F384905

General Info

Members Datasets Scaffolds Average Seq Length
282 91 275 131

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10001158|Ga0105242_100011586
Length 133
Sequence VIMRKLTLLVLVGFCQLASAGESETKPHELNEWNPLQANYKIHSGGTAYSEPPTKDDSVFTAAFKDEAARQVFEQIGPDVKSVCNDAPGYRVREKKGVYCSYAARLENPKNSHYRCWIGINLRTGESDVRVSC

Samples

Sample ID Description Type Environment
1 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
4 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
5 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
6 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
7 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
8 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
9 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
10 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
11 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
12 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
13 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
14 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
15 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
16 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
17 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
18 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
19 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
20 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
21 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
22 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
23 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
24 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
25 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
26 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
27 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
28 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
29 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
30 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
31 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
32 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
33 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
34 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
35 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
36 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
37 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
38 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
39 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
40 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
41 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
42 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
43 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
44 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
45 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
46 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
47 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
48 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
49 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
50 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
51 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
52 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
53 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
54 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
55 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
56 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
57 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
58 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
59 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
60 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
61 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
62 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
63 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
64 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
65 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
66 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
67 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
68 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
69 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
70 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
71 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
72 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
73 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
74 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
75 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
76 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
77 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
78 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
79 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
80 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
81 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
82 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
83 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
84 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
85 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
86 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
88 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
89 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
90 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 0
Rhizoplane 1.42
Rhizosphere 97.16
Stem 0
Stem Tuber 0
Unclassified 0.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1000043 3300003771 Bacteria 123347
2 Ga0070660_100316545 3300005339 Unclassified 1281
3 Ga0068855_100480588 3300005563 Bacteria 1352
4 Ga0105242_10001158 3300009176 Bacteria 20785
5 Ga0209564_1000010 3300025295 Bacteria 885399
6 Ga0207657_10295257 3300025919 Unclassified 1284
7 Ga0207657_10661886 3300025919 Unclassified 813
8 Ga0207686_10001349 3300025934 Bacteria 13963
9 Ga0207667_10669581 3300025949 Bacteria 1042
10 Ga0395899_0008773 3300037312 Bacteria 7780
11 Ga0395899_0021900 3300037312 Bacteria 4847
12 Ga0395899_0024759 3300037312 Bacteria 4536
13 Ga0395900_0000295 3300037418 Bacteria 75130
14 Ga0395900_0001133 3300037418 Bacteria 33674
15 Ga0395900_0074466 3300037418 Bacteria 3490
16 Ga0395900_0118581 3300037418 Bacteria 2716
17 Ga0395900_0811337 3300037418 Bacteria 863
18 Ga0395898_0112249 3300037466 Bacteria 2612
19 Ga0395898_0469247 3300037466 Bacteria 1198
20 Ga0395898_0569640 3300037466 Bacteria 1075
21 Ga0395901_0000217 3300038443 Bacteria 72615
22 Ga0395901_0265450 3300038443 Bacteria 1786
23 Ga0439455_0013903 3300042012 Bacteria 1831
24 Ga0439455_0044790 3300042012 Bacteria 1142
25 Ga0450920_018818 3300042122 Bacteria 1324
26 Ga0466969_0074458 3300044656 Bacteria 1629
27 Ga0466969_0119451 3300044656 Bacteria 1228
28 Ga0466969_0126709 3300044656 Bacteria 1186
29 Ga0466965_0008448 3300044683 Bacteria 4765
30 Ga0466965_0137669 3300044683 Unclassified 1269
31 Ga0466965_0163562 3300044683 Bacteria 1168
32 Ga0466966_0019055 3300044684 Bacteria 4522
33 Ga0466966_0032013 3300044684 Bacteria 3410
34 Ga0466966_0297998 3300044684 Unclassified 969
35 Ga0466961_0080850 3300044693 Bacteria 2057
36 Ga0466961_0230871 3300044693 Unclassified 1139
37 Ga0466971_0216615 3300044719 Unclassified 906
38 Ga0466968_0050065 3300044735 Bacteria 1781
39 Ga0466970_0057728 3300044765 Bacteria 2076
40 Ga0466970_0213850 3300044765 Bacteria 1075
41 Ga0466970_0720763 3300044765 Bacteria 582
42 Ga0466957_0000259 3300044842 Bacteria 25418
43 Ga0466959_0000234 3300045049 Bacteria 34859
44 Ga0466959_0004736 3300045049 Bacteria 9164
45 Ga0466959_0060516 3300045049 Bacteria 2755
46 Ga0466959_0132107 3300045049 Bacteria 1769
47 Ga0466958_0335571 3300045836 Unclassified 972
48 Ga0495617_000015 3300046452 Bacteria 260968
49 Ga0495617_000030 3300046452 Bacteria 152392
50 Ga0495617_112723 3300046452 Bacteria 879
51 Ga0495627_000228 3300046453 Bacteria 59535
52 Ga0495627_001319 3300046453 Bacteria 15128
53 Ga0495627_005007 3300046453 Bacteria 5427
54 Ga0495627_019840 3300046453 Bacteria 2248
55 Ga0495627_051957 3300046453 Bacteria 1230
56 Ga0495590_0032320 3300046457 Bacteria 1830
57 Ga0495590_0058462 3300046457 Bacteria 1348
58 Ga0495591_000153 3300046458 Bacteria 73339
59 Ga0495629_0729456 3300046459 Bacteria 657
60 Ga0495580_0700923 3300046472 Bacteria 663
61 Ga0495605_0000021 3300046474 Bacteria 248512
62 Ga0495605_0000046 3300046474 Bacteria 175985
63 Ga0495605_0000437 3300046474 Bacteria 37678
64 Ga0495605_0043354 3300046474 Bacteria 2231
65 Ga0495605_0058999 3300046474 Bacteria 1843
66 Ga0495584_0000645 3300046491 Bacteria 23239
67 Ga0495584_0004239 3300046491 Bacteria 7735
68 Ga0495584_0011546 3300046491 Bacteria 4526
69 Ga0495584_0045380 3300046491 Bacteria 2217
70 Ga0495584_0168767 3300046491 Bacteria 1112
71 Ga0495584_0232392 3300046491 Bacteria 937
72 Ga0495584_0468014 3300046491 Bacteria 642
73 Ga0495584_0680131 3300046491 Unclassified 525
74 Ga0495585_0000475 3300046492 Bacteria 38339
75 Ga0495585_0000530 3300046492 Bacteria 36070
76 Ga0495585_0001126 3300046492 Bacteria 21929
77 Ga0495585_0001235 3300046492 Bacteria 20615
78 Ga0495585_0007692 3300046492 Bacteria 6569
79 Ga0495585_0011893 3300046492 Bacteria 5139
80 Ga0495585_0026581 3300046492 Bacteria 3306
81 Ga0495585_0027250 3300046492 Bacteria 3261
82 Ga0495585_0029744 3300046492 Bacteria 3108
83 Ga0495585_0039320 3300046492 Bacteria 2659
84 Ga0495585_0192609 3300046492 Unclassified 1042
85 Ga0495585_0236717 3300046492 Bacteria 915
86 Ga0495594_0061458 3300046499 Bacteria 2079
87 Ga0495594_0164549 3300046499 Bacteria 1261
88 Ga0495594_0274548 3300046499 Bacteria 960
89 Ga0495596_0001442 3300046500 Bacteria 13606
90 Ga0495596_0002967 3300046500 Bacteria 8800
91 Ga0495596_0003443 3300046500 Bacteria 8008
92 Ga0495596_0003487 3300046500 Bacteria 7939
93 Ga0495596_0004828 3300046500 Bacteria 6477
94 Ga0495596_0005263 3300046500 Bacteria 6146
95 Ga0495596_0008750 3300046500 Bacteria 4485
96 Ga0495596_0026549 3300046500 Bacteria 2333
97 Ga0495596_0051292 3300046500 Bacteria 1616
98 Ga0495607_0001168 3300046501 Bacteria 23749
99 Ga0495607_0003667 3300046501 Bacteria 11648
100 Ga0495607_0006862 3300046501 Bacteria 7941
101 Ga0495607_0017920 3300046501 Bacteria 4530
102 Ga0495607_0019131 3300046501 Bacteria 4354
103 Ga0495583_0000065 3300046506 Bacteria 192022
104 Ga0495583_0000873 3300046506 Bacteria 36542
105 Ga0495583_0001520 3300046506 Bacteria 23011
106 Ga0495583_0002846 3300046506 Bacteria 14091
107 Ga0495610_0004943 3300046512 Bacteria 9663
108 Ga0495616_0001493 3300046513 Bacteria 16181
109 Ga0495616_0002252 3300046513 Bacteria 12910
110 Ga0495616_0004294 3300046513 Bacteria 8999
111 Ga0495616_0012127 3300046513 Bacteria 4906
112 Ga0495616_0037031 3300046513 Bacteria 2513
113 Ga0495616_0044567 3300046513 Bacteria 2249
114 Ga0495616_0182613 3300046513 Bacteria 931
115 Ga0495631_0006056 3300046518 Bacteria 6283
116 Ga0495631_0008319 3300046518 Bacteria 5228
117 Ga0495631_0014012 3300046518 Bacteria 3876
118 Ga0495631_0023167 3300046518 Bacteria 2880
119 Ga0495631_0029188 3300046518 Bacteria 2511
120 Ga0495631_0029599 3300046518 Bacteria 2489
121 Ga0495631_0033907 3300046518 Bacteria 2290
122 Ga0495631_0044211 3300046518 Bacteria 1963
123 Ga0495631_0052522 3300046518 Bacteria 1779
124 Ga0495632_0000040 3300046519 Bacteria 149644
125 Ga0495632_0013049 3300046519 Bacteria 4761
126 Ga0495637_0000011 3300046520 Bacteria 337279
127 Ga0495643_0005685 3300046522 Bacteria 8353
128 Ga0495643_0010960 3300046522 Bacteria 5549
129 Ga0495644_0002060 3300046523 Bacteria 8105
130 Ga0495644_0029168 3300046523 Bacteria 2085
131 Ga0495644_0040817 3300046523 Bacteria 1749
132 Ga0495644_0073779 3300046523 Bacteria 1283
133 Ga0495644_0122747 3300046523 Bacteria 988
134 Ga0495644_0319836 3300046523 Unclassified 609
135 Ga0495648_0000815 3300046524 Bacteria 32978
136 Ga0495648_0005736 3300046524 Bacteria 10243
137 Ga0495648_0192095 3300046524 Bacteria 1029
138 Ga0495648_0265085 3300046524 Bacteria 822
139 Ga0495663_0008354 3300046525 Bacteria 2867
140 Ga0495663_0043711 3300046525 Bacteria 1369
141 Ga0495666_0000877 3300046526 Bacteria 14038
142 Ga0495642_0000013 3300046528 Bacteria 123896
143 Ga0495642_0001505 3300046528 Bacteria 10369
144 Ga0495642_0003744 3300046528 Bacteria 5955
145 Ga0495642_0004283 3300046528 Bacteria 5548
146 Ga0495642_0010515 3300046528 Bacteria 3543
147 Ga0495642_0059435 3300046528 Bacteria 1584
148 Ga0495642_0324632 3300046528 Bacteria 675
149 Ga0495642_0571580 3300046528 Unclassified 502
150 Ga0495654_0210098 3300046530 Bacteria 828
151 Ga0495665_0004565 3300046531 Bacteria 7474
152 Ga0495640_0046361 3300046533 Bacteria 3012
153 Ga0495586_0063928 3300046535 Bacteria 2005
154 Ga0495609_0013924 3300046538 Bacteria 3791
155 Ga0495609_0031711 3300046538 Bacteria 2401
156 Ga0495609_0051253 3300046538 Bacteria 1838
157 Ga0495609_0267656 3300046538 Bacteria 701
158 Ga0495597_0015235 3300046542 Bacteria 3642
159 Ga0495597_0048936 3300046542 Bacteria 1869
160 Ga0495597_0101129 3300046542 Bacteria 1215
161 Ga0495622_0003681 3300046557 Bacteria 7181
162 Ga0495633_0000661 3300046558 Bacteria 31804
163 Ga0495633_0003581 3300046558 Bacteria 10274
164 Ga0495633_0007263 3300046558 Bacteria 6410
165 Ga0495633_0014189 3300046558 Bacteria 4175
166 Ga0495633_0017178 3300046558 Bacteria 3707
167 Ga0495633_0066594 3300046558 Bacteria 1682
168 Ga0495656_0016975 3300046615 Unclassified 2771
169 Ga0495656_0024025 3300046615 Bacteria 2403
170 Ga0495656_0222640 3300046615 Bacteria 944
171 Ga0495668_0000373 3300046616 Bacteria 59298
172 Ga0495668_0002059 3300046616 Bacteria 17461
173 Ga0495668_0002392 3300046616 Bacteria 15549
174 Ga0495668_0002418 3300046616 Bacteria 15400
175 Ga0495668_0069027 3300046616 Bacteria 1944
176 Ga0495668_0077879 3300046616 Bacteria 1820
177 Ga0495668_0109984 3300046616 Bacteria 1507
178 Ga0495611_0050781 3300046648 Bacteria 1868
179 Ga0495611_0099081 3300046648 Bacteria 1352
180 Ga0495611_0243472 3300046648 Bacteria 834
181 Ga0495611_0341940 3300046648 Bacteria 687
182 Ga0495625_0849435 3300046660 Unclassified 527
183 Ga0495661_0002889 3300046665 Bacteria 13001
184 Ga0495661_0016892 3300046665 Bacteria 4822
185 Ga0495661_0045136 3300046665 Bacteria 2696
186 Ga0495661_0050711 3300046665 Bacteria 2510
187 Ga0495661_0056541 3300046665 Bacteria 2346
188 Ga0495661_0075867 3300046665 Bacteria 1952
189 Ga0495661_0082824 3300046665 Bacteria 1845
190 Ga0495661_0096883 3300046665 Bacteria 1667
191 Ga0495661_0122619 3300046665 Bacteria 1433
192 Ga0495661_0208927 3300046665 Bacteria 1017
193 Ga0495661_0213460 3300046665 Bacteria 1003
194 Ga0495661_0233081 3300046665 Unclassified 948
195 Ga0495661_0239463 3300046665 Bacteria 931
196 Ga0495588_0122999 3300046674 Bacteria 1368
197 Ga0495669_0000161 3300046684 Bacteria 42856
198 Ga0495669_0004498 3300046684 Bacteria 5762
199 Ga0495669_0019161 3300046684 Bacteria 2951
200 Ga0495669_0042520 3300046684 Bacteria 2020
201 Ga0495669_0064630 3300046684 Bacteria 1660
202 Ga0495669_0142861 3300046684 Bacteria 1130
203 Ga0495669_0147012 3300046684 Unclassified 1114
204 Ga0495624_0005713 3300046690 Bacteria 8920
205 Ga0495670_0000660 3300046691 Bacteria 16507
206 Ga0495670_0004028 3300046691 Bacteria 7205
207 Ga0495670_0009352 3300046691 Bacteria 4821
208 Ga0495670_0026597 3300046691 Bacteria 2864
209 Ga0495670_0027443 3300046691 Bacteria 2821
210 Ga0495670_0051006 3300046691 Bacteria 2071
211 Ga0495670_0159014 3300046691 Bacteria 1186
212 Ga0495670_0251832 3300046691 Bacteria 942
213 Ga0495670_0406489 3300046691 Unclassified 736
214 Ga0495671_0000810 3300046692 Bacteria 22357
215 Ga0495671_0000823 3300046692 Bacteria 22129
216 Ga0495671_0001085 3300046692 Bacteria 18827
217 Ga0495671_0001119 3300046692 Bacteria 18505
218 Ga0495671_0007352 3300046692 Bacteria 6285
219 Ga0495671_0010821 3300046692 Bacteria 5043
220 Ga0495649_0024124 3300046694 Bacteria 3395
221 Ga0495589_0000372 3300046794 Bacteria 34449
222 Ga0495589_0000954 3300046794 Bacteria 17701
223 Ga0495589_0006579 3300046794 Bacteria 6122
224 Ga0495589_0093151 3300046794 Bacteria 1462
225 Ga0495589_0184875 3300046794 Bacteria 987
226 Ga0495660_0000279 3300046810 Bacteria 47712
227 Ga0495660_0054040 3300046810 Bacteria 2177
228 Ga0495581_0005991 3300047315 Bacteria 7043
229 Ga0495581_0041603 3300047315 Bacteria 2660
230 Ga0495672_0000307 3300047320 Bacteria 65630
231 Ga0495672_0003087 3300047320 Bacteria 14570
232 Ga0495683_0000067 3300047323 Bacteria 111573
233 Ga0495683_0000097 3300047323 Bacteria 89730
234 Ga0495683_0017605 3300047323 Bacteria 3701
235 Ga0495683_0049526 3300047323 Bacteria 2104
236 Ga0495687_000812 3300047443 Bacteria 33554
237 Ga0495687_003849 3300047443 Bacteria 10563
238 Ga0495677_0002741 3300047445 Bacteria 6885
239 Ga0495677_0004021 3300047445 Bacteria 5678
240 Ga0495677_0006137 3300047445 Bacteria 4545
241 Ga0495677_0022597 3300047445 Bacteria 2281
242 Ga0495677_0041155 3300047445 Bacteria 1690
243 Ga0495677_0057866 3300047445 Bacteria 1433
244 Ga0495677_0060850 3300047445 Bacteria 1400
245 Ga0495677_0061821 3300047445 Bacteria 1389
246 Ga0495679_011178 3300047446 Bacteria 3481
247 Ga0495679_064114 3300047446 Bacteria 1071
248 Ga0495681_0004643 3300047470 Bacteria 9317
249 Ga0495681_0006439 3300047470 Bacteria 7717
250 Ga0495681_0006721 3300047470 Bacteria 7507
251 Ga0495681_0062656 3300047470 Bacteria 1709
252 Ga0495681_0085658 3300047470 Bacteria 1399
253 Ga0495686_0040463 3300047472 Bacteria 2972
254 Ga0495686_0041296 3300047472 Bacteria 2937
255 Ga0495593_0107484 3300047673 Bacteria 1426
256 Ga0495626_0000712 3300048091 Bacteria 31224
257 Ga0495626_0002417 3300048091 Bacteria 12984
258 Ga0495626_0006986 3300048091 Bacteria 6348
259 Ga0495626_0022804 3300048091 Bacteria 3089
260 Ga0495626_0089767 3300048091 Bacteria 1353
261 Ga0495626_0152103 3300048091 Bacteria 975
262 Ga0495626_0420381 3300048091 Unclassified 515
263 Ga0496100_0055297 3300048903 Bacteria 2592
264 Ga0496101_0042914 3300048904 Bacteria 3229
265 Ga0496102_0402408 3300048905 Unclassified 1287
266 Ga0496106_0002041 3300048909 Bacteria 15181
267 Ga0496122_0398296 3300048925 Unclassified 700
268 Ga0496124_0140460 3300048927 Bacteria 1907
269 Ga0501310_033883 3300049130 Unclassified 688
270 Ga0495678_000331 3300049459 Bacteria 49785
271 Ga0495682_0053086 3300049460 Bacteria 1472
272 Ga0495682_0088885 3300049460 Bacteria 1110
273 Ga0501035_0002694 3300049822 Bacteria 17279
274 Ga0587068_003106 3300059641 Bacteria 2091
275 Ga0466962_0042073 3300061719 Bacteria 2186

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046513 Ga0495616_0037031 Ga0495616_0037031_1865_2206 103
2 3300046616 Ga0495668_0069027 Ga0495668_0069027_241_582 103
3 3300042122 Ga0450920_018818 Ga0450920_018818_42_395 108
4 3300037466 Ga0395898_0469247 Ga0395898_0469247_316_678 113
5 3300046513 Ga0495616_0004294 Ga0495616_0004294_4500_4877 115
6 3300044842 Ga0466957_0000259 Ga0466957_0000259_18824_19198 117
7 3300048905 Ga0496102_0402408 Ga0496102_0402408_489_866 117
8 3300046528 Ga0495642_0000013 Ga0495642_0000013_20142_20528 118
9 3300046538 Ga0495609_0031711 Ga0495609_0031711_1850_2236 118
10 3300046684 Ga0495669_0004498 Ga0495669_0004498_371_757 118
11 3300046691 Ga0495670_0027443 Ga0495670_0027443_372_758 118
12 3300046692 Ga0495671_0001119 Ga0495671_0001119_7204_7590 118
13 3300047445 Ga0495677_0004021 Ga0495677_0004021_514_900 118
14 3300025919 Ga0207657_10661886 Ga0207657_106618862 119
15 3300046491 Ga0495584_0000645 Ga0495584_0000645_16846_17232 120
16 3300046492 Ga0495585_0000530 Ga0495585_0000530_18313_18699 120
17 3300046492 Ga0495585_0011893 Ga0495585_0011893_3883_4269 120
18 3300046513 Ga0495616_0001493 Ga0495616_0001493_15740_16126 120
19 3300046558 Ga0495633_0000661 Ga0495633_0000661_17195_17581 120
20 3300047323 Ga0495683_0000097 Ga0495683_0000097_34573_34959 120
21 3300049460 Ga0495682_0088885 Ga0495682_0088885_457_843 120
22 3300046457 Ga0495590_0032320 Ga0495590_0032320_1253_1645 121
23 3300046474 Ga0495605_0058999 Ga0495605_0058999_206_598 121
24 3300046616 Ga0495668_0077879 Ga0495668_0077879_184_576 121
25 3300046665 Ga0495661_0082824 Ga0495661_0082824_1248_1640 121
26 3300009176 Ga0105242_10001158 Ga0105242_100011586 122
27 3300025934 Ga0207686_10001349 Ga0207686_1000134913 122
28 3300037312 Ga0395899_0024759 Ga0395899_0024759_646_1041 122
29 3300037418 Ga0395900_0118581 Ga0395900_0118581_939_1337 122
30 3300037418 Ga0395900_0811337 Ga0395900_0811337_206_601 122
31 3300042012 Ga0439455_0013903 Ga0439455_0013903_1210_1605 122
32 3300042012 Ga0439455_0044790 Ga0439455_0044790_115_510 122
33 3300044656 Ga0466969_0126709 Ga0466969_0126709_335_730 122
34 3300044684 Ga0466966_0297998 Ga0466966_0297998_469_864 122
35 3300044765 Ga0466970_0720763 Ga0466970_0720763_141_536 122
36 3300045049 Ga0466959_0132107 Ga0466959_0132107_861_1256 122
37 3300046452 Ga0495617_000015 Ga0495617_000015_256447_256845 122
38 3300046452 Ga0495617_000030 Ga0495617_000030_128463_128858 122
39 3300046452 Ga0495617_112723 Ga0495617_112723_338_733 122
40 3300046453 Ga0495627_000228 Ga0495627_000228_35604_35999 122
41 3300046453 Ga0495627_001319 Ga0495627_001319_10677_11075 122
42 3300046453 Ga0495627_005007 Ga0495627_005007_1078_1473 122
43 3300046453 Ga0495627_005007 Ga0495627_005007_592_990 122
44 3300046453 Ga0495627_019840 Ga0495627_019840_415_813 122
45 3300046457 Ga0495590_0058462 Ga0495590_0058462_912_1307 122
46 3300046458 Ga0495591_000153 Ga0495591_000153_66195_66590 122
47 3300046474 Ga0495605_0000021 Ga0495605_0000021_247811_248209 122
48 3300046474 Ga0495605_0000046 Ga0495605_0000046_152056_152451 122
49 3300046474 Ga0495605_0000437 Ga0495605_0000437_23249_23644 122
50 3300046474 Ga0495605_0043354 Ga0495605_0043354_1487_1882 122
51 3300046491 Ga0495584_0011546 Ga0495584_0011546_623_1021 122
52 3300046491 Ga0495584_0045380 Ga0495584_0045380_562_957 122
53 3300046491 Ga0495584_0168767 Ga0495584_0168767_481_876 122
54 3300046491 Ga0495584_0468014 Ga0495584_0468014_157_555 122
55 3300046491 Ga0495584_0680131 Ga0495584_0680131_46_441 122
56 3300046492 Ga0495585_0001126 Ga0495585_0001126_21019_21414 122
57 3300046492 Ga0495585_0007692 Ga0495585_0007692_343_738 122
58 3300046492 Ga0495585_0026581 Ga0495585_0026581_2602_3000 122
59 3300046492 Ga0495585_0192609 Ga0495585_0192609_618_1019 122
60 3300046499 Ga0495594_0164549 Ga0495594_0164549_149_547 122
61 3300046499 Ga0495594_0274548 Ga0495594_0274548_432_827 122
62 3300046500 Ga0495596_0003443 Ga0495596_0003443_1023_1418 122
63 3300046500 Ga0495596_0003487 Ga0495596_0003487_4031_4429 122
64 3300046500 Ga0495596_0004828 Ga0495596_0004828_1847_2245 122
65 3300046500 Ga0495596_0005263 Ga0495596_0005263_3770_4165 122
66 3300046500 Ga0495596_0026549 Ga0495596_0026549_1521_1916 122
67 3300046500 Ga0495596_0051292 Ga0495596_0051292_674_1069 122
68 3300046501 Ga0495607_0001168 Ga0495607_0001168_5055_5450 122
69 3300046501 Ga0495607_0003667 Ga0495607_0003667_3592_3987 122
70 3300046501 Ga0495607_0006862 Ga0495607_0006862_5811_6206 122
71 3300046501 Ga0495607_0019131 Ga0495607_0019131_307_705 122
72 3300046506 Ga0495583_0000873 Ga0495583_0000873_8526_8924 122
73 3300046506 Ga0495583_0001520 Ga0495583_0001520_17023_17418 122
74 3300046506 Ga0495583_0002846 Ga0495583_0002846_11481_11876 122
75 3300046506 Ga0495583_0002846 Ga0495583_0002846_12041_12439 122
76 3300046512 Ga0495610_0004943 Ga0495610_0004943_1922_2317 122
77 3300046513 Ga0495616_0037031 Ga0495616_0037031_1303_1698 122
78 3300046513 Ga0495616_0044567 Ga0495616_0044567_151_549 122
79 3300046513 Ga0495616_0182613 Ga0495616_0182613_326_724 122
80 3300046518 Ga0495631_0008319 Ga0495631_0008319_1660_2058 122
81 3300046518 Ga0495631_0014012 Ga0495631_0014012_2896_3294 122
82 3300046518 Ga0495631_0033907 Ga0495631_0033907_1544_1939 122
83 3300046518 Ga0495631_0044211 Ga0495631_0044211_14_409 122
84 3300046518 Ga0495631_0052522 Ga0495631_0052522_116_511 122
85 3300046519 Ga0495632_0000040 Ga0495632_0000040_147210_147605 122
86 3300046519 Ga0495632_0013049 Ga0495632_0013049_1983_2378 122
87 3300046520 Ga0495637_0000011 Ga0495637_0000011_206465_206860 122
88 3300046522 Ga0495643_0005685 Ga0495643_0005685_3920_4315 122
89 3300046522 Ga0495643_0010960 Ga0495643_0010960_538_933 122
90 3300046523 Ga0495644_0002060 Ga0495644_0002060_5830_6225 122
91 3300046523 Ga0495644_0029168 Ga0495644_0029168_591_986 122
92 3300046523 Ga0495644_0073779 Ga0495644_0073779_708_1106 122
93 3300046523 Ga0495644_0122747 Ga0495644_0122747_283_681 122
94 3300046523 Ga0495644_0319836 Ga0495644_0319836_173_568 122
95 3300046524 Ga0495648_0000815 Ga0495648_0000815_28495_28890 122
96 3300046524 Ga0495648_0005736 Ga0495648_0005736_9664_10062 122
97 3300046524 Ga0495648_0192095 Ga0495648_0192095_181_585 122
98 3300046525 Ga0495663_0043711 Ga0495663_0043711_144_542 122
99 3300046528 Ga0495642_0001505 Ga0495642_0001505_308_706 122
100 3300046528 Ga0495642_0004283 Ga0495642_0004283_806_1204 122
101 3300046528 Ga0495642_0010515 Ga0495642_0010515_2842_3237 122
102 3300046528 Ga0495642_0059435 Ga0495642_0059435_226_621 122
103 3300046528 Ga0495642_0571580 Ga0495642_0571580_44_439 122
104 3300046530 Ga0495654_0210098 Ga0495654_0210098_123_521 122
105 3300046533 Ga0495640_0046361 Ga0495640_0046361_29_427 122
106 3300046538 Ga0495609_0051253 Ga0495609_0051253_594_989 122
107 3300046542 Ga0495597_0015235 Ga0495597_0015235_1459_1857 122
108 3300046558 Ga0495633_0007263 Ga0495633_0007263_1052_1447 122
109 3300046558 Ga0495633_0014189 Ga0495633_0014189_3572_3967 122
110 3300046558 Ga0495633_0066594 Ga0495633_0066594_824_1219 122
111 3300046615 Ga0495656_0024025 Ga0495656_0024025_1457_1852 122
112 3300046615 Ga0495656_0222640 Ga0495656_0222640_333_731 122
113 3300046616 Ga0495668_0000373 Ga0495668_0000373_35616_36011 122
114 3300046616 Ga0495668_0002059 Ga0495668_0002059_4318_4716 122
115 3300046616 Ga0495668_0002418 Ga0495668_0002418_14812_15210 122
116 3300046616 Ga0495668_0069027 Ga0495668_0069027_747_1142 122
117 3300046616 Ga0495668_0109984 Ga0495668_0109984_563_961 122
118 3300046648 Ga0495611_0050781 Ga0495611_0050781_788_1183 122
119 3300046648 Ga0495611_0243472 Ga0495611_0243472_242_640 122
120 3300046648 Ga0495611_0341940 Ga0495611_0341940_240_638 122
121 3300046660 Ga0495625_0849435 Ga0495625_0849435_61_465 122
122 3300046665 Ga0495661_0002889 Ga0495661_0002889_8833_9228 122
123 3300046665 Ga0495661_0016892 Ga0495661_0016892_2001_2396 122
124 3300046665 Ga0495661_0045136 Ga0495661_0045136_1201_1596 122
125 3300046665 Ga0495661_0050711 Ga0495661_0050711_1736_2131 122
126 3300046665 Ga0495661_0075867 Ga0495661_0075867_714_1109 122
127 3300046665 Ga0495661_0122619 Ga0495661_0122619_233_628 122
128 3300046665 Ga0495661_0208927 Ga0495661_0208927_392_790 122
129 3300046665 Ga0495661_0213460 Ga0495661_0213460_432_830 122
130 3300046665 Ga0495661_0233081 Ga0495661_0233081_380_775 122
131 3300046665 Ga0495661_0239463 Ga0495661_0239463_96_494 122
132 3300046674 Ga0495588_0122999 Ga0495588_0122999_745_1146 122
133 3300046684 Ga0495669_0019161 Ga0495669_0019161_1481_1879 122
134 3300046684 Ga0495669_0042520 Ga0495669_0042520_1579_1977 122
135 3300046684 Ga0495669_0064630 Ga0495669_0064630_314_712 122
136 3300046684 Ga0495669_0142861 Ga0495669_0142861_309_704 122
137 3300046691 Ga0495670_0009352 Ga0495670_0009352_3491_3886 122
138 3300046691 Ga0495670_0026597 Ga0495670_0026597_1137_1535 122
139 3300046691 Ga0495670_0026597 Ga0495670_0026597_654_1049 122
140 3300046691 Ga0495670_0251832 Ga0495670_0251832_444_842 122
141 3300046691 Ga0495670_0406489 Ga0495670_0406489_135_536 122
142 3300046692 Ga0495671_0000810 Ga0495671_0000810_21567_21965 122
143 3300046692 Ga0495671_0001085 Ga0495671_0001085_15564_15959 122
144 3300046692 Ga0495671_0007352 Ga0495671_0007352_2681_3079 122
145 3300046692 Ga0495671_0010821 Ga0495671_0010821_2403_2801 122
146 3300046694 Ga0495649_0024124 Ga0495649_0024124_2224_2619 122
147 3300046794 Ga0495589_0000372 Ga0495589_0000372_23370_23765 122
148 3300046794 Ga0495589_0000954 Ga0495589_0000954_8575_8970 122
149 3300046794 Ga0495589_0006579 Ga0495589_0006579_5348_5743 122
150 3300046794 Ga0495589_0093151 Ga0495589_0093151_380_775 122
151 3300046794 Ga0495589_0184875 Ga0495589_0184875_242_640 122
152 3300046810 Ga0495660_0000279 Ga0495660_0000279_23665_24060 122
153 3300046810 Ga0495660_0054040 Ga0495660_0054040_1288_1683 122
154 3300047320 Ga0495672_0000307 Ga0495672_0000307_61034_61429 122
155 3300047320 Ga0495672_0003087 Ga0495672_0003087_14045_14440 122
156 3300047323 Ga0495683_0017605 Ga0495683_0017605_1820_2215 122
157 3300047323 Ga0495683_0049526 Ga0495683_0049526_1498_1893 122
158 3300047443 Ga0495687_000812 Ga0495687_000812_9895_10290 122
159 3300047445 Ga0495677_0002741 Ga0495677_0002741_1750_2145 122
160 3300047445 Ga0495677_0006137 Ga0495677_0006137_111_509 122
161 3300047445 Ga0495677_0022597 Ga0495677_0022597_1543_1941 122
162 3300047445 Ga0495677_0041155 Ga0495677_0041155_176_574 122
163 3300047445 Ga0495677_0041155 Ga0495677_0041155_662_1057 122
164 3300047445 Ga0495677_0060850 Ga0495677_0060850_177_572 122
165 3300047446 Ga0495679_011178 Ga0495679_011178_1297_1692 122
166 3300047446 Ga0495679_064114 Ga0495679_064114_366_764 122
167 3300047470 Ga0495681_0004643 Ga0495681_0004643_1922_2317 122
168 3300047470 Ga0495681_0006439 Ga0495681_0006439_6371_6766 122
169 3300047470 Ga0495681_0006439 Ga0495681_0006439_6854_7252 122
170 3300047470 Ga0495681_0006721 Ga0495681_0006721_1486_1881 122
171 3300047470 Ga0495681_0062656 Ga0495681_0062656_814_1212 122
172 3300047472 Ga0495686_0040463 Ga0495686_0040463_1683_2078 122
173 3300047472 Ga0495686_0041296 Ga0495686_0041296_1274_1669 122
174 3300048091 Ga0495626_0000712 Ga0495626_0000712_7359_7754 122
175 3300048091 Ga0495626_0002417 Ga0495626_0002417_12375_12779 122
176 3300048091 Ga0495626_0022804 Ga0495626_0022804_1568_1963 122
177 3300048091 Ga0495626_0089767 Ga0495626_0089767_187_582 122
178 3300048091 Ga0495626_0152103 Ga0495626_0152103_171_575 122
179 3300048903 Ga0496100_0055297 Ga0496100_0055297_615_1013 122
180 3300048904 Ga0496101_0042914 Ga0496101_0042914_381_779 122
181 3300048925 Ga0496122_0398296 Ga0496122_0398296_212_610 122
182 3300048927 Ga0496124_0140460 Ga0496124_0140460_327_728 122
183 3300049459 Ga0495678_000331 Ga0495678_000331_9569_9964 122
184 3300049460 Ga0495682_0053086 Ga0495682_0053086_886_1281 122
185 3300059641 Ga0587068_003106 Ga0587068_003106_953_1348 122
186 3300046491 Ga0495584_0004239 Ga0495584_0004239_1190_1585 123
187 3300046492 Ga0495585_0001235 Ga0495585_0001235_17784_18179 123
188 3300046500 Ga0495596_0008750 Ga0495596_0008750_2741_3136 123
189 3300046513 Ga0495616_0012127 Ga0495616_0012127_172_567 123
190 3300046538 Ga0495609_0013924 Ga0495609_0013924_435_809 123
191 3300046538 Ga0495609_0267656 Ga0495609_0267656_192_587 123
192 3300046558 Ga0495633_0003581 Ga0495633_0003581_3861_4256 123
193 3300047323 Ga0495683_0000067 Ga0495683_0000067_89001_89396 123
194 3300005339 Ga0070660_100316545 Ga0070660_1003165452 124
195 3300005563 Ga0068855_100480588 Ga0068855_1004805883 124
196 3300025919 Ga0207657_10295257 Ga0207657_102952572 124
197 3300025949 Ga0207667_10669581 Ga0207667_106695813 124
198 3300037312 Ga0395899_0008773 Ga0395899_0008773_3965_4363 124
199 3300037312 Ga0395899_0021900 Ga0395899_0021900_2682_3092 124
200 3300037418 Ga0395900_0000295 Ga0395900_0000295_48438_48848 124
201 3300037418 Ga0395900_0001133 Ga0395900_0001133_14726_15121 124
202 3300037418 Ga0395900_0074466 Ga0395900_0074466_381_779 124
203 3300037466 Ga0395898_0112249 Ga0395898_0112249_2179_2577 124
204 3300037466 Ga0395898_0569640 Ga0395898_0569640_330_725 124
205 3300038443 Ga0395901_0000217 Ga0395901_0000217_24551_24946 124
206 3300038443 Ga0395901_0265450 Ga0395901_0265450_60_458 124
207 3300044656 Ga0466969_0074458 Ga0466969_0074458_42_440 124
208 3300044656 Ga0466969_0119451 Ga0466969_0119451_741_1145 124
209 3300044683 Ga0466965_0008448 Ga0466965_0008448_778_1173 124
210 3300044683 Ga0466965_0137669 Ga0466965_0137669_147_551 124
211 3300044683 Ga0466965_0163562 Ga0466965_0163562_714_1088 124
212 3300044684 Ga0466966_0019055 Ga0466966_0019055_489_893 124
213 3300044684 Ga0466966_0032013 Ga0466966_0032013_2213_2608 124
214 3300044693 Ga0466961_0080850 Ga0466961_0080850_1296_1694 124
215 3300044693 Ga0466961_0230871 Ga0466961_0230871_594_989 124
216 3300044719 Ga0466971_0216615 Ga0466971_0216615_226_630 124
217 3300044735 Ga0466968_0050065 Ga0466968_0050065_1219_1593 124
218 3300044765 Ga0466970_0057728 Ga0466970_0057728_70_474 124
219 3300044765 Ga0466970_0213850 Ga0466970_0213850_92_490 124
220 3300045049 Ga0466959_0000234 Ga0466959_0000234_386_790 124
221 3300045049 Ga0466959_0004736 Ga0466959_0004736_6368_6763 124
222 3300045049 Ga0466959_0060516 Ga0466959_0060516_789_1187 124
223 3300045836 Ga0466958_0335571 Ga0466958_0335571_11_415 124
224 3300046453 Ga0495627_051957 Ga0495627_051957_640_1038 124
225 3300046459 Ga0495629_0729456 Ga0495629_0729456_88_486 124
226 3300046472 Ga0495580_0700923 Ga0495580_0700923_47_445 124
227 3300046491 Ga0495584_0232392 Ga0495584_0232392_164_562 124
228 3300046492 Ga0495585_0000475 Ga0495585_0000475_9182_9580 124
229 3300046492 Ga0495585_0027250 Ga0495585_0027250_2602_2994 124
230 3300046492 Ga0495585_0029744 Ga0495585_0029744_268_666 124
231 3300046492 Ga0495585_0039320 Ga0495585_0039320_1643_2041 124
232 3300046492 Ga0495585_0236717 Ga0495585_0236717_156_554 124
233 3300046499 Ga0495594_0061458 Ga0495594_0061458_148_546 124
234 3300046500 Ga0495596_0001442 Ga0495596_0001442_7735_8133 124
235 3300046500 Ga0495596_0002967 Ga0495596_0002967_8067_8465 124
236 3300046501 Ga0495607_0017920 Ga0495607_0017920_2389_2763 124
237 3300046506 Ga0495583_0000065 Ga0495583_0000065_145276_145674 124
238 3300046513 Ga0495616_0002252 Ga0495616_0002252_8666_9064 124
239 3300046518 Ga0495631_0006056 Ga0495631_0006056_748_1146 124
240 3300046518 Ga0495631_0023167 Ga0495631_0023167_2060_2458 124
241 3300046518 Ga0495631_0029188 Ga0495631_0029188_1352_1750 124
242 3300046518 Ga0495631_0029599 Ga0495631_0029599_164_562 124
243 3300046523 Ga0495644_0040817 Ga0495644_0040817_1009_1407 124
244 3300046524 Ga0495648_0265085 Ga0495648_0265085_316_714 124
245 3300046525 Ga0495663_0008354 Ga0495663_0008354_1391_1789 124
246 3300046526 Ga0495666_0000877 Ga0495666_0000877_799_1197 124
247 3300046528 Ga0495642_0003744 Ga0495642_0003744_400_798 124
248 3300046528 Ga0495642_0324632 Ga0495642_0324632_142_540 124
249 3300046531 Ga0495665_0004565 Ga0495665_0004565_773_1171 124
250 3300046535 Ga0495586_0063928 Ga0495586_0063928_188_586 124
251 3300046542 Ga0495597_0048936 Ga0495597_0048936_1303_1701 124
252 3300046542 Ga0495597_0101129 Ga0495597_0101129_743_1141 124
253 3300046557 Ga0495622_0003681 Ga0495622_0003681_5884_6282 124
254 3300046558 Ga0495633_0017178 Ga0495633_0017178_1202_1600 124
255 3300046615 Ga0495656_0016975 Ga0495656_0016975_133_531 124
256 3300046616 Ga0495668_0002392 Ga0495668_0002392_4157_4555 124
257 3300046648 Ga0495611_0099081 Ga0495611_0099081_817_1215 124
258 3300046665 Ga0495661_0056541 Ga0495661_0056541_1701_2099 124
259 3300046665 Ga0495661_0096883 Ga0495661_0096883_144_542 124
260 3300046684 Ga0495669_0000161 Ga0495669_0000161_34738_35136 124
261 3300046684 Ga0495669_0147012 Ga0495669_0147012_493_891 124
262 3300046690 Ga0495624_0005713 Ga0495624_0005713_1017_1415 124
263 3300046691 Ga0495670_0000660 Ga0495670_0000660_7689_8087 124
264 3300046691 Ga0495670_0004028 Ga0495670_0004028_3048_3446 124
265 3300046691 Ga0495670_0051006 Ga0495670_0051006_744_1142 124
266 3300046691 Ga0495670_0159014 Ga0495670_0159014_121_519 124
267 3300046692 Ga0495671_0000823 Ga0495671_0000823_19329_19730 124
268 3300047315 Ga0495581_0005991 Ga0495581_0005991_697_1095 124
269 3300047315 Ga0495581_0041603 Ga0495581_0041603_158_556 124
270 3300047443 Ga0495687_003849 Ga0495687_003849_5624_5998 124
271 3300047445 Ga0495677_0057866 Ga0495677_0057866_110_508 124
272 3300047445 Ga0495677_0061821 Ga0495677_0061821_622_1020 124
273 3300047470 Ga0495681_0085658 Ga0495681_0085658_760_1158 124
274 3300047673 Ga0495593_0107484 Ga0495593_0107484_671_1069 124
275 3300048091 Ga0495626_0006986 Ga0495626_0006986_4288_4686 124
276 3300048091 Ga0495626_0420381 Ga0495626_0420381_106_504 124
277 3300048909 Ga0496106_0002041 Ga0496106_0002041_3855_4247 124
278 3300049130 Ga0501310_033883 Ga0501310_033883_76_450 124
279 3300049822 Ga0501035_0002694 Ga0501035_0002694_569_964 124
280 3300061719 Ga0466962_0042073 Ga0466962_0042073_1322_1726 124
281 3300003771 Ga0055526_1000043 Ga0055526_100004370 125
282 3300025295 Ga0209564_1000010 Ga0209564_1000010314 125

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tuk-assembly1.cif.gz_A crystal structure of tetracycline destructase tet(51) 0.5305 85 114
5tuk-assembly3.cif.gz_C crystal structure of tetracycline destructase tet(51) 0.5265 85 114
5i4q-assembly1.cif.gz_A contact-dependent inhibition system from escherichia coli nc101 - ternary cdia/cdii/ef-tu complex (domains 2 and 3) 0.504 63 107
8f2u-assembly1.cif.gz_A human ccc complex 0.4895 29 60
8f2u-assembly1.cif.gz_D human ccc complex 0.4759 29 116
ID Description Score Start End Superfamily
af_I6YF08_25_141_3.30.565.40 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Fervidobacterium nodosum Rt17-B1 like 0.4883 29 120 3.30.565.40
6fk0B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.474 29 60 3.10.450.10
af_Q55FT0_10_134_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.4414 80 122 3.30.450.30
af_Q8I5J7_216_446_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.4409 81 120 2.130.10.10
af_Q9C0V7_457_542_3.30.1120.10 Alpha Beta;2-Layer Sandwich;Arylsulfatase, C-terminal domain; 0.4312 71 116 3.30.1120.10
ID Description Score Start End GO Terms
AF-A0A7W8YD92-F1-model_v4 Uncharacterized protein 0.9241 27 125
AF-A0A0K1K6F2-F1-model_v4 Uncharacterized protein 0.9193 28 125
AF-A0A853SZ24-F1-model_v4 Uncharacterized protein 0.9157 27 125
AF-A0A845HE78-F1-model_v4 DUF3617 family protein 0.9081 27 125
AF-A0A7Y6QP01-F1-model_v4 DUF3617 family protein 0.9079 27 125

Feature Viewer

pLDDT pTM Quality
80.19 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map