F385007

General Info

Members Datasets Scaffolds Average Seq Length
282 201 241 251

Family's Representative Sequence

Representative Sequence 3300027866|Ga0209813_10012678|Ga0209813_100126782
Length 276
Sequence MFRNDRATLPLAGHGWRMDGIERVLMSNILKGKVALVTGGSRGLGAAAAEALADQGADVAISYVASAGKAEAVVAKLKAKGVRALAIRSDQADTAAARPLIDEVVAHFGRLDILVNNAAIAVQGKTIDDPDLDTVNLDRQWQINVMGAVATTRAAAPVLSDGGRIIFIGSLLGSRVPFSGVADYAGTKAAVAGYAKAVARDLGRRNITVNVVQPGIMPTDMAAEVRDKLPDAIMDLHPIRRIATLEEVSAIVCFLAGPNGGYITGGVVDVSGGLQV

Samples

Sample ID Description Type Environment
1 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
2 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
3 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
4 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
5 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
6 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
7 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
8 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
9 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
10 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
11 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
12 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
13 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
14 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
15 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
16 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
17 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
18 2643221585 Pelomonas sp. Root662 Isolate Unclassified
19 2643221656 Pelomonas sp. Root405 Isolate Unclassified
20 2643221664 Massilia sp. Root418 Isolate Unclassified
21 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
22 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
23 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
24 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
25 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
26 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
27 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
28 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
29 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
30 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
31 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
32 2857558681 Duganella sp. R-74565 Isolate Unclassified
33 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
34 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
35 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
36 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
37 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
38 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
39 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
40 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
41 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
42 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
43 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
44 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
45 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
46 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
47 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
48 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
49 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
50 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
51 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
52 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
53 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
54 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
55 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
56 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
57 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
58 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
73 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
119 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
120 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
129 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
132 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
133 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
136 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
137 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
140 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
144 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
145 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
146 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
147 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
148 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
149 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
150 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
160 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
161 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
162 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
163 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
166 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
167 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
174 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
175 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
176 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
179 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
180 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
184 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
185 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
186 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
187 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
188 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
189 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
190 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
191 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
192 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
193 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
194 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
195 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
197 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
198 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
199 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
200 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
201 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.46
Metatranscriptomes 0
Isolates 14.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.37
Nodule 6.03
Rhizoplane 4.61
Rhizosphere 47.52
Stem 0
Stem Tuber 0
Unclassified 13.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000017 3300001979 Bacteria 57092
2 JGI25158J39367_1000110 3300002739 Bacteria 19044
3 JGI25152J39213_1001392 3300002773 Bacteria 10475
4 JGI25152J39213_1004054 3300002773 Bacteria 4766
5 JGI25152J39213_1004484 3300002773 Bacteria 4388
6 JGI25152J39213_1005535 3300002773 Bacteria 3650
7 JGI25159J45721_1000788 3300002987 Bacteria 13784
8 JGI25159J45721_1010414 3300002987 Bacteria 2368
9 JGI25151J46595_10000413 3300003187 Bacteria 43589
10 JGI25151J46595_10018198 3300003187 Bacteria 3026
11 JGI25153J46596_10002531 3300003215 Bacteria 10475
12 JGI25153J46596_10006842 3300003215 Bacteria 5698
13 JGI25153J46596_10033455 3300003215 Bacteria 1696
14 rootH1_10274006 3300003323 Bacteria 2087
15 JGI25160J50197_1007401 3300003354 Bacteria 4301
16 JGI25160J50197_1020122 3300003354 Bacteria 2024
17 JGI25161J50226_1000107 3300003374 Bacteria 65408
18 Ga0055526_1015683 3300003771 Bacteria 3025
19 Ga0055524_1000025 3300003775 Bacteria 216427
20 Ga0055528_1008010 3300003790 Bacteria 4591
21 Ga0055530_10000123 3300003791 Bacteria 66893
22 Ga0055540_1000159 3300003792 Bacteria 66893
23 Ga0055540_1006316 3300003792 Bacteria 4733
24 Ga0055543_1000074 3300004625 Bacteria 88424
25 Ga0065165_1016247 3300005262 Bacteria 2795
26 Ga0070690_100226624 3300005330 Bacteria 1312
27 Ga0070670_100571688 3300005331 Bacteria 1010
28 Ga0068869_100735912 3300005334 Bacteria 843
29 Ga0070666_10027286 3300005335 Bacteria 3738
30 Ga0070663_100000022 3300005455 Bacteria 111612
31 Ga0070663_100128955 3300005455 Bacteria 1918
32 Ga0070684_100087023 3300005535 Bacteria 2774
33 Ga0068853_100512901 3300005539 Bacteria 1133
34 Ga0070665_100145820 3300005548 Bacteria 2370
35 Ga0068855_100249790 3300005563 Bacteria 1979
36 Ga0068857_100034631 3300005577 Bacteria 4467
37 Ga0068856_100000041 3300005614 Bacteria 112613
38 Ga0068856_100127963 3300005614 Bacteria 2543
39 Ga0068856_100221828 3300005614 Bacteria 1906
40 Ga0068859_100065426 3300005617 Bacteria 3670
41 Ga0068863_100019435 3300005841 Bacteria 6498
42 Ga0068858_100006060 3300005842 Bacteria 11787
43 Ga0068860_100000185 3300005843 Bacteria 99579
44 Ga0075368_10003491 3300006042 Bacteria 5258
45 Ga0097620_100065426 3300006931 Bacteria 3670
46 Ga0079104_1000010 3300006946 Bacteria 366021
47 Ga0099826_10000005 3300006948 Bacteria 465206
48 Ga0105244_10001814 3300009036 Bacteria 16711
49 Ga0105240_10364080 3300009093 Bacteria 1637
50 Ga0105243_10096802 3300009148 Bacteria 2442
51 Ga0105241_10000037 3300009174 Bacteria 115452
52 Ga0105248_10467549 3300009177 Bacteria 1422
53 Ga0105237_10056024 3300009545 Bacteria 3947
54 Ga0105237_10135135 3300009545 Bacteria 2461
55 Ga0105238_10006058 3300009551 Bacteria 11996
56 Ga0105238_10028146 3300009551 Bacteria 5725
57 Ga0157373_10000046 3300013100 Bacteria 112179
58 Ga0157370_10000071 3300013104 Bacteria 111640
59 Ga0157374_10622236 3300013296 Bacteria 1090
60 Ga0163162_10074277 3300013306 Bacteria 3458
61 Ga0157372_10754025 3300013307 Bacteria 1132
62 Ga0182008_10012895 3300014497 Bacteria 4401
63 Ga0182006_1002982 3300015261 Bacteria 8912
64 Ga0182006_1022087 3300015261 Bacteria 2648
65 Ga0182007_10007046 3300015262 Bacteria 4764
66 Ga0182007_10015463 3300015262 Bacteria 2845
67 Ga0182005_1008632 3300015265 Bacteria 2994
68 Ga0209436_100011 3300025208 Bacteria 139405
69 Ga0207425_1000131 3300025245 Bacteria 68511
70 Ga0209129_1000075 3300025258 Bacteria 201273
71 Ga0209129_1000244 3300025258 Bacteria 57688
72 Ga0209129_1000642 3300025258 Bacteria 23416
73 Ga0209673_1005647 3300025273 Bacteria 6242
74 Ga0209673_1031696 3300025273 Bacteria 1640
75 Ga0209130_1000081 3300025284 Bacteria 166440
76 Ga0209130_1005298 3300025284 Bacteria 4532
77 Ga0209675_1035368 3300025291 Bacteria 1140
78 Ga0209676_1000159 3300025292 Bacteria 161731
79 Ga0209676_1001444 3300025292 Bacteria 22371
80 Ga0209025_1000077 3300025294 Bacteria 271958
81 Ga0209025_1004158 3300025294 Bacteria 12821
82 Ga0209564_1000046 3300025295 Bacteria 373787
83 Ga0209564_1000225 3300025295 Bacteria 126209
84 Ga0209564_1016673 3300025295 Bacteria 2906
85 Ga0209758_1000052 3300025297 Bacteria 338962
86 Ga0209758_1000463 3300025297 Bacteria 67158
87 Ga0209758_1002746 3300025297 Bacteria 17264
88 Ga0209758_1003607 3300025297 Bacteria 13855
89 Ga0209758_1067527 3300025297 Bacteria 1143
90 Ga0209050_1000013 3300025298 Bacteria 811408
91 Ga0209256_1000040 3300025299 Bacteria 366839
92 Ga0209256_1004952 3300025299 Bacteria 7982
93 Ga0207426_1000008 3300025302 Bacteria 848730
94 Ga0207426_1000576 3300025302 Bacteria 49162
95 Ga0209051_1000007 3300025303 Bacteria 811408
96 Ga0209051_1003289 3300025303 Bacteria 10720
97 Ga0209257_1010222 3300025304 Bacteria 4807
98 Ga0207680_10334458 3300025903 Bacteria 1061
99 Ga0207705_10597041 3300025909 Bacteria 859
100 Ga0207654_10000032 3300025911 Bacteria 120553
101 Ga0207694_10025450 3300025924 Bacteria 4499
102 Ga0207709_10055800 3300025935 Bacteria 2442
103 Ga0207711_10656257 3300025941 Bacteria 979
104 Ga0207658_10074956 3300025986 Bacteria 2572
105 Ga0207703_10003735 3300026035 Bacteria 12667
106 Ga0207639_10458307 3300026041 Bacteria 1159
107 Ga0207678_10000038 3300026067 Bacteria 101262
108 Ga0207702_10000061 3300026078 Bacteria 125368
109 Ga0207641_10000393 3300026088 Bacteria 51636
110 Ga0207674_10060611 3300026116 Bacteria 3826
111 Ga0209281_1000078 3300027111 Bacteria 261622
112 Ga0209282_1000003 3300027666 Bacteria 856377
113 Ga0209813_10012678 3300027866 Bacteria 2235
114 Ga0268266_10147217 3300028379 Bacteria 2119
115 Ga0268264_10000088 3300028381 Bacteria 235344
116 Ga0307515_10320230 3300028794 Bacteria 1218
117 Ga0307515_10362450 3300028794 Bacteria 1090
118 Ga0265338_10002034 3300028800 Bacteria 31298
119 Ga0316181_1270344 3300030744 Bacteria 1932
120 Ga0265325_10158573 3300031241 Unclassified 1066
121 Ga0307513_10053458 3300031456 Bacteria 4341
122 Ga0439461_0009499 3300041410 Bacteria 1766
123 Ga0439431_0007474 3300041997 Bacteria 2438
124 Ga0439448_0023252 3300042005 Bacteria 1932
125 Ga0439456_005397 3300042013 Bacteria 2592
126 Ga0439463_032410 3300042016 Bacteria 1321
127 Ga0450910_040255 3300042147 Bacteria 754
128 Ga0466960_0000255 3300044901 Bacteria 18324
129 Ga0495617_001484 3300046452 Bacteria 10256
130 Ga0495627_007425 3300046453 Bacteria 4198
131 Ga0495590_0004916 3300046457 Bacteria 5340
132 Ga0495638_0000027 3300046460 Bacteria 337569
133 Ga0495638_0010044 3300046460 Bacteria 6598
134 Ga0495650_0001919 3300046471 Bacteria 18411
135 Ga0495605_0000199 3300046474 Bacteria 74613
136 Ga0495639_0023220 3300046475 Bacteria 2724
137 Ga0495585_0027774 3300046492 Bacteria 3229
138 Ga0495607_0000101 3300046501 Bacteria 91495
139 Ga0495607_0000237 3300046501 Bacteria 59197
140 Ga0495607_0001486 3300046501 Bacteria 20812
141 Ga0495607_0216921 3300046501 Bacteria 938
142 Ga0495583_0000006 3300046506 Bacteria 436893
143 Ga0495606_0000208 3300046507 Bacteria 103578
144 Ga0495606_0000440 3300046507 Bacteria 68395
145 Ga0495606_0004315 3300046507 Bacteria 14309
146 Ga0495606_0010910 3300046507 Bacteria 7478
147 Ga0495610_0002121 3300046512 Bacteria 16887
148 Ga0495610_0002288 3300046512 Bacteria 16185
149 Ga0495610_0005000 3300046512 Bacteria 9600
150 Ga0495610_0013368 3300046512 Bacteria 4882
151 Ga0495620_0074737 3300046515 Bacteria 1380
152 Ga0495632_0118943 3300046519 Bacteria 1236
153 Ga0495632_0198623 3300046519 Bacteria 914
154 Ga0495632_0250681 3300046519 Bacteria 794
155 Ga0495637_0003505 3300046520 Bacteria 8319
156 Ga0495643_0000082 3300046522 Bacteria 159651
157 Ga0495643_0012610 3300046522 Bacteria 5092
158 Ga0495643_0039289 3300046522 Bacteria 2589
159 Ga0495648_0000002 3300046524 Bacteria 593972
160 Ga0495648_0004642 3300046524 Bacteria 11660
161 Ga0495648_0093642 3300046524 Bacteria 1675
162 Ga0495654_0001047 3300046530 Bacteria 20242
163 Ga0495609_0004741 3300046538 Bacteria 7354
164 Ga0495609_0044737 3300046538 Bacteria 1985
165 Ga0495597_0121195 3300046542 Bacteria 1090
166 Ga0495622_0000043 3300046557 Bacteria 115796
167 Ga0495633_0000033 3300046558 Bacteria 186714
168 Ga0495611_0012014 3300046648 Bacteria 3679
169 Ga0495625_0000053 3300046660 Bacteria 190575
170 Ga0495625_0008666 3300046660 Bacteria 8645
171 Ga0495625_0065098 3300046660 Bacteria 2570
172 Ga0495670_0162002 3300046691 Bacteria 1175
173 Ga0495671_0009882 3300046692 Bacteria 5308
174 Ga0495649_0005820 3300046694 Bacteria 7761
175 Ga0495649_0014200 3300046694 Bacteria 4573
176 Ga0495649_0063501 3300046694 Bacteria 1984
177 Ga0495589_0062146 3300046794 Bacteria 1832
178 Ga0495660_0003477 3300046810 Bacteria 9720
179 Ga0495660_0194264 3300046810 Bacteria 973
180 Ga0495672_0000081 3300047320 Bacteria 159863
181 Ga0495672_0000150 3300047320 Bacteria 101026
182 Ga0495683_0000360 3300047323 Bacteria 37542
183 Ga0495687_012410 3300047443 Bacteria 4506
184 Ga0495673_0000080 3300047469 Bacteria 201831
185 Ga0495686_0047952 3300047472 Bacteria 2696
186 Ga0495686_0241305 3300047472 Bacteria 1019
187 Ga0495686_0250517 3300047472 Bacteria 995
188 Ga0496102_0172784 3300048905 Bacteria 2034
189 Ga0496103_0001589 3300048906 Bacteria 14964
190 Ga0496103_0017797 3300048906 Bacteria 4257
191 Ga0496106_0000038 3300048909 Bacteria 111983
192 Ga0496114_0000796 3300048917 Bacteria 23575
193 Ga0496116_0088441 3300048919 Bacteria 1893
194 Ga0496116_0170617 3300048919 Bacteria 1179
195 Ga0496117_0018794 3300048920 Bacteria 5708
196 Ga0496118_0015279 3300048921 Bacteria 7119
197 Ga0496118_0070587 3300048921 Bacteria 2521
198 Ga0496119_0007811 3300048922 Bacteria 9539
199 Ga0496121_0014553 3300048924 Bacteria 8338
200 Ga0496121_0042309 3300048924 Bacteria 3965
201 Ga0496121_0068711 3300048924 Bacteria 2864
202 Ga0496121_0310929 3300048924 Bacteria 1065
203 Ga0496122_0033600 3300048925 Bacteria 4215
204 Ga0496123_0014475 3300048926 Bacteria 6535
205 Ga0496124_0017604 3300048927 Bacteria 6729
206 Ga0496124_0048427 3300048927 Bacteria 3632
207 Ga0496124_0115882 3300048927 Bacteria 2149
208 Ga0496125_0000816 3300048928 Bacteria 50685
209 Ga0496125_0024586 3300048928 Bacteria 5536
210 Ga0496125_0032900 3300048928 Bacteria 4598
211 Ga0496126_0038092 3300048929 Bacteria 4476
212 Ga0496126_0080171 3300048929 Bacteria 2889
213 Ga0495678_000074 3300049459 Bacteria 125964
214 Ga0495678_006191 3300049459 Bacteria 6400
215 Ga0495682_0000392 3300049460 Bacteria 31589
216 Ga0501249_000104 3300049679 Bacteria 26554
217 nmdc:mga06z11_96107_c1 3300050494 Bacteria 1618
218 nmdc:mga04h51_19754_c1 3300050495 Bacteria 2002
219 Ga0500583_0000463 3300053092 Bacteria 12643
220 Ga0500583_0004961 3300053092 Bacteria 4405
221 Ga0500583_0028720 3300053092 Bacteria 2416
222 Ga0500651_0093383 3300053093 Bacteria 1850
223 Ga0500641_0070944 3300053096 Bacteria 1466
224 Ga0500556_0000005 3300053104 Bacteria 581135
225 Ga0500556_0011189 3300053104 Bacteria 2652
226 Ga0500594_0002956 3300053118 Bacteria 3712
227 Ga0500594_0015858 3300053118 Bacteria 1824
228 Ga0500658_0007325 3300053134 Bacteria 4075
229 Ga0500568_0000280 3300053139 Bacteria 42298
230 Ga0500568_0007882 3300053139 Bacteria 5187
231 Ga0500568_0096763 3300053139 Bacteria 1110
232 Ga0500568_0108536 3300053139 Bacteria 1038
233 Ga0500577_0025470 3300053142 Bacteria 2003
234 Ga0500616_0000053 3300053153 Bacteria 291841
235 Ga0500616_0005098 3300053153 Bacteria 9061
236 Ga0500622_0000170 3300053156 Bacteria 70088
237 Ga0500622_0001457 3300053156 Bacteria 18912
238 Ga0500622_0003013 3300053156 Bacteria 11641
239 Ga0500622_0016630 3300053156 Bacteria 3929
240 Ga0500622_0137214 3300053156 Bacteria 1170
241 Ga0500633_0002546 3300053160 Bacteria 3779

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046460 Ga0495638_0010044 Ga0495638_0010044_3284_4039 223
2 3300046501 Ga0495607_0000237 Ga0495607_0000237_35275_36030 223
3 3300049460 Ga0495682_0000392 Ga0495682_0000392_15433_16188 223
4 3300053118 Ga0500594_0015858 Ga0500594_0015858_798_1553 223
5 3300028800 Ga0265338_10002034 Ga0265338_1000203421 224
6 3300031241 Ga0265325_10158573 Ga0265325_101585731 224
7 3300048905 Ga0496102_0172784 Ga0496102_0172784_1157_1912 228
8 3300048906 Ga0496103_0017797 Ga0496103_0017797_2414_3169 228
9 3300042147 Ga0450910_040255 Ga0450910_040255_18_743 240
10 3300046492 Ga0495585_0027774 Ga0495585_0027774_721_1572 241
11 3300046648 Ga0495611_0012014 Ga0495611_0012014_1412_2263 241
12 3300048921 Ga0496118_0070587 Ga0496118_0070587_1394_2122 241
13 3300046694 Ga0495649_0005820 Ga0495649_0005820_141_896 243
14 3300046794 Ga0495589_0062146 Ga0495589_0062146_864_1715 243
15 3300053118 Ga0500594_0002956 Ga0500594_0002956_1311_2066 243
16 iso_pu_bacteria 2510065019 2510131137 247
17 iso_pu_bacteria 2511231027 2511391199 247
18 iso_pu_bacteria 2513237093 2513633916 247
19 iso_pu_bacteria 2513237103 2513707293 247
20 iso_pu_bacteria 2515154113 2515638806 247
21 iso_pu_bacteria 2515154114 2515646901 247
22 iso_pu_bacteria 2516653077 2517038759 247
23 iso_pu_bacteria 2522572158 2523102836 247
24 iso_pu_bacteria 2582581298 2585222529 247
25 iso_pu_bacteria 2585427529 2585545112 247
26 iso_pu_bacteria 2599185212 2599615357 247
27 iso_pu_bacteria 2599185316 2600023012 247
28 iso_pu_bacteria 2599185317 2600028187 247
29 iso_pu_bacteria 2599185318 2600034114 247
30 iso_pu_bacteria 2599185322 2600056908 247
31 iso_pu_bacteria 2599185325 2600076760 247
32 iso_pu_bacteria 2600254930 2600357364 247
33 iso_pu_bacteria 2643221585 2643933750 247
34 iso_pu_bacteria 2643221656 2644315243 247
35 iso_pu_bacteria 2643221664 2644357076 247
36 iso_pu_bacteria 2667528176 2671124857 247
37 iso_pu_bacteria 2818991461 2819685333 247
38 iso_pu_bacteria 2821123053 2821123870 247
39 iso_pu_bacteria 2821443989 2821450844 247
40 iso_pu_bacteria 2838736955 2838739101 247
41 iso_pu_bacteria 2841840854 2841842999 247
42 iso_pu_bacteria 2842140634 2842142781 247
43 iso_pu_bacteria 2842217011 2842219129 247
44 iso_pu_bacteria 2842871566 2842875807 247
45 iso_pu_bacteria 2857531043 2857531432 247
46 iso_pu_bacteria 2857558681 2857558695 247
47 iso_pu_bacteria 2857576091 2857580909 247
48 iso_pu_bacteria 2869162929 2869166574 247
49 iso_pu_bacteria 2919100787 2919106414 247
50 iso_pu_bacteria 2923586266 2923588193 247
51 iso_pu_bacteria 2931369376 2931374926 247
52 iso_pu_bacteria 3005445848 3005448181 247
53 iso_pu_bacteria 639633055 639646356 247
54 iso_pu_bacteria 8055301274 8055304486 247
55 iso_pu_bacteria 8057874678 8057877452 247
56 3300053104 Ga0500556_0000005 Ga0500556_0000005_154833_155585 249
57 3300001979 JGI24740J21852_10000017 JGI24740J21852_1000001725 251
58 3300002739 JGI25158J39367_1000110 JGI25158J39367_10001102 251
59 3300002773 JGI25152J39213_1001392 JGI25152J39213_10013923 251
60 3300002773 JGI25152J39213_1004054 JGI25152J39213_10040545 251
61 3300002773 JGI25152J39213_1004484 JGI25152J39213_10044846 251
62 3300002773 JGI25152J39213_1005535 JGI25152J39213_10055353 251
63 3300002987 JGI25159J45721_1000788 JGI25159J45721_100078814 251
64 3300002987 JGI25159J45721_1010414 JGI25159J45721_10104144 251
65 3300003187 JGI25151J46595_10000413 JGI25151J46595_100004139 251
66 3300003187 JGI25151J46595_10018198 JGI25151J46595_100181982 251
67 3300003215 JGI25153J46596_10002531 JGI25153J46596_1000253111 251
68 3300003215 JGI25153J46596_10006842 JGI25153J46596_100068425 251
69 3300003215 JGI25153J46596_10033455 JGI25153J46596_100334552 251
70 3300003323 rootH1_10274006 rootH1_102740062 251
71 3300003354 JGI25160J50197_1007401 JGI25160J50197_10074012 251
72 3300003354 JGI25160J50197_1020122 JGI25160J50197_10201221 251
73 3300003374 JGI25161J50226_1000107 JGI25161J50226_100010759 251
74 3300003771 Ga0055526_1015683 Ga0055526_10156832 251
75 3300003775 Ga0055524_1000025 Ga0055524_100002580 251
76 3300003790 Ga0055528_1008010 Ga0055528_10080104 251
77 3300003791 Ga0055530_10000123 Ga0055530_100001238 251
78 3300003792 Ga0055540_1000159 Ga0055540_10001598 251
79 3300003792 Ga0055540_1006316 Ga0055540_10063161 251
80 3300004625 Ga0055543_1000074 Ga0055543_100007416 251
81 3300005262 Ga0065165_1016247 Ga0065165_10162473 251
82 3300005330 Ga0070690_100226624 Ga0070690_1002266242 251
83 3300005331 Ga0070670_100571688 Ga0070670_1005716882 251
84 3300005334 Ga0068869_100735912 Ga0068869_1007359121 251
85 3300005335 Ga0070666_10027286 Ga0070666_100272864 251
86 3300005455 Ga0070663_100000022 Ga0070663_10000002280 251
87 3300005455 Ga0070663_100128955 Ga0070663_1001289554 251
88 3300005535 Ga0070684_100087023 Ga0070684_1000870232 251
89 3300005539 Ga0068853_100512901 Ga0068853_1005129011 251
90 3300005548 Ga0070665_100145820 Ga0070665_1001458203 251
91 3300005563 Ga0068855_100249790 Ga0068855_1002497902 251
92 3300005577 Ga0068857_100034631 Ga0068857_1000346316 251
93 3300005614 Ga0068856_100000041 Ga0068856_10000004182 251
94 3300005614 Ga0068856_100127963 Ga0068856_1001279632 251
95 3300005614 Ga0068856_100221828 Ga0068856_1002218284 251
96 3300005617 Ga0068859_100065426 Ga0068859_1000654262 251
97 3300005841 Ga0068863_100019435 Ga0068863_1000194357 251
98 3300005842 Ga0068858_100006060 Ga0068858_1000060606 251
99 3300005843 Ga0068860_100000185 Ga0068860_10000018558 251
100 3300006042 Ga0075368_10003491 Ga0075368_100034917 251
101 3300006931 Ga0097620_100065426 Ga0097620_1000654262 251
102 3300006946 Ga0079104_1000010 Ga0079104_1000010360 251
103 3300006948 Ga0099826_10000005 Ga0099826_10000005105 251
104 3300009036 Ga0105244_10001814 Ga0105244_1000181416 251
105 3300009093 Ga0105240_10364080 Ga0105240_103640802 251
106 3300009148 Ga0105243_10096802 Ga0105243_100968022 251
107 3300009174 Ga0105241_10000037 Ga0105241_1000003779 251
108 3300009177 Ga0105248_10467549 Ga0105248_104675492 251
109 3300009545 Ga0105237_10056024 Ga0105237_100560242 251
110 3300009545 Ga0105237_10135135 Ga0105237_101351352 251
111 3300009551 Ga0105238_10006058 Ga0105238_100060587 251
112 3300009551 Ga0105238_10028146 Ga0105238_100281466 251
113 3300013100 Ga0157373_10000046 Ga0157373_1000004624 251
114 3300013104 Ga0157370_10000071 Ga0157370_1000007124 251
115 3300013296 Ga0157374_10622236 Ga0157374_106222362 251
116 3300013306 Ga0163162_10074277 Ga0163162_100742775 251
117 3300013307 Ga0157372_10754025 Ga0157372_107540252 251
118 3300014497 Ga0182008_10012895 Ga0182008_100128954 251
119 3300015261 Ga0182006_1002982 Ga0182006_10029826 251
120 3300015261 Ga0182006_1022087 Ga0182006_10220872 251
121 3300015262 Ga0182007_10007046 Ga0182007_100070463 251
122 3300015262 Ga0182007_10015463 Ga0182007_100154632 251
123 3300015265 Ga0182005_1008632 Ga0182005_10086323 251
124 3300025208 Ga0209436_100011 Ga0209436_10001184 251
125 3300025245 Ga0207425_1000131 Ga0207425_100013142 251
126 3300025258 Ga0209129_1000075 Ga0209129_100007558 251
127 3300025258 Ga0209129_1000244 Ga0209129_100024428 251
128 3300025258 Ga0209129_1000642 Ga0209129_100064213 251
129 3300025273 Ga0209673_1005647 Ga0209673_10056478 251
130 3300025273 Ga0209673_1031696 Ga0209673_10316961 251
131 3300025284 Ga0209130_1000081 Ga0209130_1000081158 251
132 3300025284 Ga0209130_1005298 Ga0209130_10052983 251
133 3300025291 Ga0209675_1035368 Ga0209675_10353682 251
134 3300025292 Ga0209676_1000159 Ga0209676_1000159164 251
135 3300025292 Ga0209676_1001444 Ga0209676_100144413 251
136 3300025294 Ga0209025_1000077 Ga0209025_1000077163 251
137 3300025294 Ga0209025_1004158 Ga0209025_10041583 251
138 3300025295 Ga0209564_1000046 Ga0209564_1000046222 251
139 3300025295 Ga0209564_1000225 Ga0209564_100022548 251
140 3300025295 Ga0209564_1016673 Ga0209564_10166733 251
141 3300025297 Ga0209758_1000052 Ga0209758_1000052241 251
142 3300025297 Ga0209758_1000463 Ga0209758_100046360 251
143 3300025297 Ga0209758_1002746 Ga0209758_10027463 251
144 3300025297 Ga0209758_1003607 Ga0209758_10036077 251
145 3300025297 Ga0209758_1067527 Ga0209758_10675271 251
146 3300025298 Ga0209050_1000013 Ga0209050_1000013642 251
147 3300025299 Ga0209256_1000040 Ga0209256_1000040105 251
148 3300025299 Ga0209256_1004952 Ga0209256_10049528 251
149 3300025302 Ga0207426_1000008 Ga0207426_1000008638 251
150 3300025302 Ga0207426_1000576 Ga0207426_10005766 251
151 3300025303 Ga0209051_1000007 Ga0209051_1000007642 251
152 3300025303 Ga0209051_1003289 Ga0209051_100328911 251
153 3300025304 Ga0209257_1010222 Ga0209257_10102224 251
154 3300025903 Ga0207680_10334458 Ga0207680_103344582 251
155 3300025909 Ga0207705_10597041 Ga0207705_105970411 251
156 3300025911 Ga0207654_10000032 Ga0207654_1000003233 251
157 3300025924 Ga0207694_10025450 Ga0207694_100254506 251
158 3300025935 Ga0207709_10055800 Ga0207709_100558002 251
159 3300025941 Ga0207711_10656257 Ga0207711_106562572 251
160 3300025986 Ga0207658_10074956 Ga0207658_100749562 251
161 3300026035 Ga0207703_10003735 Ga0207703_1000373510 251
162 3300026041 Ga0207639_10458307 Ga0207639_104583072 251
163 3300026067 Ga0207678_10000038 Ga0207678_1000003868 251
164 3300026078 Ga0207702_10000061 Ga0207702_1000006182 251
165 3300026088 Ga0207641_10000393 Ga0207641_1000039336 251
166 3300026116 Ga0207674_10060611 Ga0207674_100606112 251
167 3300027111 Ga0209281_1000078 Ga0209281_1000078237 251
168 3300027666 Ga0209282_1000003 Ga0209282_1000003695 251
169 3300027866 Ga0209813_10012678 Ga0209813_100126782 251
170 3300028379 Ga0268266_10147217 Ga0268266_101472172 251
171 3300028381 Ga0268264_10000088 Ga0268264_10000088165 251
172 3300028794 Ga0307515_10320230 Ga0307515_103202302 251
173 3300028794 Ga0307515_10362450 Ga0307515_103624501 251
174 3300030744 Ga0316181_1270344 Ga0316181_12703442 251
175 3300031456 Ga0307513_10053458 Ga0307513_100534582 251
176 3300041410 Ga0439461_0009499 Ga0439461_0009499_580_1335 251
177 3300041997 Ga0439431_0007474 Ga0439431_0007474_69_824 251
178 3300042005 Ga0439448_0023252 Ga0439448_0023252_814_1572 251
179 3300042013 Ga0439456_005397 Ga0439456_005397_873_1631 251
180 3300042016 Ga0439463_032410 Ga0439463_032410_120_878 251
181 3300044901 Ga0466960_0000255 Ga0466960_0000255_11008_11763 251
182 3300046452 Ga0495617_001484 Ga0495617_001484_8177_8935 251
183 3300046453 Ga0495627_007425 Ga0495627_007425_207_968 251
184 3300046457 Ga0495590_0004916 Ga0495590_0004916_4500_5258 251
185 3300046460 Ga0495638_0000027 Ga0495638_0000027_208340_209098 251
186 3300046471 Ga0495650_0001919 Ga0495650_0001919_14733_15491 251
187 3300046474 Ga0495605_0000199 Ga0495605_0000199_35377_36132 251
188 3300046475 Ga0495639_0023220 Ga0495639_0023220_930_1688 251
189 3300046501 Ga0495607_0000101 Ga0495607_0000101_85918_86676 251
190 3300046501 Ga0495607_0001486 Ga0495607_0001486_1761_2519 251
191 3300046501 Ga0495607_0216921 Ga0495607_0216921_128_886 251
192 3300046506 Ga0495583_0000006 Ga0495583_0000006_342403_343161 251
193 3300046507 Ga0495606_0000208 Ga0495606_0000208_60202_60960 251
194 3300046507 Ga0495606_0000440 Ga0495606_0000440_39320_40078 251
195 3300046507 Ga0495606_0004315 Ga0495606_0004315_9553_10311 251
196 3300046507 Ga0495606_0010910 Ga0495606_0010910_2183_2941 251
197 3300046512 Ga0495610_0002121 Ga0495610_0002121_2132_2890 251
198 3300046512 Ga0495610_0002288 Ga0495610_0002288_10040_10798 251
199 3300046512 Ga0495610_0005000 Ga0495610_0005000_4600_5355 251
200 3300046512 Ga0495610_0013368 Ga0495610_0013368_2731_3489 251
201 3300046515 Ga0495620_0074737 Ga0495620_0074737_469_1227 251
202 3300046519 Ga0495632_0118943 Ga0495632_0118943_310_1065 251
203 3300046519 Ga0495632_0198623 Ga0495632_0198623_93_851 251
204 3300046519 Ga0495632_0250681 Ga0495632_0250681_26_784 251
205 3300046520 Ga0495637_0003505 Ga0495637_0003505_6516_7274 251
206 3300046522 Ga0495643_0000082 Ga0495643_0000082_41449_42207 251
207 3300046522 Ga0495643_0012610 Ga0495643_0012610_2848_3606 251
208 3300046522 Ga0495643_0039289 Ga0495643_0039289_1452_2210 251
209 3300046524 Ga0495648_0000002 Ga0495648_0000002_76210_76968 251
210 3300046524 Ga0495648_0004642 Ga0495648_0004642_854_1612 251
211 3300046524 Ga0495648_0093642 Ga0495648_0093642_415_1173 251
212 3300046530 Ga0495654_0001047 Ga0495654_0001047_5959_6717 251
213 3300046538 Ga0495609_0004741 Ga0495609_0004741_3798_4556 251
214 3300046538 Ga0495609_0044737 Ga0495609_0044737_255_1013 251
215 3300046542 Ga0495597_0121195 Ga0495597_0121195_78_836 251
216 3300046557 Ga0495622_0000043 Ga0495622_0000043_31165_31923 251
217 3300046558 Ga0495633_0000033 Ga0495633_0000033_143666_144424 251
218 3300046660 Ga0495625_0000053 Ga0495625_0000053_86261_87019 251
219 3300046660 Ga0495625_0008666 Ga0495625_0008666_7752_8510 251
220 3300046660 Ga0495625_0065098 Ga0495625_0065098_1284_2042 251
221 3300046691 Ga0495670_0162002 Ga0495670_0162002_407_1165 251
222 3300046692 Ga0495671_0009882 Ga0495671_0009882_1753_2511 251
223 3300046694 Ga0495649_0014200 Ga0495649_0014200_588_1346 251
224 3300046694 Ga0495649_0063501 Ga0495649_0063501_572_1330 251
225 3300046810 Ga0495660_0003477 Ga0495660_0003477_924_1682 251
226 3300046810 Ga0495660_0194264 Ga0495660_0194264_166_924 251
227 3300047320 Ga0495672_0000081 Ga0495672_0000081_117067_117825 251
228 3300047320 Ga0495672_0000150 Ga0495672_0000150_97855_98613 251
229 3300047323 Ga0495683_0000360 Ga0495683_0000360_25037_25795 251
230 3300047443 Ga0495687_012410 Ga0495687_012410_3486_4244 251
231 3300047469 Ga0495673_0000080 Ga0495673_0000080_109237_109995 251
232 3300047472 Ga0495686_0047952 Ga0495686_0047952_1014_1769 251
233 3300047472 Ga0495686_0241305 Ga0495686_0241305_65_823 251
234 3300047472 Ga0495686_0250517 Ga0495686_0250517_133_891 251
235 3300048906 Ga0496103_0001589 Ga0496103_0001589_13524_14282 251
236 3300048909 Ga0496106_0000038 Ga0496106_0000038_73889_74647 251
237 3300048917 Ga0496114_0000796 Ga0496114_0000796_10951_11709 251
238 3300048919 Ga0496116_0088441 Ga0496116_0088441_862_1620 251
239 3300048919 Ga0496116_0170617 Ga0496116_0170617_183_941 251
240 3300048920 Ga0496117_0018794 Ga0496117_0018794_2161_2919 251
241 3300048921 Ga0496118_0015279 Ga0496118_0015279_339_1097 251
242 3300048922 Ga0496119_0007811 Ga0496119_0007811_3048_3806 251
243 3300048924 Ga0496121_0014553 Ga0496121_0014553_4682_5440 251
244 3300048924 Ga0496121_0042309 Ga0496121_0042309_208_966 251
245 3300048924 Ga0496121_0068711 Ga0496121_0068711_1890_2648 251
246 3300048924 Ga0496121_0310929 Ga0496121_0310929_17_775 251
247 3300048925 Ga0496122_0033600 Ga0496122_0033600_3137_3895 251
248 3300048926 Ga0496123_0014475 Ga0496123_0014475_3093_3851 251
249 3300048927 Ga0496124_0017604 Ga0496124_0017604_5907_6665 251
250 3300048927 Ga0496124_0048427 Ga0496124_0048427_977_1735 251
251 3300048927 Ga0496124_0115882 Ga0496124_0115882_316_1074 251
252 3300048928 Ga0496125_0000816 Ga0496125_0000816_19902_20660 251
253 3300048928 Ga0496125_0024586 Ga0496125_0024586_1021_1779 251
254 3300048928 Ga0496125_0032900 Ga0496125_0032900_744_1502 251
255 3300048929 Ga0496126_0038092 Ga0496126_0038092_432_1190 251
256 3300048929 Ga0496126_0080171 Ga0496126_0080171_457_1215 251
257 3300049459 Ga0495678_000074 Ga0495678_000074_83123_83881 251
258 3300049459 Ga0495678_006191 Ga0495678_006191_3503_4261 251
259 3300049679 Ga0501249_000104 Ga0501249_000104_19136_19894 251
260 3300050494 nmdc:mga06z11_96107_c1 nmdc:mga06z11_96107_c1_368_1222 251
261 3300050495 nmdc:mga04h51_19754_c1 nmdc:mga04h51_19754_c1_565_1419 251
262 3300053092 Ga0500583_0000463 Ga0500583_0000463_4677_5432 251
263 3300053092 Ga0500583_0004961 Ga0500583_0004961_1782_2540 251
264 3300053092 Ga0500583_0028720 Ga0500583_0028720_1456_2211 251
265 3300053093 Ga0500651_0093383 Ga0500651_0093383_762_1520 251
266 3300053096 Ga0500641_0070944 Ga0500641_0070944_12_776 251
267 3300053104 Ga0500556_0011189 Ga0500556_0011189_218_991 251
268 3300053134 Ga0500658_0007325 Ga0500658_0007325_2370_3128 251
269 3300053139 Ga0500568_0000280 Ga0500568_0000280_37243_38001 251
270 3300053139 Ga0500568_0007882 Ga0500568_0007882_1798_2553 251
271 3300053139 Ga0500568_0096763 Ga0500568_0096763_56_814 251
272 3300053139 Ga0500568_0108536 Ga0500568_0108536_183_941 251
273 3300053142 Ga0500577_0025470 Ga0500577_0025470_107_862 251
274 3300053153 Ga0500616_0000053 Ga0500616_0000053_203588_204346 251
275 3300053153 Ga0500616_0005098 Ga0500616_0005098_6158_6916 251
276 3300053156 Ga0500622_0000170 Ga0500622_0000170_22016_22774 251
277 3300053156 Ga0500622_0001457 Ga0500622_0001457_15712_16470 251
278 3300053156 Ga0500622_0003013 Ga0500622_0003013_7501_8256 251
279 3300053156 Ga0500622_0016630 Ga0500622_0016630_1624_2400 251
280 3300053156 Ga0500622_0137214 Ga0500622_0137214_283_1038 251
281 3300053160 Ga0500633_0002546 Ga0500633_0002546_1795_2553 251
282 iso_pu_bacteria 2844533157 2844538020 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

33

230

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

39

275

0.92

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

35

238

0.79

PF08659

KR

KR domain

33

217

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wva-assembly1.cif.gz_A-2 serratia marcescens short-chain dehydrogenase/reductase f98y/f202y mutant 0.9616 4 250
5wul-assembly1.cif.gz_A serratia marcescens short-chain dehydrogenase/reductase f98a/f202l 0.9616 4 250
4zgw-assembly1.cif.gz_A short-chain dehydrogenase/reductase from serratia marcescens bcrc 10948 0.9613 4 250
5wuw-assembly1.cif.gz_A-2 serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant 0.9606 4 250
3wtb-assembly2.cif.gz_E crystal structure of gox0525 0.96 8 250
ID Description Score Start End Superfamily
3wtbC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9596 8 250 3.40.50.720
3wtbC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9443 8 250 3.40.50.720
3i3oG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9421 2 248 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9407 4 249 3.40.50.720
4mowD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.94 4 248 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1F6PTA4-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9774 3 92 GO:0016614
AF-A0A1G7JL47-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.9771 1 250 GO:0016491
AF-A0A1G7JL47-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.9733 1 250 GO:0016491
AF-A0A5S9M3Y8-F1-model_v4 Uncharacterized protein 0.9618 1 83 GO:0016614
AF-A0A3C1QWH6-F1-model_v4 Oxidoreductase 0.9568 3 93

Feature Viewer

pLDDT pTM Quality
92.96 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map