F385094

General Info

Members Datasets Scaffolds Average Seq Length
282 217 564 320

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0978037|Ga0436363_0978037_259_1359
Length 366
Sequence MLLGVLDIGSNSAQLQVFEARSGAPPLPTHAVKAATLLGEAFGPDDAIDLAGVDRVVEAVNHAMNAARRLGVQQLYVFTTSAVRDAPNRDVILDRVEAEAGVRPQFLSGEDEARLTYLAVHQWYGWSAGRLLILDIGGGSMEIVLGRDAEPELALSLPLGAGRLSRTFLPDDPPRHEQIAALRRYVNATLREVADRLLWEGLPDRAIGTSKTFKQLARLAGAPAQRKGPFVPRSVTARDLEGWIPRLARLPAQQRAKLRGVSRSRSRQIVAGAVVAKAAMKALNVDSVDICPWALREGIILHYLQTTRGESFDLPLRPLTGATYGNGRLGVRGSGHGHVSLVTPSAASPGHGESGYGRQVSSAGDG

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
87 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
88 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
101 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
177 2501939600 Micromonospora sp. L5 Isolate Unclassified
178 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
179 2582580736 Prauserella sp. Am3 Isolate Unclassified
180 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
181 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
182 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
183 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
184 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
185 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
186 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
187 2855683550 Micromonospora sp. RP3T Isolate Unclassified
188 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
189 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
190 2858868258 Micromonospora sp. MH33 Isolate Unclassified
191 2858882152 Micromonospora noduli MED15 Isolate Nodule
192 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
193 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
194 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
195 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
196 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
197 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
198 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
199 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
200 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
201 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
202 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
203 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
204 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
205 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
206 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
207 2902582711 Micromonospora sp. AP08 Isolate Unclassified
208 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
209 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
210 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
211 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
212 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
213 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
214 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
215 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
216 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
217 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.11
Metatranscriptomes 0.35
Isolates 14.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 1.77
Rhizoplane 4.26
Rhizosphere 80.85
Stem 0
Stem Tuber 0.35
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_0978037 3300039450 Bacteria 4814
2 JGI25406J46586_10004640 3300003203 Bacteria 6396
3 Ga0070683_100038123 3300005329 Bacteria 4403
4 Ga0070683_100064223 3300005329 Bacteria 3417
5 Ga0070683_100149554 3300005329 Bacteria 2214
6 Ga0068869_100004314 3300005334 Bacteria 8829
7 Ga0068869_100110500 3300005334 Bacteria 2090
8 Ga0068869_100235726 3300005334 Bacteria 1456
9 Ga0070680_100161272 3300005336 Bacteria 1884
10 Ga0068868_100005203 3300005338 Bacteria 9132
11 Ga0070692_10010798 3300005345 Bacteria 4173
12 Ga0070669_100052454 3300005353 Bacteria 2984
13 Ga0070675_100001433 3300005354 Bacteria 17504
14 Ga0070667_100170819 3300005367 Bacteria 1919
15 Ga0070667_100198886 3300005367 Bacteria 1778
16 Ga0070713_100029055 3300005436 Bacteria 4372
17 Ga0070710_10148587 3300005437 Bacteria 1443
18 Ga0070700_100042155 3300005441 Bacteria 2801
19 Ga0070700_100164868 3300005441 Bacteria 1529
20 Ga0070663_100002797 3300005455 Bacteria 9900
21 Ga0070663_100282256 3300005455 Bacteria 1324
22 Ga0070678_100264090 3300005456 Bacteria 1449
23 Ga0070678_100264320 3300005456 Bacteria 1448
24 Ga0070662_100016110 3300005457 Bacteria 5014
25 Ga0070662_100107283 3300005457 Bacteria 2123
26 Ga0068853_100086492 3300005539 Bacteria 2749
27 Ga0068853_100269911 3300005539 Bacteria 1566
28 Ga0070672_100041340 3300005543 Bacteria 3544
29 Ga0070665_100046207 3300005548 Bacteria 4374
30 Ga0070665_100233548 3300005548 Bacteria 1839
31 Ga0070664_100000129 3300005564 Bacteria 50535
32 Ga0070664_100020112 3300005564 Bacteria 5497
33 Ga0070664_100084184 3300005564 Bacteria 2745
34 Ga0068857_100105418 3300005577 Bacteria 2531
35 Ga0068854_100055909 3300005578 Bacteria 2843
36 Ga0070702_100080806 3300005615 Bacteria 1946
37 Ga0068864_100209641 3300005618 Bacteria 1794
38 Ga0068870_10160990 3300005840 Bacteria 1331
39 Ga0068870_10184648 3300005840 Bacteria 1254
40 Ga0068858_100123105 3300005842 Bacteria 2427
41 Ga0068860_100218873 3300005843 Bacteria 1849
42 Ga0068862_100377140 3300005844 Bacteria 1322
43 Ga0081455_10000239 3300005937 Bacteria 71193
44 Ga0081455_10000692 3300005937 Bacteria 43780
45 Ga0081539_10000094 3300005985 Bacteria 206102
46 Ga0070716_100011783 3300006173 Bacteria 4410
47 Ga0070716_100244952 3300006173 Bacteria 1218
48 Ga0070712_100052398 3300006175 Bacteria 2846
49 Ga0075428_100154290 3300006844 Bacteria 2495
50 Ga0075428_100430732 3300006844 Bacteria 1413
51 Ga0075431_100074069 3300006847 Bacteria 3514
52 Ga0075433_10226328 3300006852 Bacteria 1661
53 Ga0075429_100258948 3300006880 Bacteria 1523
54 Ga0068865_100095394 3300006881 Bacteria 2167
55 Ga0111539_10002620 3300009094 Bacteria 23860
56 Ga0105245_10010908 3300009098 Bacteria 7904
57 Ga0105245_10164254 3300009098 Bacteria 2109
58 Ga0105245_10205495 3300009098 Bacteria 1893
59 Ga0114129_10113108 3300009147 Bacteria 3743
60 Ga0105243_10050563 3300009148 Bacteria 3284
61 Ga0105248_10671846 3300009177 Bacteria 1169
62 Ga0105237_10035524 3300009545 Bacteria 5043
63 Ga0105238_10203952 3300009551 Bacteria 1953
64 Ga0105249_10102131 3300009553 Bacteria 2698
65 Ga0105239_10269178 3300010375 Bacteria 1916
66 Ga0157369_10038208 3300013105 Bacteria 5249
67 Ga0157374_10060297 3300013296 Bacteria 3550
68 Ga0157374_10527896 3300013296 Bacteria 1187
69 Ga0157374_10608794 3300013296 Bacteria 1103
70 Ga0163162_10427329 3300013306 Bacteria 1457
71 Ga0157372_10084294 3300013307 Bacteria 3602
72 Ga0157372_10262646 3300013307 Bacteria 2005
73 Ga0163163_10220045 3300014325 Bacteria 1947
74 Ga0157380_10410758 3300014326 Bacteria 1287
75 Ga0157377_10079162 3300014745 Bacteria 1917
76 Ga0157376_10031763 3300014969 Bacteria 4233
77 Ga0224712_10064480 3300022467 Bacteria 1469
78 Ga0207699_10189639 3300025906 Bacteria 1386
79 Ga0207643_10135579 3300025908 Bacteria 1467
80 Ga0207643_10151350 3300025908 Bacteria 1391
81 Ga0207693_10040883 3300025915 Bacteria 3652
82 Ga0207660_10146719 3300025917 Bacteria 1809
83 Ga0207657_10012111 3300025919 Bacteria 8523
84 Ga0207681_10053683 3300025923 Bacteria 2737
85 Ga0207659_10001580 3300025926 Bacteria 13505
86 Ga0207687_10009453 3300025927 Bacteria 6377
87 Ga0207700_10016962 3300025928 Bacteria 4851
88 Ga0207700_10069216 3300025928 Bacteria 2708
89 Ga0207690_10190380 3300025932 Bacteria 1551
90 Ga0207706_10048378 3300025933 Bacteria 3761
91 Ga0207706_10142724 3300025933 Bacteria 2106
92 Ga0207686_10061589 3300025934 Bacteria 2380
93 Ga0207704_10148628 3300025938 Bacteria 1650
94 Ga0207691_10245644 3300025940 Bacteria 1546
95 Ga0207711_10234967 3300025941 Bacteria 1680
96 Ga0207689_10002797 3300025942 Bacteria 16110
97 Ga0207689_10094327 3300025942 Bacteria 2458
98 Ga0207661_10009949 3300025944 Bacteria 6831
99 Ga0207661_10490016 3300025944 Bacteria 1123
100 Ga0207679_10005935 3300025945 Bacteria 7680
101 Ga0207679_10105022 3300025945 Bacteria 2218
102 Ga0207679_10154615 3300025945 Bacteria 1871
103 Ga0207712_10537625 3300025961 Bacteria 1004
104 Ga0207668_10002836 3300025972 Bacteria 10150
105 Ga0207677_10009515 3300026023 Bacteria 5471
106 Ga0207703_10112183 3300026035 Bacteria 2329
107 Ga0207703_10425898 3300026035 Bacteria 1236
108 Ga0207678_10003506 3300026067 Bacteria 14109
109 Ga0207678_10004858 3300026067 Bacteria 12071
110 Ga0207708_10016543 3300026075 Bacteria 5547
111 Ga0207708_10156420 3300026075 Bacteria 1798
112 Ga0207674_10055829 3300026116 Bacteria 4013
113 Ga0207674_10085207 3300026116 Bacteria 3156
114 Ga0207674_10092079 3300026116 Bacteria 3021
115 Ga0207683_10222478 3300026121 Bacteria 1720
116 Ga0207683_10314038 3300026121 Bacteria 1435
117 Ga0207698_10062132 3300026142 Bacteria 2915
118 Ga0207428_10004452 3300027907 Bacteria 13308
119 Ga0268266_10117165 3300028379 Bacteria 2367
120 Ga0268265_10353558 3300028380 Bacteria 1342
121 Ga0307515_10283484 3300028794 Bacteria 1361
122 Ga0307512_10004546 3300030522 Bacteria 15156
123 Ga0265328_10013737 3300031239 Bacteria 3199
124 Ga0307513_10049467 3300031456 Bacteria 4553
125 Ga0307408_100228008 3300031548 Bacteria 1524
126 Ga0307508_10076995 3300031616 Bacteria 2914
127 Ga0307405_10007016 3300031731 Bacteria 5600
128 Ga0307413_10016786 3300031824 Bacteria 3795
129 Ga0307518_10002805 3300031838 Bacteria 12656
130 Ga0307406_10023385 3300031901 Bacteria 3675
131 Ga0307406_10232692 3300031901 Bacteria 1377
132 Ga0307412_10027485 3300031911 Bacteria 3548
133 Ga0307409_100000172 3300031995 Bacteria 25235
134 Ga0307409_100017156 3300031995 Bacteria 4816
135 Ga0307416_100003890 3300032002 Bacteria 8886
136 Ga0307415_100000019 3300032126 Bacteria 70406
137 Ga0307415_100052180 3300032126 Bacteria 2779
138 Ga0373934_0122282 3300035086 Bacteria 1059
139 Ga0373936_0000129 3300035113 Bacteria 26180
140 Ga0373936_0057932 3300035113 Bacteria 1576
141 Ga0373953_0032711 3300035117 Bacteria 2030
142 Ga0373943_0140656 3300035170 Bacteria 1300
143 Ga0373946_0004701 3300035171 Bacteria 4904
144 Ga0373924_0018113 3300035410 Bacteria 2711
145 Ga0373931_0014280 3300035691 Bacteria 3879
146 Ga0373935_0025420 3300035692 Bacteria 3649
147 Ga0373927_0089767 3300035695 Bacteria 1995
148 Ga0373933_0065300 3300035724 Bacteria 2203
149 Ga0373947_0015331 3300035725 Bacteria 4399
150 Ga0373937_0047290 3300036401 Bacteria 3936
151 Ga0373925_0030621 3300037068 Bacteria 3950
152 Ga0466969_0002172 3300044656 Bacteria 10479
153 Ga0466969_0003206 3300044656 Bacteria 8711
154 Ga0466966_0001621 3300044684 Bacteria 14489
155 Ga0466961_0001418 3300044693 Bacteria 14866
156 Ga0466961_0013468 3300044693 Bacteria 5237
157 Ga0466963_0104892 3300044694 Unclassified 1937
158 Ga0466970_0007063 3300044765 Bacteria 5617
159 Ga0466957_0105143 3300044842 Bacteria 1784
160 Ga0466959_0012892 3300045049 Bacteria 6051
161 Ga0466967_0151473 3300045976 Bacteria 2168
162 Ga0466967_0463804 3300045976 Bacteria 1239
163 Ga0495592_0019982 3300046454 Bacteria 5092
164 Ga0495603_0009713 3300046455 Bacteria 5820
165 Ga0495603_0024223 3300046455 Bacteria 3670
166 Ga0495603_0026416 3300046455 Bacteria 3507
167 Ga0495603_0203059 3300046455 Bacteria 1145
168 Ga0495629_0001493 3300046459 Bacteria 18395
169 Ga0495629_0006813 3300046459 Bacteria 8446
170 Ga0495651_0064529 3300046462 Bacteria 2798
171 Ga0495653_0013092 3300046463 Bacteria 6762
172 Ga0495580_0108618 3300046472 Bacteria 1926
173 Ga0495639_0042251 3300046475 Bacteria 2056
174 Ga0495662_0008648 3300046476 Bacteria 5004
175 Ga0495662_0027276 3300046476 Bacteria 2759
176 Ga0495662_0027427 3300046476 Bacteria 2751
177 Ga0495662_0049112 3300046476 Bacteria 2037
178 Ga0495664_0009648 3300046477 Bacteria 5404
179 Ga0495618_0027859 3300046514 Bacteria 3518
180 Ga0495628_0052901 3300046516 Bacteria 3206
181 Ga0495630_0037006 3300046517 Bacteria 3648
182 Ga0495630_0241669 3300046517 Bacteria 1380
183 Ga0495652_0033468 3300046529 Bacteria 4487
184 Ga0495652_0063609 3300046529 Bacteria 3106
185 Ga0495640_0013363 3300046533 Bacteria 6237
186 Ga0495587_0062448 3300046536 Bacteria 2181
187 Ga0495587_0130873 3300046536 Bacteria 1434
188 Ga0495645_0021016 3300046543 Bacteria 4716
189 Ga0495645_0136646 3300046543 Bacteria 1714
190 Ga0495633_0087412 3300046558 Bacteria 1449
191 Ga0495667_0003508 3300046559 Bacteria 10519
192 Ga0495634_0028006 3300046642 Bacteria 3914
193 Ga0495635_0032509 3300046663 Bacteria 3619
194 Ga0495635_0122066 3300046663 Bacteria 1777
195 Ga0495635_0153411 3300046663 Bacteria 1568
196 Ga0495588_0057485 3300046674 Bacteria 2009
197 Ga0495588_0064035 3300046674 Bacteria 1907
198 Ga0495657_0006597 3300046675 Bacteria 9064
199 Ga0495657_0032021 3300046675 Bacteria 3673
200 Ga0495599_0016304 3300046678 Bacteria 4613
201 Ga0495646_0019630 3300046680 Bacteria 4276
202 Ga0495613_0007144 3300046689 Bacteria 8313
203 Ga0495613_0127707 3300046689 Bacteria 1822
204 Ga0495613_0152489 3300046689 Bacteria 1647
205 Ga0495624_0177507 3300046690 Bacteria 1298
206 Ga0495670_0119040 3300046691 Bacteria 1371
207 Ga0495589_0064884 3300046794 Bacteria 1790
208 Ga0495600_0063603 3300046809 Bacteria 2411
209 Ga0495581_0037713 3300047315 Bacteria 2798
210 Ga0495581_0087682 3300047315 Bacteria 1804
211 Ga0495636_0001969 3300047318 Bacteria 7868
212 Ga0495636_0057717 3300047318 Bacteria 1635
213 Ga0495674_0012912 3300047319 Bacteria 7866
214 Ga0495676_0029340 3300047321 Bacteria 4685
215 Ga0495680_0024824 3300047322 Bacteria 4965
216 Ga0495675_0023984 3300047444 Bacteria 3887
217 Ga0495685_014110 3300047447 Bacteria 2712
218 Ga0495684_0001151 3300047471 Bacteria 21288
219 Ga0495684_0037083 3300047471 Bacteria 3738
220 Ga0495614_0088571 3300048089 Bacteria 1345
221 Ga0496101_0161631 3300048904 Bacteria 1718
222 Ga0496102_0063130 3300048905 Bacteria 3392
223 Ga0496103_0033889 3300048906 Bacteria 3121
224 Ga0496104_0274650 3300048907 Bacteria 1598
225 Ga0496105_0404997 3300048908 Bacteria 1082
226 Ga0496108_0131859 3300048911 Bacteria 2148
227 Ga0496108_0178108 3300048911 Bacteria 1841
228 Ga0496109_0016717 3300048912 Bacteria 6418
229 Ga0496111_0440139 3300048914 Bacteria 962
230 Ga0496113_0004007 3300048916 Bacteria 8957
231 Ga0496114_0023649 3300048917 Bacteria 5015
232 Ga0496114_0121690 3300048917 Bacteria 2245
233 Ga0501038_0174350 3300049574 Bacteria 1739
234 nmdc:mga05p37_181359_c1 3300050507 Bacteria 2561
235 nmdc:mga09592_180813_c1 3300050508 Bacteria 1824
236 nmdc:mga09592_301127_c1 3300050508 Bacteria 1390
237 nmdc:mga06r32_38171_c1 3300050510 Bacteria 4548
238 nmdc:mga08y16_2982_c1 3300050511 Bacteria 17452
239 nmdc:mga0n895_157375_c1 3300050512 Bacteria 2303
240 nmdc:mga08x19_47481_c2 3300050514 Bacteria 1368
241 Ga0500616_0009327 3300053153 Bacteria 5978
242 2501945493 2501939600 Bacteria 6907073
243 2515495506 2515154088 Bacteria 5526283
244 2583148843 2582580736 Bacteria 5325865
245 2585298114 2582581312 Bacteria 7308206
246 2586064740 2585427649 Bacteria 9053857
247 2772645505 2772190715 Bacteria 6959372
248 2809586026 2808606522 Bacteria 9488490
249 2832010209 2832004796 Bacteria 6538017
250 2855673873 2855670206 Bacteria 7120389
251 2855679471 2855676851 Bacteria 7063653
252 2855686997 2855683550 Bacteria 7134265
253 2857289453 2857288857 Bacteria 7189066
254 2858851965 2858848962 Bacteria 6963058
255 2858870053 2858868258 Bacteria 7683772
256 2858887987 2858882152 Bacteria 7230291
257 2858895394 2858888857 Bacteria 7060307
258 2858900152 2858895516 Bacteria 7378898
259 2858902785 2858902515 Bacteria 7086037
260 2862295201 2862290372 Bacteria 7471434
261 2866617291 2866612099 Bacteria 7543886
262 2867306128 2867302475 Bacteria 7087181
263 2867317325 2867312974 Bacteria 7058875
264 2867323142 2867319477 Bacteria 7069771
265 2869051513 2869048445 Bacteria 6875584
266 2869065745 2869061728 Bacteria 7112407
267 2869071694 2869068681 Bacteria 7205615
268 2880495028 2880489317 Bacteria 7096270
269 2880497303 2880495981 Bacteria 7340502
270 2899361180 2899359706 Bacteria 10940472
271 2899373717 2899370129 Bacteria 6781179
272 2902584164 2902582711 Bacteria 6187705
273 2915773071 2915768154 Bacteria 8424322
274 2929225870 2929219909 Bacteria 6984360
275 2929231139 2929226422 Bacteria 7248583
276 3006428427 3006425503 Bacteria 6491253
277 8003833338 8003830390 Bacteria 6541657
278 8003858095 8003856774 Bacteria 7675274
279 8003870849 8003870546 Bacteria 7396674
280 8054704374 8054704163 Bacteria 7247792
281 8054731532 8054727385 Bacteria 7558670
282 8054736117 8054734606 Bacteria 6947278
283 Ga0436363_0978037
284 JGI25406J46586_10004640
285 Ga0070683_100038123
286 Ga0070683_100064223
287 Ga0070683_100149554
288 Ga0068869_100004314
289 Ga0068869_100110500
290 Ga0068869_100235726
291 Ga0070680_100161272
292 Ga0068868_100005203
293 Ga0070692_10010798
294 Ga0070669_100052454
295 Ga0070675_100001433
296 Ga0070667_100170819
297 Ga0070667_100198886
298 Ga0070713_100029055
299 Ga0070710_10148587
300 Ga0070700_100042155
301 Ga0070700_100164868
302 Ga0070663_100002797
303 Ga0070663_100282256
304 Ga0070678_100264090
305 Ga0070678_100264320
306 Ga0070662_100016110
307 Ga0070662_100107283
308 Ga0068853_100086492
309 Ga0068853_100269911
310 Ga0070672_100041340
311 Ga0070665_100046207
312 Ga0070665_100233548
313 Ga0070664_100000129
314 Ga0070664_100020112
315 Ga0070664_100084184
316 Ga0068857_100105418
317 Ga0068854_100055909
318 Ga0070702_100080806
319 Ga0068864_100209641
320 Ga0068870_10160990
321 Ga0068870_10184648
322 Ga0068858_100123105
323 Ga0068860_100218873
324 Ga0068862_100377140
325 Ga0081455_10000239
326 Ga0081455_10000692
327 Ga0081539_10000094
328 Ga0070716_100011783
329 Ga0070716_100244952
330 Ga0070712_100052398
331 Ga0075428_100154290
332 Ga0075428_100430732
333 Ga0075431_100074069
334 Ga0075433_10226328
335 Ga0075429_100258948
336 Ga0068865_100095394
337 Ga0111539_10002620
338 Ga0105245_10010908
339 Ga0105245_10164254
340 Ga0105245_10205495
341 Ga0114129_10113108
342 Ga0105243_10050563
343 Ga0105248_10671846
344 Ga0105237_10035524
345 Ga0105238_10203952
346 Ga0105249_10102131
347 Ga0105239_10269178
348 Ga0157369_10038208
349 Ga0157374_10060297
350 Ga0157374_10527896
351 Ga0157374_10608794
352 Ga0163162_10427329
353 Ga0157372_10084294
354 Ga0157372_10262646
355 Ga0163163_10220045
356 Ga0157380_10410758
357 Ga0157377_10079162
358 Ga0157376_10031763
359 Ga0224712_10064480
360 Ga0207699_10189639
361 Ga0207643_10135579
362 Ga0207643_10151350
363 Ga0207693_10040883
364 Ga0207660_10146719
365 Ga0207657_10012111
366 Ga0207681_10053683
367 Ga0207659_10001580
368 Ga0207687_10009453
369 Ga0207700_10016962
370 Ga0207700_10069216
371 Ga0207690_10190380
372 Ga0207706_10048378
373 Ga0207706_10142724
374 Ga0207686_10061589
375 Ga0207704_10148628
376 Ga0207691_10245644
377 Ga0207711_10234967
378 Ga0207689_10002797
379 Ga0207689_10094327
380 Ga0207661_10009949
381 Ga0207661_10490016
382 Ga0207679_10005935
383 Ga0207679_10105022
384 Ga0207679_10154615
385 Ga0207712_10537625
386 Ga0207668_10002836
387 Ga0207677_10009515
388 Ga0207703_10112183
389 Ga0207703_10425898
390 Ga0207678_10003506
391 Ga0207678_10004858
392 Ga0207708_10016543
393 Ga0207708_10156420
394 Ga0207674_10055829
395 Ga0207674_10085207
396 Ga0207674_10092079
397 Ga0207683_10222478
398 Ga0207683_10314038
399 Ga0207698_10062132
400 Ga0207428_10004452
401 Ga0268266_10117165
402 Ga0268265_10353558
403 Ga0307515_10283484
404 Ga0307512_10004546
405 Ga0265328_10013737
406 Ga0307513_10049467
407 Ga0307408_100228008
408 Ga0307508_10076995
409 Ga0307405_10007016
410 Ga0307413_10016786
411 Ga0307518_10002805
412 Ga0307406_10023385
413 Ga0307406_10232692
414 Ga0307412_10027485
415 Ga0307409_100000172
416 Ga0307409_100017156
417 Ga0307416_100003890
418 Ga0307415_100000019
419 Ga0307415_100052180
420 Ga0373934_0122282
421 Ga0373936_0000129
422 Ga0373936_0057932
423 Ga0373953_0032711
424 Ga0373943_0140656
425 Ga0373946_0004701
426 Ga0373924_0018113
427 Ga0373931_0014280
428 Ga0373935_0025420
429 Ga0373927_0089767
430 Ga0373933_0065300
431 Ga0373947_0015331
432 Ga0373937_0047290
433 Ga0373925_0030621
434 Ga0466969_0002172
435 Ga0466969_0003206
436 Ga0466966_0001621
437 Ga0466961_0001418
438 Ga0466961_0013468
439 Ga0466963_0104892
440 Ga0466970_0007063
441 Ga0466957_0105143
442 Ga0466959_0012892
443 Ga0466967_0151473
444 Ga0466967_0463804
445 Ga0495592_0019982
446 Ga0495603_0009713
447 Ga0495603_0024223
448 Ga0495603_0026416
449 Ga0495603_0203059
450 Ga0495629_0001493
451 Ga0495629_0006813
452 Ga0495651_0064529
453 Ga0495653_0013092
454 Ga0495580_0108618
455 Ga0495639_0042251
456 Ga0495662_0008648
457 Ga0495662_0027276
458 Ga0495662_0027427
459 Ga0495662_0049112
460 Ga0495664_0009648
461 Ga0495618_0027859
462 Ga0495628_0052901
463 Ga0495630_0037006
464 Ga0495630_0241669
465 Ga0495652_0033468
466 Ga0495652_0063609
467 Ga0495640_0013363
468 Ga0495587_0062448
469 Ga0495587_0130873
470 Ga0495645_0021016
471 Ga0495645_0136646
472 Ga0495633_0087412
473 Ga0495667_0003508
474 Ga0495634_0028006
475 Ga0495635_0032509
476 Ga0495635_0122066
477 Ga0495635_0153411
478 Ga0495588_0057485
479 Ga0495588_0064035
480 Ga0495657_0006597
481 Ga0495657_0032021
482 Ga0495599_0016304
483 Ga0495646_0019630
484 Ga0495613_0007144
485 Ga0495613_0127707
486 Ga0495613_0152489
487 Ga0495624_0177507
488 Ga0495670_0119040
489 Ga0495589_0064884
490 Ga0495600_0063603
491 Ga0495581_0037713
492 Ga0495581_0087682
493 Ga0495636_0001969
494 Ga0495636_0057717
495 Ga0495674_0012912
496 Ga0495676_0029340
497 Ga0495680_0024824
498 Ga0495675_0023984
499 Ga0495685_014110
500 Ga0495684_0001151
501 Ga0495684_0037083
502 Ga0495614_0088571
503 Ga0496101_0161631
504 Ga0496102_0063130
505 Ga0496103_0033889
506 Ga0496104_0274650
507 Ga0496105_0404997
508 Ga0496108_0131859
509 Ga0496108_0178108
510 Ga0496109_0016717
511 Ga0496111_0440139
512 Ga0496113_0004007
513 Ga0496114_0023649
514 Ga0496114_0121690
515 Ga0501038_0174350
516 nmdc:mga05p37_181359_c1
517 nmdc:mga09592_180813_c1
518 nmdc:mga09592_301127_c1
519 nmdc:mga06r32_38171_c1
520 nmdc:mga08y16_2982_c1
521 nmdc:mga0n895_157375_c1
522 nmdc:mga08x19_47481_c2
523 Ga0500616_0009327
524 2501945493
525 2515495506
526 2583148843
527 2585298114
528 2586064740
529 2772645505
530 2809586026
531 2832010209
532 2855673873
533 2855679471
534 2855686997
535 2857289453
536 2858851965
537 2858870053
538 2858887987
539 2858895394
540 2858900152
541 2858902785
542 2862295201
543 2866617291
544 2867306128
545 2867317325
546 2867323142
547 2869051513
548 2869065745
549 2869071694
550 2880495028
551 2880497303
552 2899361180
553 2899373717
554 2902584164
555 2915773071
556 2929225870
557 2929231139
558 3006428427
559 8003833338
560 8003858095
561 8003870849
562 8054704374
563 8054731532
564 8054736117

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02541

Ppx-GppA

Ppx/GppA phosphatase family

17

307

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gla-assembly1.cif.gz_G-2 structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase 0.8452 1 33
6xb3-assembly6.cif.gz_K structure of acnpv poxin in post-reactive state with gp[2'-5']ap[3'] 0.8169 118 144
6xb3-assembly1.cif.gz_A structure of acnpv poxin in post-reactive state with gp[2'-5']ap[3'] 0.8114 118 144
6xb3-assembly5.cif.gz_I structure of acnpv poxin in post-reactive state with gp[2'-5']ap[3'] 0.8113 118 144
6xb3-assembly5.cif.gz_J structure of acnpv poxin in post-reactive state with gp[2'-5']ap[3'] 0.8109 118 144
ID Description Score Start End Superfamily
af_P9WHV5_128_308_3.30.420.150 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Exopolyphosphatase. Domain 2 0.9586 114 296 3.30.420.150
af_P9WHV5_128_308_3.30.420.150 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Exopolyphosphatase. Domain 2 0.9431 114 296 3.30.420.150
af_Q9VZV9_30_306_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8864 2 19 3.30.420.40
2j4rB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Exopolyphosphatase. Domain 2 0.8663 115 291 3.30.420.150
af_P96374_137_319_3.30.420.150 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Exopolyphosphatase. Domain 2 0.8618 117 292 3.30.420.150
ID Description Score Start End GO Terms
AF-A0A7K2NVQ0-F1-model_v4 Ppx/GppA family phosphatase 0.9849 198 297 GO:0016462
AF-A0A655HYN7-F1-model_v4 deleted 0.9662 62 296
AF-A0A4Y9NLI4-F1-model_v4 Ppx/GppA phosphatase N-terminal domain-containing protein 0.9634 121 300 GO:0016462
AF-Q46054-F1-model_v4 Ppx protein 0.9619 163 296 GO:0016462
AF-A0A7K0N6X3-F1-model_v4 Ppx/GppA family phosphatase 0.9604 137 297 GO:0016462

Map