F384907

General Info

Members Datasets Scaffolds Average Seq Length
282 150 564 193

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10348144|Ga0105242_103481443
Length 208
Sequence MHGEGGMSTPNGGDSPKCARPIDPAMLADYWIGFATGPDEEAIEEHLFECDHCGHRLRQVIVLSDGIRKLAREGSLRMVVSDVFLQRAAESGIAVREYNIPAGGSVECTVTAEDDILIGRVAANLSGARRVDMCICNENGVEQLRLPDIPVHSGRTSVAFQESITFLKSAPSMKMIMRLVSLDDAGSEQLLGEYTFNHTRSLPGPGAW

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
103 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
129 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.77
Rhizosphere 98.23
Stem 0
Stem Tuber 0
Unclassified 33.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10348144 3300009176 Bacteria 1368
2 Ga0070683_100867820 3300005329 Bacteria 865
3 Ga0070666_10027425 3300005335 Bacteria 3731
4 Ga0070680_100077132 3300005336 Bacteria 2745
5 Ga0070682_100854267 3300005337 Unclassified 744
6 Ga0068868_100031504 3300005338 Bacteria 4074
7 Ga0070660_100507752 3300005339 Unclassified 1003
8 Ga0070689_100101127 3300005340 Bacteria 2281
9 Ga0070661_100197905 3300005344 Bacteria 1534
10 Ga0070671_100039285 3300005355 Bacteria 3928
11 Ga0070673_100019733 3300005364 Unclassified 4845
12 Ga0070688_100014387 3300005365 Unclassified 4482
13 Ga0070667_100236908 3300005367 Bacteria 1628
14 Ga0070709_10017516 3300005434 Bacteria 4111
15 Ga0070714_100161474 3300005435 Bacteria 2028
16 Ga0070711_100109515 3300005439 Bacteria 2025
17 Ga0070705_100631696 3300005440 Unclassified 832
18 Ga0070694_100881168 3300005444 Unclassified 738
19 Ga0070681_10065291 3300005458 Unclassified 3608
20 Ga0070681_10092068 3300005458 Bacteria 2981
21 Ga0070681_10261586 3300005458 Bacteria 1642
22 Ga0068867_100034154 3300005459 Bacteria 3686
23 Ga0068867_100314380 3300005459 Bacteria 1295
24 Ga0070699_100033990 3300005518 Unclassified 4406
25 Ga0070679_100064558 3300005530 Bacteria 3649
26 Ga0070679_100240527 3300005530 Bacteria 1768
27 Ga0070679_100250407 3300005530 Bacteria 1728
28 Ga0070684_100298982 3300005535 Unclassified 1477
29 Ga0068853_100064148 3300005539 Unclassified 3184
30 Ga0070672_100242101 3300005543 Unclassified 1517
31 Ga0070695_100941881 3300005545 Unclassified 699
32 Ga0070696_100206584 3300005546 Bacteria 1468
33 Ga0070696_100228076 3300005546 Unclassified 1400
34 Ga0070665_100037917 3300005548 Unclassified 4845
35 Ga0070665_100110211 3300005548 Bacteria 2755
36 Ga0070704_100062897 3300005549 Viruses 2662
37 Ga0070704_100070928 3300005549 Bacteria 2530
38 Ga0068855_100136358 3300005563 Unclassified 2800
39 Ga0068855_100262862 3300005563 Unclassified 1922
40 Ga0070664_100083157 3300005564 Bacteria 2761
41 Ga0068857_100041387 3300005577 Unclassified 4086
42 Ga0068857_100051216 3300005577 Bacteria 3662
43 Ga0068857_100287503 3300005577 Unclassified 1513
44 Ga0068856_100019474 3300005614 Bacteria 6587
45 Ga0068856_100061204 3300005614 Unclassified 3718
46 Ga0068856_101034200 3300005614 Unclassified 839
47 Ga0070702_100149101 3300005615 Bacteria 1499
48 Ga0068859_100359463 3300005617 Bacteria 1551
49 Ga0068859_100822226 3300005617 Bacteria 1016
50 Ga0068866_10038953 3300005718 Bacteria 2345
51 Ga0068863_100301421 3300005841 Bacteria 1555
52 Ga0068858_100029710 3300005842 Bacteria 5077
53 Ga0068858_100096226 3300005842 Bacteria 2759
54 Ga0068858_100231957 3300005842 Bacteria 1750
55 Ga0068860_100034383 3300005843 Unclassified 4861
56 Ga0070716_100279095 3300006173 Unclassified 1152
57 Ga0097621_100010886 3300006237 Bacteria 6676
58 Ga0097621_100034394 3300006237 Bacteria 4043
59 Ga0097621_100061872 3300006237 Bacteria 3071
60 Ga0097621_100299892 3300006237 Bacteria 1419
61 Ga0068871_100011161 3300006358 Bacteria 6586
62 Ga0068871_100040597 3300006358 Bacteria 3728
63 Ga0068871_100065766 3300006358 Bacteria 2970
64 Ga0068871_100107295 3300006358 Bacteria 2345
65 Ga0068871_100234523 3300006358 Unclassified 1594
66 Ga0075428_100196938 3300006844 Unclassified 2179
67 Ga0075428_100233308 3300006844 Bacteria 1986
68 Ga0075430_100086265 3300006846 Unclassified 2628
69 Ga0075431_100017265 3300006847 Bacteria 7334
70 Ga0075431_100072135 3300006847 Bacteria 3563
71 Ga0075433_10011760 3300006852 Bacteria 7050
72 Ga0075433_10107302 3300006852 Unclassified 2476
73 Ga0075434_100009371 3300006871 Bacteria 9128
74 Ga0075434_100031839 3300006871 Bacteria 5201
75 Ga0075434_100123637 3300006871 Bacteria 2604
76 Ga0075429_100070194 3300006880 Bacteria 3050
77 Ga0075429_100254476 3300006880 Unclassified 1538
78 Ga0097620_100359479 3300006931 Bacteria 1551
79 Ga0097620_100822320 3300006931 Bacteria 1016
80 Ga0075435_100000840 3300007076 Bacteria 19163
81 Ga0075435_100197694 3300007076 Bacteria 1703
82 Ga0105240_10029384 3300009093 Bacteria 7161
83 Ga0105240_10085345 3300009093 Bacteria 3868
84 Ga0105240_10114412 3300009093 Bacteria 3259
85 Ga0105240_10160086 3300009093 Unclassified 2675
86 Ga0111539_10463151 3300009094 Bacteria 1476
87 Ga0111539_10493252 3300009094 Unclassified 1426
88 Ga0105245_10108788 3300009098 Bacteria 2575
89 Ga0105245_10139255 3300009098 Bacteria 2283
90 Ga0105245_10321485 3300009098 Bacteria 1524
91 Ga0105245_10833352 3300009098 Bacteria 962
92 Ga0105245_10864347 3300009098 Unclassified 945
93 Ga0105247_10027024 3300009101 Bacteria 3470
94 Ga0114129_10003490 3300009147 Bacteria 22112
95 Ga0114129_10008120 3300009147 Bacteria 14960
96 Ga0114129_10051539 3300009147 Bacteria 5778
97 Ga0114129_10057309 3300009147 Bacteria 5453
98 Ga0114129_10065470 3300009147 Bacteria 5072
99 Ga0114129_10080693 3300009147 Bacteria 4522
100 Ga0105241_10022154 3300009174 Bacteria 4703
101 Ga0105241_10051079 3300009174 Bacteria 3152
102 Ga0105242_10205618 3300009176 Bacteria 1751
103 Ga0105242_10298088 3300009176 Bacteria 1470
104 Ga0105248_10012145 3300009177 Bacteria 9500
105 Ga0105248_10021852 3300009177 Bacteria 7090
106 Ga0105248_10146215 3300009177 Unclassified 2667
107 Ga0105248_10268807 3300009177 Bacteria 1920
108 Ga0105248_10446368 3300009177 Bacteria 1457
109 Ga0105248_10833752 3300009177 Unclassified 1041
110 Ga0105248_11712023 3300009177 Unclassified 713
111 Ga0105237_10012917 3300009545 Bacteria 8774
112 Ga0105237_10019896 3300009545 Bacteria 6929
113 Ga0105237_10079849 3300009545 Bacteria 3261
114 Ga0105237_10204051 3300009545 Bacteria 1977
115 Ga0105237_10369635 3300009545 Unclassified 1439
116 Ga0105238_10065832 3300009551 Unclassified 3625
117 Ga0105238_10082127 3300009551 Bacteria 3212
118 Ga0105238_10632111 3300009551 Unclassified 1080
119 Ga0105239_10095394 3300010375 Bacteria 3286
120 Ga0105239_10154469 3300010375 Bacteria 2562
121 Ga0105239_10408997 3300010375 Bacteria 1536
122 Ga0105239_10878797 3300010375 Unclassified 1028
123 Ga0105239_10951520 3300010375 Unclassified 986
124 Ga0105246_10071191 3300011119 Unclassified 2448
125 Ga0105246_10178227 3300011119 Bacteria 1634
126 Ga0157370_10273781 3300013104 Bacteria 1560
127 Ga0157374_10002252 3300013296 Bacteria 16248
128 Ga0157374_10038869 3300013296 Bacteria 4376
129 Ga0157378_10015952 3300013297 Bacteria 6579
130 Ga0157378_10072335 3300013297 Bacteria 3098
131 Ga0157378_10447028 3300013297 Bacteria 1282
132 Ga0163162_10038627 3300013306 Unclassified 4764
133 Ga0163162_10085169 3300013306 Bacteria 3237
134 Ga0163162_10299872 3300013306 Bacteria 1739
135 Ga0163162_10305833 3300013306 Bacteria 1722
136 Ga0157372_10302572 3300013307 Bacteria 1860
137 Ga0157372_11116806 3300013307 Unclassified 912
138 Ga0157375_10150398 3300013308 Bacteria 2463
139 Ga0157375_10219763 3300013308 Unclassified 2058
140 Ga0157375_10294267 3300013308 Bacteria 1787
141 Ga0163163_10020705 3300014325 Bacteria 6199
142 Ga0163163_10151703 3300014325 Bacteria 2361
143 Ga0163163_10223540 3300014325 Unclassified 1932
144 Ga0163163_10618338 3300014325 Bacteria 1147
145 Ga0157380_10904923 3300014326 Bacteria 909
146 Ga0157376_10148837 3300014969 Bacteria 2109
147 Ga0157376_10154284 3300014969 Unclassified 2074
148 Ga0157376_11240405 3300014969 Bacteria 774
149 Ga0207680_10029714 3300025903 Bacteria 3074
150 Ga0207654_10022427 3300025911 Unclassified 3369
151 Ga0207707_10015549 3300025912 Bacteria 6628
152 Ga0207707_10036278 3300025912 Unclassified 4312
153 Ga0207707_10090324 3300025912 Unclassified 2677
154 Ga0207695_10087361 3300025913 Bacteria 3141
155 Ga0207695_10184962 3300025913 Bacteria 2003
156 Ga0207671_10030505 3300025914 Bacteria 4021
157 Ga0207671_10032403 3300025914 Bacteria 3891
158 Ga0207663_10298418 3300025916 Bacteria 1203
159 Ga0207660_10686107 3300025917 Unclassified 835
160 Ga0207657_10622270 3300025919 Unclassified 841
161 Ga0207649_10160539 3300025920 Bacteria 1557
162 Ga0207652_10218255 3300025921 Unclassified 1718
163 Ga0207652_10635363 3300025921 Bacteria 955
164 Ga0207694_10023308 3300025924 Bacteria 4699
165 Ga0207694_10125766 3300025924 Unclassified 2051
166 Ga0207687_10059005 3300025927 Bacteria 2702
167 Ga0207687_10651778 3300025927 Unclassified 891
168 Ga0207687_10660422 3300025927 Bacteria 885
169 Ga0207664_10129772 3300025929 Bacteria 2121
170 Ga0207644_10492114 3300025931 Bacteria 1011
171 Ga0207670_10127825 3300025936 Bacteria 1857
172 Ga0207704_10030152 3300025938 Bacteria 3037
173 Ga0207691_10293363 3300025940 Bacteria 1398
174 Ga0207711_10063897 3300025941 Bacteria 3178
175 Ga0207711_10119110 3300025941 Bacteria 2355
176 Ga0207711_10127259 3300025941 Bacteria 2280
177 Ga0207711_10558212 3300025941 Bacteria 1068
178 Ga0207661_10086801 3300025944 Bacteria 2597
179 Ga0207679_10054704 3300025945 Bacteria 2939
180 Ga0207679_10591257 3300025945 Bacteria 999
181 Ga0207667_10067631 3300025949 Unclassified 3721
182 Ga0207667_10110297 3300025949 Unclassified 2839
183 Ga0207667_10329119 3300025949 Unclassified 1560
184 Ga0207651_10506712 3300025960 Bacteria 1044
185 Ga0207658_10532113 3300025986 Unclassified 1050
186 Ga0207658_10799911 3300025986 Unclassified 856
187 Ga0207703_10047901 3300026035 Bacteria 3447
188 Ga0207639_10099989 3300026041 Unclassified 2342
189 Ga0207639_10169773 3300026041 Bacteria 1846
190 Ga0207702_10037053 3300026078 Unclassified 4080
191 Ga0207641_10069517 3300026088 Bacteria 3023
192 Ga0207641_10260930 3300026088 Bacteria 1622
193 Ga0207641_11265255 3300026088 Unclassified 738
194 Ga0207648_10034350 3300026089 Bacteria 4470
195 Ga0207674_10003663 3300026116 Bacteria 18742
196 Ga0207674_10024010 3300026116 Bacteria 6520
197 Ga0207674_10314110 3300026116 Bacteria 1516
198 Ga0268266_10014186 3300028379 Bacteria 6854
199 Ga0268266_10314468 3300028379 Unclassified 1464
200 Ga0268264_10929126 3300028381 Unclassified 874
201 Ga0268264_11007828 3300028381 Bacteria 839
202 Ga0373945_0324599 3300035116 Unclassified 663
203 Ga0373953_0122495 3300035117 Unclassified 1105
204 Ga0373955_0063094 3300035172 Unclassified 2051
205 Ga0373955_0634676 3300035172 Bacteria 655
206 Ga0373931_0141668 3300035691 Unclassified 1393
207 Ga0373931_0167751 3300035691 Bacteria 1291
208 Ga0373933_0091551 3300035724 Bacteria 1877
209 Ga0373933_0456590 3300035724 Unclassified 836
210 Ga0373937_0037339 3300036401 Bacteria 4427
211 Ga0373937_0048825 3300036401 Bacteria 3875
212 Ga0373937_0146537 3300036401 Bacteria 2210
213 Ga0373937_0391658 3300036401 Bacteria 1318
214 Ga0373925_0027220 3300037068 Bacteria 4187
215 Ga0453684_1293556 3300044712 Unclassified 761
216 Ga0453684_1386087 3300044712 Bacteria 730
217 Ga0451576_0350423 3300045051 Unclassified 1546
218 Ga0451576_0488293 3300045051 Unclassified 1294
219 Ga0495629_0024362 3300046459 Bacteria 4309
220 Ga0495651_0008630 3300046462 Bacteria 7815
221 Ga0495651_0210192 3300046462 Bacteria 1355
222 Ga0495580_0042308 3300046472 Bacteria 3246
223 Ga0495580_0076425 3300046472 Unclassified 2336
224 Ga0495580_0554883 3300046472 Unclassified 762
225 Ga0495582_0093089 3300046473 Unclassified 1682
226 Ga0495582_0210253 3300046473 Unclassified 1112
227 Ga0495608_0013807 3300046511 Bacteria 5604
228 Ga0495618_0479731 3300046514 Unclassified 752
229 Ga0495630_0020674 3300046517 Unclassified 4855
230 Ga0495642_0121733 3300046528 Bacteria 1120
231 Ga0495652_0018354 3300046529 Bacteria 6238
232 Ga0495652_0069057 3300046529 Unclassified 2959
233 Ga0495652_0433015 3300046529 Bacteria 924
234 Ga0495665_0030323 3300046531 Unclassified 2894
235 Ga0495640_0478184 3300046533 Unclassified 759
236 Ga0495586_0003316 3300046535 Bacteria 8640
237 Ga0495586_0107979 3300046535 Unclassified 1548
238 Ga0495587_0096603 3300046536 Bacteria 1704
239 Ga0495645_0009720 3300046543 Bacteria 6727
240 Ga0495645_0061355 3300046543 Unclassified 2724
241 Ga0495667_0024383 3300046559 Bacteria 4073
242 Ga0495667_0113227 3300046559 Unclassified 1753
243 Ga0495667_0516134 3300046559 Bacteria 748
244 Ga0495634_0016778 3300046642 Bacteria 5231
245 Ga0495657_0001514 3300046675 Bacteria 20013
246 Ga0495599_0124241 3300046678 Bacteria 1604
247 Ga0495623_0074974 3300046679 Bacteria 2102
248 Ga0495658_0279289 3300046683 Bacteria 1054
249 Ga0495658_0548935 3300046683 Unclassified 740
250 Ga0495613_0121306 3300046689 Bacteria 1877
251 Ga0495613_0471046 3300046689 Unclassified 849
252 Ga0495600_0407501 3300046809 Unclassified 845
253 Ga0495604_0031529 3300047317 Bacteria 4204
254 Ga0495674_0091104 3300047319 Unclassified 2605
255 Ga0495680_0369869 3300047322 Bacteria 995
256 Ga0495684_0009925 3300047471 Bacteria 7350
257 Ga0495684_0209317 3300047471 Bacteria 1435
258 Ga0496101_0735397 3300048904 Bacteria 779
259 Ga0496112_0060973 3300048915 Bacteria 3718
260 Ga0496112_0384269 3300048915 Bacteria 1345
261 Ga0496114_0131222 3300048917 Unclassified 2164
262 Ga0496115_0212375 3300048918 Unclassified 1598
263 Ga0501075_0685216 3300049591 Unclassified 781
264 nmdc:mga05p37_193666_c1 3300050507 Unclassified 2466
265 nmdc:mga05p37_219199_c1 3300050507 Unclassified 2297
266 nmdc:mga05p37_35139_c1 3300050507 Bacteria 6144
267 nmdc:mga05p37_47724_c1 3300050507 Bacteria 5266
268 nmdc:mga05p37_594655_c1 3300050507 Bacteria 1250
269 nmdc:mga05p37_8360_c2 3300050507 Bacteria 6613
270 nmdc:mga09592_70440_c1 3300050508 Bacteria 2967
271 nmdc:mga09592_73534_c1 3300050508 Bacteria 2904
272 nmdc:mga0qj67_23068_c1 3300050509 Bacteria 4783
273 nmdc:mga06r32_202025_c1 3300050510 Unclassified 1975
274 nmdc:mga0n895_188182_c1 3300050512 Bacteria 2095
275 nmdc:mga0n895_21768_c1 3300050512 Bacteria 6001
276 nmdc:mga0n895_223264_c1 3300050512 Bacteria 1912
277 nmdc:mga0rr50_185187_c1 3300050513 Bacteria 1704
278 nmdc:mga0rr50_299240_c1 3300050513 Bacteria 1345
279 nmdc:mga0a205_37316_c1 3300050515 Bacteria 4673
280 nmdc:mga0a205_63416_c1 3300050515 Unclassified 3570
281 Ga0495601_0220209 3300053077 Bacteria 1240
282 Ga0495619_0124825 3300053085 Unclassified 1766
283 Ga0105242_10348144
284 Ga0070683_100867820
285 Ga0070666_10027425
286 Ga0070680_100077132
287 Ga0070682_100854267
288 Ga0068868_100031504
289 Ga0070660_100507752
290 Ga0070689_100101127
291 Ga0070661_100197905
292 Ga0070671_100039285
293 Ga0070673_100019733
294 Ga0070688_100014387
295 Ga0070667_100236908
296 Ga0070709_10017516
297 Ga0070714_100161474
298 Ga0070711_100109515
299 Ga0070705_100631696
300 Ga0070694_100881168
301 Ga0070681_10065291
302 Ga0070681_10092068
303 Ga0070681_10261586
304 Ga0068867_100034154
305 Ga0068867_100314380
306 Ga0070699_100033990
307 Ga0070679_100064558
308 Ga0070679_100240527
309 Ga0070679_100250407
310 Ga0070684_100298982
311 Ga0068853_100064148
312 Ga0070672_100242101
313 Ga0070695_100941881
314 Ga0070696_100206584
315 Ga0070696_100228076
316 Ga0070665_100037917
317 Ga0070665_100110211
318 Ga0070704_100062897
319 Ga0070704_100070928
320 Ga0068855_100136358
321 Ga0068855_100262862
322 Ga0070664_100083157
323 Ga0068857_100041387
324 Ga0068857_100051216
325 Ga0068857_100287503
326 Ga0068856_100019474
327 Ga0068856_100061204
328 Ga0068856_101034200
329 Ga0070702_100149101
330 Ga0068859_100359463
331 Ga0068859_100822226
332 Ga0068866_10038953
333 Ga0068863_100301421
334 Ga0068858_100029710
335 Ga0068858_100096226
336 Ga0068858_100231957
337 Ga0068860_100034383
338 Ga0070716_100279095
339 Ga0097621_100010886
340 Ga0097621_100034394
341 Ga0097621_100061872
342 Ga0097621_100299892
343 Ga0068871_100011161
344 Ga0068871_100040597
345 Ga0068871_100065766
346 Ga0068871_100107295
347 Ga0068871_100234523
348 Ga0075428_100196938
349 Ga0075428_100233308
350 Ga0075430_100086265
351 Ga0075431_100017265
352 Ga0075431_100072135
353 Ga0075433_10011760
354 Ga0075433_10107302
355 Ga0075434_100009371
356 Ga0075434_100031839
357 Ga0075434_100123637
358 Ga0075429_100070194
359 Ga0075429_100254476
360 Ga0097620_100359479
361 Ga0097620_100822320
362 Ga0075435_100000840
363 Ga0075435_100197694
364 Ga0105240_10029384
365 Ga0105240_10085345
366 Ga0105240_10114412
367 Ga0105240_10160086
368 Ga0111539_10463151
369 Ga0111539_10493252
370 Ga0105245_10108788
371 Ga0105245_10139255
372 Ga0105245_10321485
373 Ga0105245_10833352
374 Ga0105245_10864347
375 Ga0105247_10027024
376 Ga0114129_10003490
377 Ga0114129_10008120
378 Ga0114129_10051539
379 Ga0114129_10057309
380 Ga0114129_10065470
381 Ga0114129_10080693
382 Ga0105241_10022154
383 Ga0105241_10051079
384 Ga0105242_10205618
385 Ga0105242_10298088
386 Ga0105248_10012145
387 Ga0105248_10021852
388 Ga0105248_10146215
389 Ga0105248_10268807
390 Ga0105248_10446368
391 Ga0105248_10833752
392 Ga0105248_11712023
393 Ga0105237_10012917
394 Ga0105237_10019896
395 Ga0105237_10079849
396 Ga0105237_10204051
397 Ga0105237_10369635
398 Ga0105238_10065832
399 Ga0105238_10082127
400 Ga0105238_10632111
401 Ga0105239_10095394
402 Ga0105239_10154469
403 Ga0105239_10408997
404 Ga0105239_10878797
405 Ga0105239_10951520
406 Ga0105246_10071191
407 Ga0105246_10178227
408 Ga0157370_10273781
409 Ga0157374_10002252
410 Ga0157374_10038869
411 Ga0157378_10015952
412 Ga0157378_10072335
413 Ga0157378_10447028
414 Ga0163162_10038627
415 Ga0163162_10085169
416 Ga0163162_10299872
417 Ga0163162_10305833
418 Ga0157372_10302572
419 Ga0157372_11116806
420 Ga0157375_10150398
421 Ga0157375_10219763
422 Ga0157375_10294267
423 Ga0163163_10020705
424 Ga0163163_10151703
425 Ga0163163_10223540
426 Ga0163163_10618338
427 Ga0157380_10904923
428 Ga0157376_10148837
429 Ga0157376_10154284
430 Ga0157376_11240405
431 Ga0207680_10029714
432 Ga0207654_10022427
433 Ga0207707_10015549
434 Ga0207707_10036278
435 Ga0207707_10090324
436 Ga0207695_10087361
437 Ga0207695_10184962
438 Ga0207671_10030505
439 Ga0207671_10032403
440 Ga0207663_10298418
441 Ga0207660_10686107
442 Ga0207657_10622270
443 Ga0207649_10160539
444 Ga0207652_10218255
445 Ga0207652_10635363
446 Ga0207694_10023308
447 Ga0207694_10125766
448 Ga0207687_10059005
449 Ga0207687_10651778
450 Ga0207687_10660422
451 Ga0207664_10129772
452 Ga0207644_10492114
453 Ga0207670_10127825
454 Ga0207704_10030152
455 Ga0207691_10293363
456 Ga0207711_10063897
457 Ga0207711_10119110
458 Ga0207711_10127259
459 Ga0207711_10558212
460 Ga0207661_10086801
461 Ga0207679_10054704
462 Ga0207679_10591257
463 Ga0207667_10067631
464 Ga0207667_10110297
465 Ga0207667_10329119
466 Ga0207651_10506712
467 Ga0207658_10532113
468 Ga0207658_10799911
469 Ga0207703_10047901
470 Ga0207639_10099989
471 Ga0207639_10169773
472 Ga0207702_10037053
473 Ga0207641_10069517
474 Ga0207641_10260930
475 Ga0207641_11265255
476 Ga0207648_10034350
477 Ga0207674_10003663
478 Ga0207674_10024010
479 Ga0207674_10314110
480 Ga0268266_10014186
481 Ga0268266_10314468
482 Ga0268264_10929126
483 Ga0268264_11007828
484 Ga0373945_0324599
485 Ga0373953_0122495
486 Ga0373955_0063094
487 Ga0373955_0634676
488 Ga0373931_0141668
489 Ga0373931_0167751
490 Ga0373933_0091551
491 Ga0373933_0456590
492 Ga0373937_0037339
493 Ga0373937_0048825
494 Ga0373937_0146537
495 Ga0373937_0391658
496 Ga0373925_0027220
497 Ga0453684_1293556
498 Ga0453684_1386087
499 Ga0451576_0350423
500 Ga0451576_0488293
501 Ga0495629_0024362
502 Ga0495651_0008630
503 Ga0495651_0210192
504 Ga0495580_0042308
505 Ga0495580_0076425
506 Ga0495580_0554883
507 Ga0495582_0093089
508 Ga0495582_0210253
509 Ga0495608_0013807
510 Ga0495618_0479731
511 Ga0495630_0020674
512 Ga0495642_0121733
513 Ga0495652_0018354
514 Ga0495652_0069057
515 Ga0495652_0433015
516 Ga0495665_0030323
517 Ga0495640_0478184
518 Ga0495586_0003316
519 Ga0495586_0107979
520 Ga0495587_0096603
521 Ga0495645_0009720
522 Ga0495645_0061355
523 Ga0495667_0024383
524 Ga0495667_0113227
525 Ga0495667_0516134
526 Ga0495634_0016778
527 Ga0495657_0001514
528 Ga0495599_0124241
529 Ga0495623_0074974
530 Ga0495658_0279289
531 Ga0495658_0548935
532 Ga0495613_0121306
533 Ga0495613_0471046
534 Ga0495600_0407501
535 Ga0495604_0031529
536 Ga0495674_0091104
537 Ga0495680_0369869
538 Ga0495684_0009925
539 Ga0495684_0209317
540 Ga0496101_0735397
541 Ga0496112_0060973
542 Ga0496112_0384269
543 Ga0496114_0131222
544 Ga0496115_0212375
545 Ga0501075_0685216
546 nmdc:mga05p37_193666_c1
547 nmdc:mga05p37_219199_c1
548 nmdc:mga05p37_35139_c1
549 nmdc:mga05p37_47724_c1
550 nmdc:mga05p37_594655_c1
551 nmdc:mga05p37_8360_c2
552 nmdc:mga09592_70440_c1
553 nmdc:mga09592_73534_c1
554 nmdc:mga0qj67_23068_c1
555 nmdc:mga06r32_202025_c1
556 nmdc:mga0n895_188182_c1
557 nmdc:mga0n895_21768_c1
558 nmdc:mga0n895_223264_c1
559 nmdc:mga0rr50_185187_c1
560 nmdc:mga0rr50_299240_c1
561 nmdc:mga0a205_37316_c1
562 nmdc:mga0a205_63416_c1
563 Ga0495601_0220209
564 Ga0495619_0124825

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vw4-assembly2.cif.gz_B 2.35 angstrom structure of caci_6494 from catenulispora acidiphila in complex with s-dnpa 0.7236 159 182
5dft-assembly3.cif.gz_C structure of the eleventh type iii domain from human fibronectin 0.6703 108 187
2h45-assembly1.cif.gz_A solution structure of the second type iii domain of human fibronectin: ensemble of 25 structures 0.6665 103 180
2pn5-assembly1.cif.gz_A crystal structure of tep1r 0.6575 112 184
6tpw-assembly1.cif.gz_A crystal structures of fniii domain one through four of the human leucocyte common antigen-related protein ( lar) 0.6524 105 189
ID Description Score Start End Superfamily
af_A0A0R0KPI3_375_473_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8557 157 183 3.30.420.10
af_X1WH44_4_261_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7911 159 181 3.10.450.50
af_Q09243_24_162_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7463 157 182 3.10.450.50
af_P23467_994_1085_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7241 113 184 2.60.40.10
af_P91532_70_161_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7184 158 181 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A7V3XJT3-F1-model_v4 Zf-HC2 domain-containing protein 0.9507 2 188
AF-A0A7V3XJT3-F1-model_v4 Zf-HC2 domain-containing protein 0.9174 2 188
AF-A0A5M8SXV2-F1-model_v4 Putative zinc-finger domain-containing protein 0.8876 1 193
AF-A0A1D2TLJ1-F1-model_v4 deleted 0.8742 1 189
AF-A0A1H4G5J6-F1-model_v4 Zinc-finger 0.8548 3 188

Map