F385174

General Info

Members Datasets Scaffolds Average Seq Length
282 171 564 164

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_1237163|Ga0496104_1237163_133_624
Length 163
Sequence VSPYRHGAAVIDFPSDLDIVVSRDFEAPIELVFEVMTEPEHMRHHIAPYGEEVTVLDLDLRVGGEYHIVFLAPDDGREMSFRGTFLEVEPPTRTVQTWLFEGWPDAEAVETMELREHDGVTTLTYRLSFRDQAGRDHMSGFDGLLANFDNVETHLKTLLAQRG

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
61 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
102 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
170 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.26
Metatranscriptomes 6.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 6.74
Rhizosphere 91.49
Stem 0
Stem Tuber 0
Unclassified 15.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_1237163 3300048907 Bacteria 650
2 Ga0058862_11736574 3300004803 Unclassified 690
3 Ga0070658_10139508 3300005327 Bacteria 2024
4 Ga0070683_100046076 3300005329 Bacteria 4026
5 Ga0070683_100100942 3300005329 Bacteria 2717
6 Ga0070683_100287817 3300005329 Bacteria 1563
7 Ga0070683_100508523 3300005329 Bacteria 1151
8 Ga0070680_100040300 3300005336 Bacteria 3782
9 Ga0070680_100320928 3300005336 Bacteria 1315
10 Ga0070680_101416480 3300005336 Unclassified 602
11 Ga0068868_100436636 3300005338 Bacteria 1136
12 Ga0070691_10421970 3300005341 Bacteria 756
13 Ga0070661_100755762 3300005344 Bacteria 795
14 Ga0070703_10316762 3300005406 Unclassified 655
15 Ga0070709_10055807 3300005434 Bacteria 2495
16 Ga0070709_10066946 3300005434 Bacteria 2305
17 Ga0070714_100026693 3300005435 Bacteria 4775
18 Ga0070714_100243790 3300005435 Unclassified 1659
19 Ga0070714_100657293 3300005435 Bacteria 1009
20 Ga0070714_100890072 3300005435 Unclassified 864
21 Ga0070713_100025848 3300005436 Bacteria 4598
22 Ga0070713_100107378 3300005436 Bacteria 2428
23 Ga0070713_100139012 3300005436 Bacteria 2149
24 Ga0070713_100883731 3300005436 Unclassified 859
25 Ga0070710_10012119 3300005437 Bacteria 4273
26 Ga0070710_10253984 3300005437 Bacteria 1131
27 Ga0070710_10858206 3300005437 Bacteria 652
28 Ga0070711_100203929 3300005439 Bacteria 1528
29 Ga0070708_100238112 3300005445 Bacteria 1709
30 Ga0070681_10045565 3300005458 Bacteria 4387
31 Ga0070681_10050987 3300005458 Bacteria 4128
32 Ga0070706_100106689 3300005467 Bacteria 2606
33 Ga0070707_100152814 3300005468 Bacteria 2247
34 Ga0070707_100525914 3300005468 Bacteria 1145
35 Ga0070707_100939510 3300005468 Unclassified 830
36 Ga0070698_100035927 3300005471 Bacteria 5122
37 Ga0070698_100952343 3300005471 Bacteria 805
38 Ga0070699_100519350 3300005518 Bacteria 1083
39 Ga0070679_100029034 3300005530 Bacteria 5455
40 Ga0070679_100042055 3300005530 Bacteria 4550
41 Ga0070679_100323686 3300005530 Bacteria 1491
42 Ga0070684_100003680 3300005535 Bacteria 11570
43 Ga0070684_100186236 3300005535 Bacteria 1888
44 Ga0070684_100505586 3300005535 Bacteria 1119
45 Ga0070684_101310035 3300005535 Bacteria 682
46 Ga0070697_100228778 3300005536 Bacteria 1586
47 Ga0070693_100902914 3300005547 Bacteria 662
48 Ga0068855_100188505 3300005563 Bacteria 2328
49 Ga0068855_100205559 3300005563 Bacteria 2215
50 Ga0068855_100220856 3300005563 Bacteria 2125
51 Ga0068857_100767603 3300005577 Bacteria 919
52 Ga0068856_100068420 3300005614 Bacteria 3510
53 Ga0068856_100591721 3300005614 Bacteria 1130
54 Ga0068852_101554519 3300005616 Bacteria 684
55 Ga0068861_100128883 3300005719 Bacteria 2051
56 Ga0070717_10051075 3300006028 Bacteria 3401
57 Ga0070717_10108045 3300006028 Bacteria 2370
58 Ga0070717_10159779 3300006028 Bacteria 1954
59 Ga0070717_10306902 3300006028 Bacteria 1411
60 Ga0070717_10507356 3300006028 Unclassified 1090
61 Ga0070715_10166824 3300006163 Unclassified 1093
62 Ga0070716_100076794 3300006173 Bacteria 1981
63 Ga0070712_100011400 3300006175 Bacteria 5635
64 Ga0070712_100041632 3300006175 Bacteria 3155
65 Ga0070712_100111814 3300006175 Bacteria 2040
66 Ga0070712_101109558 3300006175 Unclassified 687
67 Ga0068871_100065607 3300006358 Bacteria 2973
68 Ga0075428_100025957 3300006844 Bacteria 6487
69 Ga0075431_100115961 3300006847 Bacteria 2765
70 Ga0075433_10039187 3300006852 Bacteria 4096
71 Ga0075434_100008206 3300006871 Bacteria 9689
72 Ga0075434_100200089 3300006871 Bacteria 2017
73 Ga0075434_100914871 3300006871 Unclassified 892
74 Ga0075436_100125578 3300006914 Bacteria 1797
75 Ga0075436_100141646 3300006914 Bacteria 1690
76 Ga0075436_100237268 3300006914 Unclassified 1296
77 Ga0075436_100793430 3300006914 Bacteria 705
78 Ga0075435_100004410 3300007076 Bacteria 9659
79 Ga0075435_100177249 3300007076 Bacteria 1800
80 Ga0075435_100252369 3300007076 Bacteria 1502
81 Ga0105240_10089565 3300009093 Bacteria 3763
82 Ga0105240_10787132 3300009093 Bacteria 1031
83 Ga0111539_10073254 3300009094 Bacteria 4038
84 Ga0105245_10083662 3300009098 Bacteria 2921
85 Ga0105245_10505209 3300009098 Bacteria 1226
86 Ga0114129_10109319 3300009147 Bacteria 3817
87 Ga0105237_10377333 3300009545 Bacteria 1422
88 Ga0105238_10062718 3300009551 Bacteria 3717
89 Ga0105238_10433623 3300009551 Bacteria 1310
90 Ga0105249_10171965 3300009553 Bacteria 2102
91 Ga0099796_10067159 3300010159 Unclassified 1286
92 Ga0105239_10015119 3300010375 Bacteria 8556
93 Ga0105246_11138415 3300011119 Unclassified 715
94 Ga0157373_10579926 3300013100 Bacteria 815
95 Ga0157373_11137820 3300013100 Bacteria 587
96 Ga0157370_10049268 3300013104 Bacteria 4032
97 Ga0157370_10572293 3300013104 Bacteria 1035
98 Ga0157369_10022424 3300013105 Bacteria 7045
99 Ga0157369_10252440 3300013105 Unclassified 1840
100 Ga0163162_10341857 3300013306 Bacteria 1629
101 Ga0157372_10030957 3300013307 Bacteria 5856
102 Ga0157372_10540672 3300013307 Bacteria 1358
103 Ga0157372_10558660 3300013307 Bacteria 1334
104 Ga0157372_10869635 3300013307 Unclassified 1046
105 Ga0157372_11928931 3300013307 Unclassified 679
106 Ga0157372_12295970 3300013307 Unclassified 620
107 Ga0157375_11502020 3300013308 Bacteria 795
108 Ga0157376_10185795 3300014969 Bacteria 1903
109 Ga0197907_10165693 3300020069 Unclassified 1743
110 Ga0197907_11495528 3300020069 Unclassified 715
111 Ga0206356_11483307 3300020070 Unclassified 896
112 Ga0206355_1115822 3300020076 Bacteria 1077
113 Ga0206351_10413155 3300020077 Bacteria 1113
114 Ga0206351_10770591 3300020077 Bacteria 707
115 Ga0206354_10493096 3300020081 Bacteria 2178
116 Ga0206353_11509041 3300020082 Bacteria 1115
117 Ga0154015_1157299 3300020610 Bacteria 783
118 Ga0154015_1599495 3300020610 Unclassified 937
119 Ga0213875_10001861 3300021388 Bacteria 13118
120 Ga0213875_10159501 3300021388 Bacteria 1058
121 Ga0224712_10022522 3300022467 Unclassified 2173
122 Ga0224712_10062594 3300022467 Bacteria 1487
123 Ga0224712_10073887 3300022467 Bacteria 1391
124 Ga0224712_10210929 3300022467 Bacteria 886
125 Ga0224712_10241867 3300022467 Unclassified 831
126 Ga0224712_10278421 3300022467 Bacteria 778
127 Ga0224712_10302991 3300022467 Unclassified 748
128 Ga0207692_10019954 3300025898 Bacteria 3040
129 Ga0207685_10119509 3300025905 Unclassified 1154
130 Ga0207699_10077849 3300025906 Bacteria 2047
131 Ga0207699_10420016 3300025906 Unclassified 955
132 Ga0207705_10655627 3300025909 Bacteria 816
133 Ga0207684_10134819 3300025910 Bacteria 2120
134 Ga0207684_10148434 3300025910 Bacteria 2017
135 Ga0207684_10414726 3300025910 Bacteria 1157
136 Ga0207707_10093323 3300025912 Bacteria 2629
137 Ga0207707_10248288 3300025912 Bacteria 1546
138 Ga0207695_10141695 3300025913 Bacteria 2352
139 Ga0207693_10007328 3300025915 Bacteria 9073
140 Ga0207693_10010380 3300025915 Bacteria 7561
141 Ga0207693_10075977 3300025915 Bacteria 2631
142 Ga0207693_10243443 3300025915 Bacteria 1412
143 Ga0207693_10347490 3300025915 Unclassified 1161
144 Ga0207663_10045995 3300025916 Bacteria 2687
145 Ga0207660_10251766 3300025917 Bacteria 1394
146 Ga0207660_10331771 3300025917 Bacteria 1216
147 Ga0207649_10810623 3300025920 Bacteria 731
148 Ga0207652_10100675 3300025921 Bacteria 2551
149 Ga0207652_10138712 3300025921 Bacteria 2173
150 Ga0207646_10255912 3300025922 Bacteria 1582
151 Ga0207646_10534175 3300025922 Bacteria 1055
152 Ga0207694_10362049 3300025924 Bacteria 1202
153 Ga0207694_10634654 3300025924 Bacteria 899
154 Ga0207700_10029817 3300025928 Bacteria 3854
155 Ga0207700_10091151 3300025928 Bacteria 2407
156 Ga0207700_10226734 3300025928 Bacteria 1587
157 Ga0207700_10690996 3300025928 Bacteria 910
158 Ga0207700_10749408 3300025928 Unclassified 873
159 Ga0207664_10031718 3300025929 Bacteria 4045
160 Ga0207664_10105190 3300025929 Bacteria 2339
161 Ga0207664_10153402 3300025929 Bacteria 1959
162 Ga0207664_10320941 3300025929 Bacteria 1367
163 Ga0207664_10542046 3300025929 Unclassified 1043
164 Ga0207664_11030531 3300025929 Unclassified 737
165 Ga0207690_10221536 3300025932 Bacteria 1448
166 Ga0207665_10011924 3300025939 Bacteria 5708
167 Ga0207665_10029806 3300025939 Bacteria 3605
168 Ga0207661_10190238 3300025944 Bacteria 1799
169 Ga0207661_10226272 3300025944 Bacteria 1655
170 Ga0207661_10342981 3300025944 Bacteria 1346
171 Ga0207679_11027523 3300025945 Bacteria 756
172 Ga0207667_10557454 3300025949 Unclassified 1159
173 Ga0207712_10055847 3300025961 Bacteria 2780
174 Ga0207702_10680712 3300026078 Bacteria 1013
175 Ga0207674_10085681 3300026116 Bacteria 3145
176 Ga0207675_100080277 3300026118 Bacteria 3058
177 Ga0207698_10275206 3300026142 Bacteria 1554
178 Ga0207428_10087175 3300027907 Bacteria 2429
179 Ga0265338_10110889 3300028800 Bacteria 2210
180 Ga0265332_10179528 3300031238 Bacteria 882
181 Ga0265320_10052394 3300031240 Bacteria 1977
182 Ga0265325_10031810 3300031241 Bacteria 2820
183 Ga0265340_10200469 3300031247 Bacteria 897
184 Ga0265339_10115146 3300031249 Bacteria 1387
185 Ga0265316_10085590 3300031344 Bacteria 2412
186 Ga0265316_10563115 3300031344 Unclassified 810
187 Ga0373926_0368568 3300035083 Unclassified 565
188 Ga0373944_0002837 3300035089 Bacteria 4434
189 Ga0373923_0003067 3300035111 Bacteria 5288
190 Ga0373936_0000602 3300035113 Bacteria 12454
191 Ga0373945_0000122 3300035116 Bacteria 19157
192 Ga0373943_0000154 3300035170 Bacteria 26850
193 Ga0373946_0000320 3300035171 Bacteria 15539
194 Ga0373931_0080255 3300035691 Bacteria 1799
195 Ga0373935_0002999 3300035692 Bacteria 9737
196 Ga0373935_1026797 3300035692 Unclassified 613
197 Ga0373927_0000295 3300035695 Bacteria 39423
198 Ga0373933_0057154 3300035724 Bacteria 2344
199 Ga0373947_0000143 3300035725 Bacteria 37108
200 Ga0373947_0158362 3300035725 Bacteria 1463
201 Ga0373925_0001994 3300037068 Bacteria 16911
202 Ga0373925_0028656 3300037068 Bacteria 4080
203 Ga0373925_0172224 3300037068 Bacteria 1709
204 Ga0373925_0604073 3300037068 Bacteria 903
205 Ga0395899_0010198 3300037312 Bacteria 7199
206 Ga0395900_0004344 3300037418 Bacteria 15038
207 Ga0395898_0026811 3300037466 Bacteria 5791
208 Ga0395905_0013399 3300037471 Bacteria 7856
209 Ga0436364_0273664 3300037853 Bacteria 21979
210 Ga0395901_0029235 3300038443 Bacteria 5671
211 Ga0395901_0061350 3300038443 Bacteria 3912
212 Ga0436362_0820759 3300039453 Unclassified 609
213 Ga0451853_3797733 3300041512 Unclassified 701
214 Ga0466969_0136931 3300044656 Bacteria 1133
215 Ga0466961_0046196 3300044693 Unclassified 2786
216 Ga0466960_0042604 3300044901 Unclassified 2156
217 Ga0466967_0008307 3300045976 Bacteria 7591
218 Ga0466967_0085704 3300045976 Bacteria 2852
219 Ga0466967_0215521 3300045976 Bacteria 1822
220 Ga0466967_0232091 3300045976 Bacteria 1757
221 Ga0495641_0007538 3300046461 Bacteria 6777
222 Ga0495653_0003160 3300046463 Bacteria 13196
223 Ga0495664_0003056 3300046477 Bacteria 9066
224 Ga0495608_0202157 3300046511 Bacteria 1251
225 Ga0495618_0009275 3300046514 Bacteria 5938
226 Ga0495630_0063139 3300046517 Bacteria 2782
227 Ga0495652_0013772 3300046529 Bacteria 7276
228 Ga0495665_0055853 3300046531 Bacteria 2085
229 Ga0495667_0005468 3300046559 Bacteria 8584
230 Ga0495667_0550124 3300046559 Bacteria 721
231 Ga0495634_0014934 3300046642 Bacteria 5584
232 Ga0495635_0014284 3300046663 Bacteria 5556
233 Ga0495635_0546299 3300046663 Bacteria 760
234 Ga0495647_0172711 3300046681 Bacteria 937
235 Ga0495624_0011510 3300046690 Bacteria 6081
236 Ga0495600_0008444 3300046809 Bacteria 6327
237 Ga0495581_0014168 3300047315 Bacteria 4621
238 Ga0495674_0000541 3300047319 Bacteria 34957
239 Ga0495680_0010708 3300047322 Bacteria 8178
240 Ga0495684_0015990 3300047471 Bacteria 5778
241 Ga0495602_0373777 3300048088 Bacteria 1023
242 Ga0496100_0017415 3300048903 Bacteria 4241
243 Ga0496100_0504262 3300048903 Bacteria 933
244 Ga0496101_0005929 3300048904 Bacteria 7825
245 Ga0496102_0270370 3300048905 Bacteria 1602
246 Ga0496102_0938242 3300048905 Bacteria 787
247 Ga0496103_0112004 3300048906 Bacteria 1734
248 Ga0496104_0026747 3300048907 Bacteria 5331
249 Ga0496104_0685497 3300048907 Bacteria 933
250 Ga0496105_0211357 3300048908 Bacteria 1581
251 Ga0496106_0005599 3300048909 Bacteria 9301
252 Ga0496106_0439575 3300048909 Bacteria 1048
253 Ga0496107_0030371 3300048910 Bacteria 3851
254 Ga0496109_0145295 3300048912 Bacteria 2219
255 Ga0496110_0527585 3300048913 Bacteria 1074
256 Ga0496112_1331574 3300048915 Bacteria 633
257 Ga0496113_0422557 3300048916 Bacteria 1071
258 Ga0496114_0008205 3300048917 Bacteria 8278
259 Ga0496114_0009909 3300048917 Bacteria 7572
260 Ga0501042_0447941 3300049578 Bacteria 936
261 Ga0501067_0034123 3300049583 Bacteria 2823
262 Ga0501067_0326089 3300049583 Unclassified 855
263 Ga0501069_0295987 3300049585 Bacteria 948
264 Ga0501070_0294385 3300049586 Bacteria 1323
265 nmdc:mga0yw44_116442_c1 3300050492 Bacteria 1717
266 nmdc:mga05p37_9392_c1 3300050507 Bacteria 11578
267 nmdc:mga06r32_215137_c1 3300050510 Bacteria 1909
268 nmdc:mga08y16_395210_c1 3300050511 Bacteria 1416
269 nmdc:mga0n895_1385949_c1 3300050512 Unclassified 672
270 nmdc:mga0n895_16454_c1 3300050512 Bacteria 6788
271 nmdc:mga0n895_456394_c1 3300050512 Bacteria 1290
272 nmdc:mga0n895_92781_c1 3300050512 Bacteria 3023
273 nmdc:mga0rr50_16413_c1 3300050513 Bacteria 4919
274 nmdc:mga0rr50_47589_c1 3300050513 Bacteria 3165
275 nmdc:mga08x19_125685_c1 3300050514 Bacteria 1722
276 nmdc:mga08x19_220155_c1 3300050514 Unclassified 1304
277 nmdc:mga08x19_29391_c1 3300050514 Bacteria 3447
278 nmdc:mga08x19_967844_c1 3300050514 Bacteria 605
279 nmdc:mga0a205_97868_c1 3300050515 Bacteria 2833
280 Ga0495601_0297761 3300053077 Bacteria 1051
281 Ga0587082_086640 3300059504 Unclassified 661
282 Ga0530510_0536758 3300061734 Bacteria 888
283 Ga0496104_1237163
284 Ga0058862_11736574
285 Ga0070658_10139508
286 Ga0070683_100046076
287 Ga0070683_100100942
288 Ga0070683_100287817
289 Ga0070683_100508523
290 Ga0070680_100040300
291 Ga0070680_100320928
292 Ga0070680_101416480
293 Ga0068868_100436636
294 Ga0070691_10421970
295 Ga0070661_100755762
296 Ga0070703_10316762
297 Ga0070709_10055807
298 Ga0070709_10066946
299 Ga0070714_100026693
300 Ga0070714_100243790
301 Ga0070714_100657293
302 Ga0070714_100890072
303 Ga0070713_100025848
304 Ga0070713_100107378
305 Ga0070713_100139012
306 Ga0070713_100883731
307 Ga0070710_10012119
308 Ga0070710_10253984
309 Ga0070710_10858206
310 Ga0070711_100203929
311 Ga0070708_100238112
312 Ga0070681_10045565
313 Ga0070681_10050987
314 Ga0070706_100106689
315 Ga0070707_100152814
316 Ga0070707_100525914
317 Ga0070707_100939510
318 Ga0070698_100035927
319 Ga0070698_100952343
320 Ga0070699_100519350
321 Ga0070679_100029034
322 Ga0070679_100042055
323 Ga0070679_100323686
324 Ga0070684_100003680
325 Ga0070684_100186236
326 Ga0070684_100505586
327 Ga0070684_101310035
328 Ga0070697_100228778
329 Ga0070693_100902914
330 Ga0068855_100188505
331 Ga0068855_100205559
332 Ga0068855_100220856
333 Ga0068857_100767603
334 Ga0068856_100068420
335 Ga0068856_100591721
336 Ga0068852_101554519
337 Ga0068861_100128883
338 Ga0070717_10051075
339 Ga0070717_10108045
340 Ga0070717_10159779
341 Ga0070717_10306902
342 Ga0070717_10507356
343 Ga0070715_10166824
344 Ga0070716_100076794
345 Ga0070712_100011400
346 Ga0070712_100041632
347 Ga0070712_100111814
348 Ga0070712_101109558
349 Ga0068871_100065607
350 Ga0075428_100025957
351 Ga0075431_100115961
352 Ga0075433_10039187
353 Ga0075434_100008206
354 Ga0075434_100200089
355 Ga0075434_100914871
356 Ga0075436_100125578
357 Ga0075436_100141646
358 Ga0075436_100237268
359 Ga0075436_100793430
360 Ga0075435_100004410
361 Ga0075435_100177249
362 Ga0075435_100252369
363 Ga0105240_10089565
364 Ga0105240_10787132
365 Ga0111539_10073254
366 Ga0105245_10083662
367 Ga0105245_10505209
368 Ga0114129_10109319
369 Ga0105237_10377333
370 Ga0105238_10062718
371 Ga0105238_10433623
372 Ga0105249_10171965
373 Ga0099796_10067159
374 Ga0105239_10015119
375 Ga0105246_11138415
376 Ga0157373_10579926
377 Ga0157373_11137820
378 Ga0157370_10049268
379 Ga0157370_10572293
380 Ga0157369_10022424
381 Ga0157369_10252440
382 Ga0163162_10341857
383 Ga0157372_10030957
384 Ga0157372_10540672
385 Ga0157372_10558660
386 Ga0157372_10869635
387 Ga0157372_11928931
388 Ga0157372_12295970
389 Ga0157375_11502020
390 Ga0157376_10185795
391 Ga0197907_10165693
392 Ga0197907_11495528
393 Ga0206356_11483307
394 Ga0206355_1115822
395 Ga0206351_10413155
396 Ga0206351_10770591
397 Ga0206354_10493096
398 Ga0206353_11509041
399 Ga0154015_1157299
400 Ga0154015_1599495
401 Ga0213875_10001861
402 Ga0213875_10159501
403 Ga0224712_10022522
404 Ga0224712_10062594
405 Ga0224712_10073887
406 Ga0224712_10210929
407 Ga0224712_10241867
408 Ga0224712_10278421
409 Ga0224712_10302991
410 Ga0207692_10019954
411 Ga0207685_10119509
412 Ga0207699_10077849
413 Ga0207699_10420016
414 Ga0207705_10655627
415 Ga0207684_10134819
416 Ga0207684_10148434
417 Ga0207684_10414726
418 Ga0207707_10093323
419 Ga0207707_10248288
420 Ga0207695_10141695
421 Ga0207693_10007328
422 Ga0207693_10010380
423 Ga0207693_10075977
424 Ga0207693_10243443
425 Ga0207693_10347490
426 Ga0207663_10045995
427 Ga0207660_10251766
428 Ga0207660_10331771
429 Ga0207649_10810623
430 Ga0207652_10100675
431 Ga0207652_10138712
432 Ga0207646_10255912
433 Ga0207646_10534175
434 Ga0207694_10362049
435 Ga0207694_10634654
436 Ga0207700_10029817
437 Ga0207700_10091151
438 Ga0207700_10226734
439 Ga0207700_10690996
440 Ga0207700_10749408
441 Ga0207664_10031718
442 Ga0207664_10105190
443 Ga0207664_10153402
444 Ga0207664_10320941
445 Ga0207664_10542046
446 Ga0207664_11030531
447 Ga0207690_10221536
448 Ga0207665_10011924
449 Ga0207665_10029806
450 Ga0207661_10190238
451 Ga0207661_10226272
452 Ga0207661_10342981
453 Ga0207679_11027523
454 Ga0207667_10557454
455 Ga0207712_10055847
456 Ga0207702_10680712
457 Ga0207674_10085681
458 Ga0207675_100080277
459 Ga0207698_10275206
460 Ga0207428_10087175
461 Ga0265338_10110889
462 Ga0265332_10179528
463 Ga0265320_10052394
464 Ga0265325_10031810
465 Ga0265340_10200469
466 Ga0265339_10115146
467 Ga0265316_10085590
468 Ga0265316_10563115
469 Ga0373926_0368568
470 Ga0373944_0002837
471 Ga0373923_0003067
472 Ga0373936_0000602
473 Ga0373945_0000122
474 Ga0373943_0000154
475 Ga0373946_0000320
476 Ga0373931_0080255
477 Ga0373935_0002999
478 Ga0373935_1026797
479 Ga0373927_0000295
480 Ga0373933_0057154
481 Ga0373947_0000143
482 Ga0373947_0158362
483 Ga0373925_0001994
484 Ga0373925_0028656
485 Ga0373925_0172224
486 Ga0373925_0604073
487 Ga0395899_0010198
488 Ga0395900_0004344
489 Ga0395898_0026811
490 Ga0395905_0013399
491 Ga0436364_0273664
492 Ga0395901_0029235
493 Ga0395901_0061350
494 Ga0436362_0820759
495 Ga0451853_3797733
496 Ga0466969_0136931
497 Ga0466961_0046196
498 Ga0466960_0042604
499 Ga0466967_0008307
500 Ga0466967_0085704
501 Ga0466967_0215521
502 Ga0466967_0232091
503 Ga0495641_0007538
504 Ga0495653_0003160
505 Ga0495664_0003056
506 Ga0495608_0202157
507 Ga0495618_0009275
508 Ga0495630_0063139
509 Ga0495652_0013772
510 Ga0495665_0055853
511 Ga0495667_0005468
512 Ga0495667_0550124
513 Ga0495634_0014934
514 Ga0495635_0014284
515 Ga0495635_0546299
516 Ga0495647_0172711
517 Ga0495624_0011510
518 Ga0495600_0008444
519 Ga0495581_0014168
520 Ga0495674_0000541
521 Ga0495680_0010708
522 Ga0495684_0015990
523 Ga0495602_0373777
524 Ga0496100_0017415
525 Ga0496100_0504262
526 Ga0496101_0005929
527 Ga0496102_0270370
528 Ga0496102_0938242
529 Ga0496103_0112004
530 Ga0496104_0026747
531 Ga0496104_0685497
532 Ga0496105_0211357
533 Ga0496106_0005599
534 Ga0496106_0439575
535 Ga0496107_0030371
536 Ga0496109_0145295
537 Ga0496110_0527585
538 Ga0496112_1331574
539 Ga0496113_0422557
540 Ga0496114_0008205
541 Ga0496114_0009909
542 Ga0501042_0447941
543 Ga0501067_0034123
544 Ga0501067_0326089
545 Ga0501069_0295987
546 Ga0501070_0294385
547 nmdc:mga0yw44_116442_c1
548 nmdc:mga05p37_9392_c1
549 nmdc:mga06r32_215137_c1
550 nmdc:mga08y16_395210_c1
551 nmdc:mga0n895_1385949_c1
552 nmdc:mga0n895_16454_c1
553 nmdc:mga0n895_456394_c1
554 nmdc:mga0n895_92781_c1
555 nmdc:mga0rr50_16413_c1
556 nmdc:mga0rr50_47589_c1
557 nmdc:mga08x19_125685_c1
558 nmdc:mga08x19_220155_c1
559 nmdc:mga08x19_29391_c1
560 nmdc:mga08x19_967844_c1
561 nmdc:mga0a205_97868_c1
562 Ga0495601_0297761
563 Ga0587082_086640
564 Ga0530510_0536758

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

26

156

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xuv-assembly2.cif.gz_B-2 x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. 0.9284 8 161
3pu2-assembly1.cif.gz_A crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9257 8 156
3pu2-assembly2.cif.gz_B crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.925 9 156
3pu2-assembly4.cif.gz_D crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9188 8 156
3pu2-assembly5.cif.gz_E crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.918 8 157
ID Description Score Start End Superfamily
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9235 8 157 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9184 8 160 3.30.530.20
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9113 8 157 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8789 10 154 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8772 18 153 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A2A5RLI1-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9842 11 165
AF-A0A2V9FGY1-F1-model_v4 ATPase 0.9733 6 136
AF-A0A7W0N0Q3-F1-model_v4 SRPBCC family protein 0.9711 7 130
AF-A0A542VLE7-F1-model_v4 deleted 0.9671 20 161
AF-A0A538GTP8-F1-model_v4 ATPase 0.9645 1 166

Map