
75 3300005457 Ga0070662_100026063 Ga0070662_1000260631 241
76 3300005457 Ga0070662_100379351 Ga0070662_1003793512 241
77 3300005459 Ga0068867_100018897 Ga0068867_1000188977 241
78 3300005539 Ga0068853_100291208 Ga0068853_1002912082 241
79 3300005539 Ga0068853_100853049 Ga0068853_1008530491 241
80 3300005543 Ga0070672_100006161 Ga0070672_1000061613 241
81 3300005543 Ga0070672_100053047 Ga0070672_1000530472 241
82 3300005543 Ga0070672_100059833 Ga0070672_1000598332 241
83 3300005563 Ga0068855_100079951 Ga0068855_1000799512 241
84 3300005563 Ga0068855_100121820 Ga0068855_1001218204 241
85 3300005564 Ga0070664_100088920 Ga0070664_1000889202 241
86 3300005564 Ga0070664_100176161 Ga0070664_1001761612 241
87 3300005577 Ga0068857_100074034 Ga0068857_1000740344 241
88 3300005577 Ga0068857_100541878 Ga0068857_1005418781 241
89 3300005578 Ga0068854_100233620 Ga0068854_1002336202 241
90 3300005578 Ga0068854_100282596 Ga0068854_1002825962 241
91 3300005614 Ga0068856_100093104 Ga0068856_1000931042 241
92 3300005616 Ga0068852_100550747 Ga0068852_1005507472 241
93 3300005617 Ga0068859_100020263 Ga0068859_1000202638 241
94 3300005618 Ga0068864_100144852 Ga0068864_1001448522 241
95 3300005618 Ga0068864_100176448 Ga0068864_1001764482 241
96 3300005841 Ga0068863_100036602 Ga0068863_1000366023 241
97 3300005841 Ga0068863_100123087 Ga0068863_1001230872 241
98 3300005842 Ga0068858_100169444 Ga0068858_1001694443 241
99 3300005842 Ga0068858_100249557 Ga0068858_1002495572 241
100 3300005843 Ga0068860_100011501 Ga0068860_1000115019 241
101 3300005843 Ga0068860_100041476 Ga0068860_1000414762 241
102 3300005843 Ga0068860_100392907 Ga0068860_1003929072 241
103 3300005844 Ga0068862_100027510 Ga0068862_1000275105 241
104 3300005844 Ga0068862_100227064 Ga0068862_1002270642 241
105 3300006237 Ga0097621_100340449 Ga0097621_1003404492 241
106 3300006358 Ga0068871_100146472 Ga0068871_1001464722 241
107 3300006847 Ga0075431_100428669 Ga0075431_1004286692 241
108 3300006847 Ga0075431_100548233 Ga0075431_1005482332 241
109 3300006852 Ga0075433_10050455 Ga0075433_100504552 241
110 3300006931 Ga0097620_100020262 Ga0097620_1000202628 241
111 3300009011 Ga0105251_10037700 Ga0105251_100377002 241
112 3300009093 Ga0105240_10071809 Ga0105240_100718092 241
113 3300009094 Ga0111539_10092401 Ga0111539_100924012 241
114 3300009098 Ga0105245_10047515 Ga0105245_100475152 241
115 3300009147 Ga0114129_10328511 Ga0114129_103285112 241
116 3300009148 Ga0105243_11201472 Ga0105243_112014721 241
117 3300009177 Ga0105248_10198050 Ga0105248_101980502 241
118 3300009545 Ga0105237_10571004 Ga0105237_105710042 241
119 3300009553 Ga0105249_10009708 Ga0105249_100097082 241
120 3300009553 Ga0105249_10017605 Ga0105249_100176059 241
121 3300010375 Ga0105239_10112137 Ga0105239_101121372 241
122 3300013100 Ga0157373_10305333 Ga0157373_103053332 241
123 3300013102 Ga0157371_10386842 Ga0157371_103868422 241
124 3300013306 Ga0163162_10151193 Ga0163162_101511933 241
125 3300013308 Ga0157375_10442180 Ga0157375_104421802 241
126 3300014326 Ga0157380_10002756 Ga0157380_1000275617 241
127 3300014326 Ga0157380_10039563 Ga0157380_100395634 241
128 3300014326 Ga0157380_10068268 Ga0157380_100682682 241
129 3300014326 Ga0157380_10170093 Ga0157380_101700932 241
130 3300014497 Ga0182008_10038133 Ga0182008_100381332 241
131 3300014745 Ga0157377_10053544 Ga0157377_100535442 241
132 3300025315 Ga0207697_10017971 Ga0207697_100179713 241
133 3300025321 Ga0207656_10073666 Ga0207656_100736662 241
134 3300025893 Ga0207682_10000595 Ga0207682_1000059519 241
135 3300025893 Ga0207682_10005520 Ga0207682_100055204 241
136 3300025901 Ga0207688_10065719 Ga0207688_100657192 241
137 3300025904 Ga0207647_10001281 Ga0207647_1000128119 241
138 3300025907 Ga0207645_10016164 Ga0207645_100161642 241
139 3300025907 Ga0207645_10230621 Ga0207645_102306212 241
140 3300025908 Ga0207643_10153782 Ga0207643_101537822 241
141 3300025914 Ga0207671_10195133 Ga0207671_101951331 241
142 3300025919 Ga0207657_10006333 Ga0207657_100063336 241
143 3300025920 Ga0207649_10199607 Ga0207649_101996072 241
144 3300025923 Ga0207681_10002684 Ga0207681_100026849 241
145 3300025923 Ga0207681_10026132 Ga0207681_100261322 241
146 3300025923 Ga0207681_10521014 Ga0207681_105210142 241
147 3300025925 Ga0207650_10002108 Ga0207650_1000210813 241
148 3300025925 Ga0207650_10021386 Ga0207650_100213866 241
149 3300025925 Ga0207650_10214032 Ga0207650_102140322 241
150 3300025926 Ga0207659_10006537 Ga0207659_100065372 241
151 3300025926 Ga0207659_10024122 Ga0207659_100241222 241
152 3300025927 Ga0207687_10054429 Ga0207687_100544294 241
153 3300025931 Ga0207644_10058819 Ga0207644_100588194 241
154 3300025931 Ga0207644_10070362 Ga0207644_100703622 241
155 3300025931 Ga0207644_10085244 Ga0207644_100852442 241
156 3300025932 Ga0207690_10001514 Ga0207690_100015144 241
157 3300025933 Ga0207706_10005097 Ga0207706_100050979 241
158 3300025933 Ga0207706_10005104 Ga0207706_1000510411 241
159 3300025933 Ga0207706_10014997 Ga0207706_100149978 241
160 3300025935 Ga0207709_10133207 Ga0207709_101332073 241
161 3300025937 Ga0207669_10002484 Ga0207669_100024842 241
162 3300025937 Ga0207669_10005318 Ga0207669_100053181 241
163 3300025940 Ga0207691_10000693 Ga0207691_100006939 241
164 3300025940 Ga0207691_10009544 Ga0207691_100095444 241
165 3300025942 Ga0207689_10029526 Ga0207689_100295262 241
166 3300025945 Ga0207679_10105804 Ga0207679_101058043 241
167 3300025949 Ga0207667_10020343 Ga0207667_100203438 241
168 3300025960 Ga0207651_10056502 Ga0207651_100565022 241
169 3300025961 Ga0207712_10001363 Ga0207712_1000136319 241
170 3300025961 Ga0207712_10046624 Ga0207712_100466243 241
171 3300025972 Ga0207668_10002686 Ga0207668_100026864 241
172 3300025972 Ga0207668_10031530 Ga0207668_100315302 241
173 3300025972 Ga0207668_10050442 Ga0207668_100504423 241
174 3300025981 Ga0207640_10306580 Ga0207640_103065802 241
175 3300025986 Ga0207658_10051725 Ga0207658_100517254 241
176 3300026035 Ga0207703_10010867 Ga0207703_100108676 241
177 3300026035 Ga0207703_10719261 Ga0207703_107192612 241
178 3300026041 Ga0207639_10131995 Ga0207639_101319952 241
179 3300026041 Ga0207639_10133811 Ga0207639_101338112 241
180 3300026041 Ga0207639_10159444 Ga0207639_101594442 241
181 3300026067 Ga0207678_10029856 Ga0207678_100298567 241
182 3300026088 Ga0207641_10159529 Ga0207641_101595292 241
183 3300026089 Ga0207648_10388841 Ga0207648_103888412 241
184 3300026095 Ga0207676_10081577 Ga0207676_100815772 241
185 3300026095 Ga0207676_10143775 Ga0207676_101437752 241
186 3300026116 Ga0207674_10002909 Ga0207674_1000290914 241
187 3300026118 Ga0207675_100028302 Ga0207675_1000283024 241
188 3300026121 Ga0207683_10239098 Ga0207683_102390982 241
189 3300026142 Ga0207698_10577171 Ga0207698_105771712 241
190 3300027614 Ga0209970_1017155 Ga0209970_10171552 241
191 3300028380 Ga0268265_10244123 Ga0268265_102441232 241
192 3300028380 Ga0268265_10280943 Ga0268265_102809432 241
193 3300028380 Ga0268265_10350691 Ga0268265_103506912 241
194 3300028381 Ga0268264_10001863 Ga0268264_1000186316 241
195 3300028381 Ga0268264_10103455 Ga0268264_101034552 241
196 3300028381 Ga0268264_10270923 Ga0268264_102709232 241
197 3300031548 Ga0307408_100373917 Ga0307408_1003739172 241
198 3300031548 Ga0307408_100540828 Ga0307408_1005408281 241
199 3300031731 Ga0307405_10176928 Ga0307405_101769282 241
200 3300031824 Ga0307413_10028289 Ga0307413_100282892 241
201 3300031824 Ga0307413_10312040 Ga0307413_103120402 241
202 3300031852 Ga0307410_10002694 Ga0307410_100026947 241
203 3300031852 Ga0307410_10047036 Ga0307410_100470365 241
204 3300031852 Ga0307410_10191936 Ga0307410_101919362 241
205 3300031852 Ga0307410_10253591 Ga0307410_102535912 241
206 3300031901 Ga0307406_10006508 Ga0307406_100065084 241
207 3300031901 Ga0307406_10326274 Ga0307406_103262742 241
208 3300031903 Ga0307407_10047487 Ga0307407_100474872 241
209 3300031903 Ga0307407_10060101 Ga0307407_100601011 241
210 3300031995 Ga0307409_100001792 Ga0307409_1000017929 241
211 3300031995 Ga0307409_100081848 Ga0307409_1000818482 241
212 3300031995 Ga0307409_100167482 Ga0307409_1001674822 241
213 3300031995 Ga0307409_100554503 Ga0307409_1005545032 241
214 3300031995 Ga0307409_100765979 Ga0307409_1007659792 241
215 3300031995 Ga0307409_100984174 Ga0307409_1009841741 241
216 3300032004 Ga0307414_10012961 Ga0307414_100129613 241
217 3300032004 Ga0307414_10062051 Ga0307414_100620512 241
218 3300032004 Ga0307414_10301604 Ga0307414_103016042 241
219 3300032004 Ga0307414_10771191 Ga0307414_107711911 241
220 3300032005 Ga0307411_10002842 Ga0307411_100028428 241
221 3300032005 Ga0307411_10099884 Ga0307411_100998842 241
222 3300032005 Ga0307411_10376551 Ga0307411_103765512 241
223 3300035085 Ga0373929_0077001 Ga0373929_0077001_20_745 241
224 3300037312 Ga0395899_0082547 Ga0395899_0082547_890_1615 241
225 3300037312 Ga0395899_0200640 Ga0395899_0200640_181_906 241
226 3300037418 Ga0395900_0001673 Ga0395900_0001673_24072_24797 241
227 3300037418 Ga0395900_0033551 Ga0395900_0033551_1203_1928 241
228 3300037466 Ga0395898_0103904 Ga0395898_0103904_825_1550 241
229 3300037466 Ga0395898_0428078 Ga0395898_0428078_342_1067 241
230 3300037471 Ga0395905_0000218 Ga0395905_0000218_15206_15931 241
231 3300037471 Ga0395905_0006999 Ga0395905_0006999_8619_9344 241
232 3300037471 Ga0395905_0092797 Ga0395905_0092797_1700_2425 241
233 3300037471 Ga0395905_0171272 Ga0395905_0171272_1260_1985 241
234 3300037471 Ga0395905_0192752 Ga0395905_0192752_825_1550 241
235 3300037471 Ga0395905_0227705 Ga0395905_0227705_221_946 241
236 3300037471 Ga0395905_0273355 Ga0395905_0273355_810_1538 241
237 3300038443 Ga0395901_0002884 Ga0395901_0002884_13839_14564 241
238 3300038443 Ga0395901_0054333 Ga0395901_0054333_605_1330 241
239 3300038443 Ga0395901_0265133 Ga0395901_0265133_883_1608 241
240 3300042004 Ga0439445_0001396 Ga0439445_0001396_2034_2759 241
241 3300042006 Ga0439432_058375 Ga0439432_058375_279_1004 241
242 3300046525 Ga0495663_0048346 Ga0495663_0048346_126_851 241
243 3300046539 Ga0495621_0000168 Ga0495621_0000168_942_1667 241
244 3300046539 Ga0495621_0001375 Ga0495621_0001375_2165_2890 241
245 3300046616 Ga0495668_0100999 Ga0495668_0100999_597_1322 241
246 3300046684 Ga0495669_0267895 Ga0495669_0267895_86_811 241
247 3300046691 Ga0495670_0003974 Ga0495670_0003974_5600_6325 241
248 3300047318 Ga0495636_0160451 Ga0495636_0160451_187_912 241
249 3300048905 Ga0496102_0069149 Ga0496102_0069149_1398_2123 241
250 3300048906 Ga0496103_0069596 Ga0496103_0069596_463_1188 241
251 3300048915 Ga0496112_0060166 Ga0496112_0060166_2462_3187 241
252 3300049660 Ga0501216_030791 Ga0501216_030791_242_967 241
253 3300050507 nmdc:mga05p37_715086_c1 nmdc:mga05p37_715086_c1_145_870 241
254 3300050510 nmdc:mga06r32_34710_c1 nmdc:mga06r32_34710_c1_2550_3275 241
255 3300050510 nmdc:mga06r32_413392_c1 nmdc:mga06r32_413392_c1_100_825 241
256 3300050512 nmdc:mga0n895_478754_c1 nmdc:mga0n895_478754_c1_327_1052 241
257 3300050515 nmdc:mga0a205_2308_c1 nmdc:mga0a205_2308_c1_1622_2347 241
258 3300031824 Ga0307413_10289316 Ga0307413_102893162 242
259 3300031911 Ga0307412_10374917 Ga0307412_103749172 242
260 3300032005 Ga0307411_10331464 Ga0307411_103314642 242
261 3300042435 Ga0439434_0010760 Ga0439434_0010760_212_955 242
262 3300001990 JGI24737J22298_10000172 JGI24737J22298_100001723 247
263 3300005577 Ga0068857_100000424 Ga0068857_10000042417 247
264 3300005618 Ga0068864_100279478 Ga0068864_1002794782 247
265 3300005841 Ga0068863_100045878 Ga0068863_1000458783 247
266 3300006195 Ga0075366_10029492 Ga0075366_100294922 247
267 3300014325 Ga0163163_10046357 Ga0163163_100463574 247
268 3300025904 Ga0207647_10028524 Ga0207647_100285242 247
269 3300025925 Ga0207650_10040826 Ga0207650_100408263 247
270 3300026095 Ga0207676_10385252 Ga0207676_103852522 247
271 3300026116 Ga0207674_10000725 Ga0207674_1000072527 247
272 3300028380 Ga0268265_10055853 Ga0268265_100558532 247
273 3300037312 Ga0395899_0161101 Ga0395899_0161101_797_1540 247
274 3300037418 Ga0395900_0007137 Ga0395900_0007137_1591_2334 247
275 3300037418 Ga0395900_0036528 Ga0395900_0036528_735_1478 247
276 3300037418 Ga0395900_0489098 Ga0395900_0489098_94_840 247
277 3300037466 Ga0395898_0413965 Ga0395898_0413965_48_791 247
278 3300037466 Ga0395898_0555672 Ga0395898_0555672_309_1052 247
279 3300037471 Ga0395905_0004444 Ga0395905_0004444_13761_14504 247
280 3300037471 Ga0395905_0014490 Ga0395905_0014490_3714_4457 247
281 3300038443 Ga0395901_0016093 Ga0395901_0016093_4766_5509 247
282 3300038443 Ga0395901_0208111 Ga0395901_0208111_113_856 247
283 3300050493 nmdc:mga0k408_71146_c1 nmdc:mga0k408_71146_c1_132_875 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01177

Asp_Glu_race

Asp/Glu/Hydantoin racemase

13

222

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5elm-assembly2.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9341 1 224
5hqt-assembly1.cif.gz_A crystal structure of an aspartate/glutamate racemase from escherichia coli o157 0.9247 1 224
5elm-assembly2.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8881 1 224
1iu9-assembly1.cif.gz_A crystal structure of the c-terminal domain of aspartate racemase from pyrococcus horikoshii ot3 0.8825 103 210
5hqt-assembly1.cif.gz_A crystal structure of an aspartate/glutamate racemase from escherichia coli o157 0.879 1 224
ID Description Score Start End Superfamily
af_P03813_105_213_3.40.50.1860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9536 104 207 3.40.50.1860
af_P03813_2_104_3.40.50.1860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9418 2 88 3.40.50.1860
af_P03813_2_229_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9416 2 223 3.40.50.720
5ellB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9404 1 88 3.40.50.1860
af_P03813_2_229_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9136 2 223 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6N1EBM2-F1-model_v4 deleted 0.9939 60 235
AF-A0A7X0P607-F1-model_v4 Aspartate racemase (EC 5.1.1.13) 0.9926 1 236 GO:0047689
AF-A0A3A4KBP1-F1-model_v4 Amino acid racemase (EC 5.1.1.-) 0.992 1 238 GO:0047661
AF-A0A3D3DC12-F1-model_v4 Aspartate racemase 0.9873 111 224 GO:0036361
AF-A0A4R8EAY2-F1-model_v4 Aspartate racemase 0.9837 2 239 GO:0047661

Feature Viewer

pLDDT pTM Quality
93.92 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map