F384866

General Info

Members Datasets Scaffolds Average Seq Length
282 176 564 147

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100083629|Ga0075430_1000836293
Length 163
Sequence VSDTSKTGAQAPNAQRLAERVQQAMLARDTFSRWLGVDVIDIGPGTCTLTMTVRGEMLNGFGVAHGGIVFSVADSAFAFACNTHGRVTVSIENSITYPVAIREGDVLTAVAREEAASERLGYYRVDVTRQGGQLVGLFRGTAYRTLKEHFPPAPNEAAVPSPS

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
89 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
90 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
91 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
93 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
94 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
95 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
106 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
107 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
135 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
173 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.71
Rhizosphere 98.23
Stem 0
Stem Tuber 0
Unclassified 8.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100083629 3300006846 Bacteria 2674
2 Ga0065707_10625438 3300005295 Unclassified 676
3 Ga0070658_10461799 3300005327 Bacteria 1095
4 Ga0070676_10148622 3300005328 Bacteria 1498
5 Ga0070683_100012046 3300005329 Bacteria 7501
6 Ga0070683_100070939 3300005329 Bacteria 3250
7 Ga0070683_100103088 3300005329 Bacteria 2688
8 Ga0070683_100288548 3300005329 Bacteria 1561
9 Ga0070682_100244186 3300005337 Bacteria 1291
10 Ga0070691_10026787 3300005341 Bacteria 2688
11 Ga0070661_100829246 3300005344 Bacteria 760
12 Ga0070669_100411605 3300005353 Bacteria 1108
13 Ga0070688_100530863 3300005365 Bacteria 892
14 Ga0070709_10439437 3300005434 Bacteria 981
15 Ga0070711_100511516 3300005439 Unclassified 991
16 Ga0070711_101722961 3300005439 Bacteria 549
17 Ga0070694_100860473 3300005444 Unclassified 746
18 Ga0070681_10011535 3300005458 Bacteria 8748
19 Ga0070706_100186732 3300005467 Bacteria 1937
20 Ga0070698_100000575 3300005471 Bacteria 39403
21 Ga0070698_100013126 3300005471 Bacteria 8767
22 Ga0070699_100857868 3300005518 Bacteria 831
23 Ga0070679_100053528 3300005530 Bacteria 4017
24 Ga0070684_100020166 3300005535 Bacteria 5531
25 Ga0070684_100063993 3300005535 Bacteria 3226
26 Ga0070684_100151313 3300005535 Bacteria 2102
27 Ga0070684_100216549 3300005535 Bacteria 1746
28 Ga0070684_100596696 3300005535 Bacteria 1027
29 Ga0070684_100704099 3300005535 Bacteria 942
30 Ga0070696_100000366 3300005546 Bacteria 27619
31 Ga0070664_100077474 3300005564 Bacteria 2858
32 Ga0068852_100008675 3300005616 Bacteria 7510
33 Ga0068859_100199042 3300005617 Bacteria 2088
34 Ga0068864_100405902 3300005618 Bacteria 1295
35 Ga0068858_100665218 3300005842 Unclassified 1012
36 Ga0068862_100056818 3300005844 Bacteria 3354
37 Ga0068862_100790501 3300005844 Bacteria 926
38 Ga0070712_100180611 3300006175 Bacteria 1644
39 Ga0097621_100471302 3300006237 Bacteria 1134
40 Ga0097621_101513812 3300006237 Bacteria 637
41 Ga0075428_100009337 3300006844 Bacteria 10881
42 Ga0075428_101767056 3300006844 Unclassified 644
43 Ga0075430_100221378 3300006846 Bacteria 1570
44 Ga0075431_100198822 3300006847 Bacteria 2051
45 Ga0075431_100405413 3300006847 Bacteria 1364
46 Ga0075434_101795228 3300006871 Unclassified 620
47 Ga0075429_100811411 3300006880 Bacteria 819
48 Ga0068865_100643138 3300006881 Bacteria 901
49 Ga0097620_100199037 3300006931 Bacteria 2088
50 Ga0097620_101869323 3300006931 Bacteria 663
51 Ga0105240_11522742 3300009093 Bacteria 701
52 Ga0111539_11017136 3300009094 Unclassified 963
53 Ga0105245_11962653 3300009098 Bacteria 639
54 Ga0114129_10081998 3300009147 Bacteria 4483
55 Ga0114129_11084002 3300009147 Bacteria 1004
56 Ga0105241_10132314 3300009174 Bacteria 2021
57 Ga0105241_10485964 3300009174 Bacteria 1098
58 Ga0105241_10634900 3300009174 Bacteria 968
59 Ga0105237_10035134 3300009545 Bacteria 5073
60 Ga0105238_10206179 3300009551 Bacteria 1942
61 Ga0105238_10302893 3300009551 Bacteria 1582
62 Ga0105246_11924102 3300011119 Bacteria 568
63 Ga0157370_10051270 3300013104 Bacteria 3941
64 Ga0157369_10161729 3300013105 Bacteria 2363
65 Ga0157369_10501650 3300013105 Bacteria 1255
66 Ga0157369_11148926 3300013105 Unclassified 793
67 Ga0157369_11213388 3300013105 Bacteria 770
68 Ga0157378_10794984 3300013297 Bacteria 971
69 Ga0163162_10073988 3300013306 Bacteria 3465
70 Ga0157372_10009870 3300013307 Bacteria 10154
71 Ga0157372_10040198 3300013307 Bacteria 5164
72 Ga0157375_10408333 3300013308 Bacteria 1524
73 Ga0157375_10696405 3300013308 Bacteria 1170
74 Ga0157380_10754351 3300014326 Unclassified 985
75 Ga0157376_10502965 3300014969 Bacteria 1191
76 Ga0207692_10079435 3300025898 Bacteria 1750
77 Ga0207699_10312546 3300025906 Bacteria 1100
78 Ga0207684_10033277 3300025910 Bacteria 4383
79 Ga0207654_10123996 3300025911 Bacteria 1626
80 Ga0207707_10051785 3300025912 Bacteria 3575
81 Ga0207693_10042063 3300025915 Bacteria 3597
82 Ga0207693_10102735 3300025915 Bacteria 2242
83 Ga0207663_10389170 3300025916 Bacteria 1064
84 Ga0207660_10016747 3300025917 Bacteria 4860
85 Ga0207652_10004745 3300025921 Bacteria 11019
86 Ga0207652_10046832 3300025921 Bacteria 3692
87 Ga0207681_10860525 3300025923 Bacteria 758
88 Ga0207694_10491646 3300025924 Unclassified 1027
89 Ga0207700_10826380 3300025928 Bacteria 829
90 Ga0207700_10905384 3300025928 Unclassified 789
91 Ga0207664_10032872 3300025929 Bacteria 3980
92 Ga0207704_10184229 3300025938 Bacteria 1512
93 Ga0207691_10073182 3300025940 Bacteria 3090
94 Ga0207691_10946630 3300025940 Bacteria 720
95 Ga0207711_12016402 3300025941 Bacteria 520
96 Ga0207689_10654258 3300025942 Unclassified 885
97 Ga0207661_10183593 3300025944 Bacteria 1829
98 Ga0207661_10545119 3300025944 Bacteria 1062
99 Ga0207677_11766155 3300026023 Unclassified 574
100 Ga0207703_10418601 3300026035 Bacteria 1246
101 Ga0207648_10052441 3300026089 Bacteria 3566
102 Ga0207676_10342261 3300026095 Bacteria 1380
103 Ga0207676_11975578 3300026095 Bacteria 582
104 Ga0207698_10008472 3300026142 Bacteria 6508
105 Ga0207698_10056621 3300026142 Bacteria 3028
106 Ga0209969_1029903 3300027360 Bacteria 831
107 Ga0268265_10187930 3300028380 Bacteria 1781
108 Ga0268265_10223812 3300028380 Bacteria 1648
109 Ga0307517_10526272 3300028786 Bacteria 596
110 Ga0265327_10009830 3300031251 Bacteria 6833
111 Ga0307408_100178889 3300031548 Bacteria 1699
112 Ga0307408_100211252 3300031548 Bacteria 1577
113 Ga0307405_10088847 3300031731 Bacteria 2040
114 Ga0307405_10405478 3300031731 Bacteria 1068
115 Ga0307413_10018304 3300031824 Bacteria 3672
116 Ga0307413_10081637 3300031824 Bacteria 2074
117 Ga0307413_10378889 3300031824 Archaea 1101
118 Ga0307413_11137954 3300031824 Bacteria 676
119 Ga0307410_10036258 3300031852 Bacteria 3210
120 Ga0307410_10059383 3300031852 Bacteria 2610
121 Ga0307410_10412906 3300031852 Bacteria 1093
122 Ga0307406_10075410 3300031901 Bacteria 2225
123 Ga0307406_10078312 3300031901 Bacteria 2189
124 Ga0307406_10427564 3300031901 Bacteria 1057
125 Ga0307407_10195150 3300031903 Bacteria 1352
126 Ga0307412_10011900 3300031911 Bacteria 5053
127 Ga0307412_10021551 3300031911 Bacteria 3938
128 Ga0307416_100008773 3300032002 Bacteria 6553
129 Ga0307416_100048377 3300032002 Bacteria 3373
130 Ga0307416_100347335 3300032002 Bacteria 1499
131 Ga0307416_100919296 3300032002 Bacteria 976
132 Ga0307416_101946336 3300032002 Bacteria 691
133 Ga0307411_10035611 3300032005 Bacteria 3110
134 Ga0307411_10100621 3300032005 Bacteria 2043
135 Ga0307415_100045283 3300032126 Bacteria 2948
136 Ga0373926_0002092 3300035083 Bacteria 6288
137 Ga0373926_0051079 3300035083 Bacteria 1491
138 Ga0373934_0001169 3300035086 Bacteria 9581
139 Ga0373934_0003210 3300035086 Bacteria 5979
140 Ga0373944_0016713 3300035089 Bacteria 2073
141 Ga0373923_0028944 3300035111 Bacteria 2219
142 Ga0373953_0115993 3300035117 Bacteria 1135
143 Ga0373954_0198241 3300035118 Bacteria 986
144 Ga0373954_0261717 3300035118 Bacteria 852
145 Ga0373956_0236197 3300035119 Bacteria 868
146 Ga0373943_0004680 3300035170 Bacteria 6191
147 Ga0373955_0020388 3300035172 Bacteria 3332
148 Ga0373924_0206587 3300035410 Bacteria 867
149 Ga0373924_0317252 3300035410 Bacteria 693
150 Ga0373935_0001544 3300035692 Bacteria 12816
151 Ga0373935_0957671 3300035692 Bacteria 635
152 Ga0373933_0017032 3300035724 Bacteria 4074
153 Ga0373933_0525687 3300035724 Unclassified 776
154 Ga0373947_0025566 3300035725 Bacteria 3444
155 Ga0373947_0051224 3300035725 Bacteria 2484
156 Ga0373947_0315559 3300035725 Bacteria 1044
157 Ga0373937_0044606 3300036401 Bacteria 4050
158 Ga0373925_0001983 3300037068 Bacteria 16951
159 Ga0373925_0022165 3300037068 Bacteria 4632
160 Ga0395898_1050611 3300037466 Bacteria 749
161 Ga0436365_0200949 3300039437 Bacteria 6981
162 Ga0436365_0214667 3300039437 Unclassified 545
163 Ga0451807_1334692 3300041486 Bacteria 542
164 Ga0439446_0336518 3300042156 Bacteria 536
165 Ga0439434_0090413 3300042435 Bacteria 978
166 Ga0466970_0643942 3300044765 Unclassified 616
167 Ga0451576_1123813 3300045051 Bacteria 822
168 Ga0466967_0538540 3300045976 Bacteria 1148
169 Ga0466967_0919375 3300045976 Bacteria 870
170 Ga0466967_0989559 3300045976 Unclassified 837
171 Ga0466967_1061233 3300045976 Bacteria 807
172 Ga0495592_0021574 3300046454 Bacteria 4899
173 Ga0495592_0046750 3300046454 Bacteria 3226
174 Ga0495603_0017576 3300046455 Bacteria 4330
175 Ga0495629_0041097 3300046459 Bacteria 3254
176 Ga0495651_0004726 3300046462 Bacteria 10424
177 Ga0495651_0016060 3300046462 Bacteria 5798
178 Ga0495653_0009129 3300046463 Bacteria 8107
179 Ga0495653_0015136 3300046463 Bacteria 6288
180 Ga0495580_0000872 3300046472 Bacteria 26075
181 Ga0495580_0009666 3300046472 Bacteria 7570
182 Ga0495580_0385273 3300046472 Bacteria 947
183 Ga0495582_0024365 3300046473 Bacteria 3310
184 Ga0495639_0001230 3300046475 Bacteria 11550
185 Ga0495639_0003326 3300046475 Bacteria 6967
186 Ga0495664_0011288 3300046477 Bacteria 5034
187 Ga0495664_0050198 3300046477 Bacteria 2477
188 Ga0495594_0028624 3300046499 Bacteria 3008
189 Ga0495608_0017077 3300046511 Bacteria 5022
190 Ga0495608_0028053 3300046511 Bacteria 3827
191 Ga0495608_0499758 3300046511 Unclassified 736
192 Ga0495618_0053682 3300046514 Bacteria 2548
193 Ga0495628_0018040 3300046516 Bacteria 5853
194 Ga0495628_0304388 3300046516 Bacteria 1179
195 Ga0495630_0122096 3300046517 Bacteria 1976
196 Ga0495630_0246982 3300046517 Bacteria 1363
197 Ga0495666_0248960 3300046526 Bacteria 810
198 Ga0495652_0027905 3300046529 Bacteria 4972
199 Ga0495665_0000362 3300046531 Bacteria 22903
200 Ga0495665_0023806 3300046531 Bacteria 3290
201 Ga0495665_0136508 3300046531 Bacteria 1283
202 Ga0495640_0195645 3300046533 Bacteria 1284
203 Ga0495586_0007005 3300046535 Bacteria 6008
204 Ga0495586_0306962 3300046535 Bacteria 909
205 Ga0495587_0005403 3300046536 Bacteria 8343
206 Ga0495587_0056396 3300046536 Bacteria 2311
207 Ga0495645_0014336 3300046543 Bacteria 5621
208 Ga0495645_0021916 3300046543 Bacteria 4620
209 Ga0495645_0072939 3300046543 Bacteria 2473
210 Ga0495667_0001793 3300046559 Bacteria 14245
211 Ga0495667_0015731 3300046559 Bacteria 5114
212 Ga0495667_0290682 3300046559 Bacteria 1036
213 Ga0495635_0007704 3300046663 Bacteria 7513
214 Ga0495635_0121193 3300046663 Bacteria 1784
215 Ga0495635_0127610 3300046663 Bacteria 1734
216 Ga0495659_0104922 3300046664 Bacteria 1098
217 Ga0495588_0001104 3300046674 Bacteria 11636
218 Ga0495588_0510110 3300046674 Unclassified 630
219 Ga0495657_0031914 3300046675 Bacteria 3679
220 Ga0495657_0044331 3300046675 Bacteria 3026
221 Ga0495599_0004250 3300046678 Bacteria 8461
222 Ga0495623_0019643 3300046679 Bacteria 4367
223 Ga0495646_0011076 3300046680 Bacteria 5726
224 Ga0495646_0086178 3300046680 Bacteria 1822
225 Ga0495646_0251529 3300046680 Bacteria 946
226 Ga0495658_0090025 3300046683 Bacteria 1815
227 Ga0495613_0033184 3300046689 Bacteria 3836
228 Ga0495613_0051411 3300046689 Bacteria 3037
229 Ga0495613_1041100 3300046689 Bacteria 524
230 Ga0495600_0001245 3300046809 Bacteria 13999
231 Ga0495581_0006856 3300047315 Bacteria 6605
232 Ga0495581_0155035 3300047315 Bacteria 1338
233 Ga0495581_0244976 3300047315 Bacteria 1048
234 Ga0495604_0019932 3300047317 Bacteria 5362
235 Ga0495604_0120773 3300047317 Bacteria 1897
236 Ga0495674_0077604 3300047319 Bacteria 2855
237 Ga0495674_0160216 3300047319 Bacteria 1883
238 Ga0495676_0137308 3300047321 Bacteria 1757
239 Ga0495680_0384620 3300047322 Bacteria 971
240 Ga0495680_0867324 3300047322 Bacteria 585
241 Ga0495675_0007585 3300047444 Bacteria 6690
242 Ga0495675_0018372 3300047444 Bacteria 4438
243 Ga0495684_0005178 3300047471 Bacteria 10163
244 Ga0495684_0038127 3300047471 Bacteria 3685
245 Ga0495684_0063134 3300047471 Bacteria 2816
246 Ga0495593_0000896 3300047673 Bacteria 17308
247 Ga0495593_0083528 3300047673 Bacteria 1650
248 Ga0495602_0032548 3300048088 Bacteria 4907
249 Ga0495602_0177149 3300048088 Bacteria 1648
250 Ga0495614_0033786 3300048089 Bacteria 2199
251 Ga0496104_0122362 3300048907 Bacteria 2498
252 Ga0501298_060076 3300049521 Bacteria 804
253 Ga0501036_0114108 3300049572 Bacteria 2283
254 Ga0501038_0016186 3300049574 Bacteria 6765
255 Ga0501043_0120193 3300049579 Bacteria 2060
256 Ga0501075_0412215 3300049591 Bacteria 1030
257 Ga0501260_054993 3300049689 Unclassified 509
258 Ga0501079_0910870 3300049741 Bacteria 692
259 Ga0501079_1293264 3300049741 Unclassified 574
260 Ga0501081_0234935 3300049743 Bacteria 1336
261 Ga0501270_069390 3300049767 Unclassified 678
262 Ga0501035_0011037 3300049822 Bacteria 8365
263 Ga0501044_0159167 3300049823 Bacteria 2236
264 Ga0501044_0923430 3300049823 Bacteria 747
265 nmdc:mga05p37_1179757_c1 3300050507 Unclassified 793
266 nmdc:mga09592_561733_c1 3300050508 Bacteria 980
267 nmdc:mga09592_876285_c1 3300050508 Bacteria 756
268 nmdc:mga09592_99821_c1 3300050508 Bacteria 2485
269 nmdc:mga0qj67_149686_c1 3300050509 Bacteria 1893
270 nmdc:mga0qj67_57957_c1 3300050509 Bacteria 3071
271 nmdc:mga0qj67_75833_c1 3300050509 Bacteria 2688
272 nmdc:mga06r32_1023432_c1 3300050510 Bacteria 778
273 nmdc:mga06r32_316425_c1 3300050510 Bacteria 1546
274 nmdc:mga08y16_599665_c1 3300050511 Bacteria 1110
275 nmdc:mga0n895_732927_c1 3300050512 Unclassified 982
276 nmdc:mga0rr50_1240542_c1 3300050513 Bacteria 633
277 Ga0495612_0050793 3300053078 Bacteria 1703
278 Ga0495595_0256477 3300053084 Bacteria 876
279 Ga0495619_0011107 3300053085 Bacteria 5664
280 Ga0495619_0092476 3300053085 Bacteria 2049
281 Ga0501082_0064381 3300060353 Bacteria 3158
282 Ga0530510_0480434 3300061734 Bacteria 941
283 Ga0075430_100083629
284 Ga0065707_10625438
285 Ga0070658_10461799
286 Ga0070676_10148622
287 Ga0070683_100012046
288 Ga0070683_100070939
289 Ga0070683_100103088
290 Ga0070683_100288548
291 Ga0070682_100244186
292 Ga0070691_10026787
293 Ga0070661_100829246
294 Ga0070669_100411605
295 Ga0070688_100530863
296 Ga0070709_10439437
297 Ga0070711_100511516
298 Ga0070711_101722961
299 Ga0070694_100860473
300 Ga0070681_10011535
301 Ga0070706_100186732
302 Ga0070698_100000575
303 Ga0070698_100013126
304 Ga0070699_100857868
305 Ga0070679_100053528
306 Ga0070684_100020166
307 Ga0070684_100063993
308 Ga0070684_100151313
309 Ga0070684_100216549
310 Ga0070684_100596696
311 Ga0070684_100704099
312 Ga0070696_100000366
313 Ga0070664_100077474
314 Ga0068852_100008675
315 Ga0068859_100199042
316 Ga0068864_100405902
317 Ga0068858_100665218
318 Ga0068862_100056818
319 Ga0068862_100790501
320 Ga0070712_100180611
321 Ga0097621_100471302
322 Ga0097621_101513812
323 Ga0075428_100009337
324 Ga0075428_101767056
325 Ga0075430_100221378
326 Ga0075431_100198822
327 Ga0075431_100405413
328 Ga0075434_101795228
329 Ga0075429_100811411
330 Ga0068865_100643138
331 Ga0097620_100199037
332 Ga0097620_101869323
333 Ga0105240_11522742
334 Ga0111539_11017136
335 Ga0105245_11962653
336 Ga0114129_10081998
337 Ga0114129_11084002
338 Ga0105241_10132314
339 Ga0105241_10485964
340 Ga0105241_10634900
341 Ga0105237_10035134
342 Ga0105238_10206179
343 Ga0105238_10302893
344 Ga0105246_11924102
345 Ga0157370_10051270
346 Ga0157369_10161729
347 Ga0157369_10501650
348 Ga0157369_11148926
349 Ga0157369_11213388
350 Ga0157378_10794984
351 Ga0163162_10073988
352 Ga0157372_10009870
353 Ga0157372_10040198
354 Ga0157375_10408333
355 Ga0157375_10696405
356 Ga0157380_10754351
357 Ga0157376_10502965
358 Ga0207692_10079435
359 Ga0207699_10312546
360 Ga0207684_10033277
361 Ga0207654_10123996
362 Ga0207707_10051785
363 Ga0207693_10042063
364 Ga0207693_10102735
365 Ga0207663_10389170
366 Ga0207660_10016747
367 Ga0207652_10004745
368 Ga0207652_10046832
369 Ga0207681_10860525
370 Ga0207694_10491646
371 Ga0207700_10826380
372 Ga0207700_10905384
373 Ga0207664_10032872
374 Ga0207704_10184229
375 Ga0207691_10073182
376 Ga0207691_10946630
377 Ga0207711_12016402
378 Ga0207689_10654258
379 Ga0207661_10183593
380 Ga0207661_10545119
381 Ga0207677_11766155
382 Ga0207703_10418601
383 Ga0207648_10052441
384 Ga0207676_10342261
385 Ga0207676_11975578
386 Ga0207698_10008472
387 Ga0207698_10056621
388 Ga0209969_1029903
389 Ga0268265_10187930
390 Ga0268265_10223812
391 Ga0307517_10526272
392 Ga0265327_10009830
393 Ga0307408_100178889
394 Ga0307408_100211252
395 Ga0307405_10088847
396 Ga0307405_10405478
397 Ga0307413_10018304
398 Ga0307413_10081637
399 Ga0307413_10378889
400 Ga0307413_11137954
401 Ga0307410_10036258
402 Ga0307410_10059383
403 Ga0307410_10412906
404 Ga0307406_10075410
405 Ga0307406_10078312
406 Ga0307406_10427564
407 Ga0307407_10195150
408 Ga0307412_10011900
409 Ga0307412_10021551
410 Ga0307416_100008773
411 Ga0307416_100048377
412 Ga0307416_100347335
413 Ga0307416_100919296
414 Ga0307416_101946336
415 Ga0307411_10035611
416 Ga0307411_10100621
417 Ga0307415_100045283
418 Ga0373926_0002092
419 Ga0373926_0051079
420 Ga0373934_0001169
421 Ga0373934_0003210
422 Ga0373944_0016713
423 Ga0373923_0028944
424 Ga0373953_0115993
425 Ga0373954_0198241
426 Ga0373954_0261717
427 Ga0373956_0236197
428 Ga0373943_0004680
429 Ga0373955_0020388
430 Ga0373924_0206587
431 Ga0373924_0317252
432 Ga0373935_0001544
433 Ga0373935_0957671
434 Ga0373933_0017032
435 Ga0373933_0525687
436 Ga0373947_0025566
437 Ga0373947_0051224
438 Ga0373947_0315559
439 Ga0373937_0044606
440 Ga0373925_0001983
441 Ga0373925_0022165
442 Ga0395898_1050611
443 Ga0436365_0200949
444 Ga0436365_0214667
445 Ga0451807_1334692
446 Ga0439446_0336518
447 Ga0439434_0090413
448 Ga0466970_0643942
449 Ga0451576_1123813
450 Ga0466967_0538540
451 Ga0466967_0919375
452 Ga0466967_0989559
453 Ga0466967_1061233
454 Ga0495592_0021574
455 Ga0495592_0046750
456 Ga0495603_0017576
457 Ga0495629_0041097
458 Ga0495651_0004726
459 Ga0495651_0016060
460 Ga0495653_0009129
461 Ga0495653_0015136
462 Ga0495580_0000872
463 Ga0495580_0009666
464 Ga0495580_0385273
465 Ga0495582_0024365
466 Ga0495639_0001230
467 Ga0495639_0003326
468 Ga0495664_0011288
469 Ga0495664_0050198
470 Ga0495594_0028624
471 Ga0495608_0017077
472 Ga0495608_0028053
473 Ga0495608_0499758
474 Ga0495618_0053682
475 Ga0495628_0018040
476 Ga0495628_0304388
477 Ga0495630_0122096
478 Ga0495630_0246982
479 Ga0495666_0248960
480 Ga0495652_0027905
481 Ga0495665_0000362
482 Ga0495665_0023806
483 Ga0495665_0136508
484 Ga0495640_0195645
485 Ga0495586_0007005
486 Ga0495586_0306962
487 Ga0495587_0005403
488 Ga0495587_0056396
489 Ga0495645_0014336
490 Ga0495645_0021916
491 Ga0495645_0072939
492 Ga0495667_0001793
493 Ga0495667_0015731
494 Ga0495667_0290682
495 Ga0495635_0007704
496 Ga0495635_0121193
497 Ga0495635_0127610
498 Ga0495659_0104922
499 Ga0495588_0001104
500 Ga0495588_0510110
501 Ga0495657_0031914
502 Ga0495657_0044331
503 Ga0495599_0004250
504 Ga0495623_0019643
505 Ga0495646_0011076
506 Ga0495646_0086178
507 Ga0495646_0251529
508 Ga0495658_0090025
509 Ga0495613_0033184
510 Ga0495613_0051411
511 Ga0495613_1041100
512 Ga0495600_0001245
513 Ga0495581_0006856
514 Ga0495581_0155035
515 Ga0495581_0244976
516 Ga0495604_0019932
517 Ga0495604_0120773
518 Ga0495674_0077604
519 Ga0495674_0160216
520 Ga0495676_0137308
521 Ga0495680_0384620
522 Ga0495680_0867324
523 Ga0495675_0007585
524 Ga0495675_0018372
525 Ga0495684_0005178
526 Ga0495684_0038127
527 Ga0495684_0063134
528 Ga0495593_0000896
529 Ga0495593_0083528
530 Ga0495602_0032548
531 Ga0495602_0177149
532 Ga0495614_0033786
533 Ga0496104_0122362
534 Ga0501298_060076
535 Ga0501036_0114108
536 Ga0501038_0016186
537 Ga0501043_0120193
538 Ga0501075_0412215
539 Ga0501260_054993
540 Ga0501079_0910870
541 Ga0501079_1293264
542 Ga0501081_0234935
543 Ga0501270_069390
544 Ga0501035_0011037
545 Ga0501044_0159167
546 Ga0501044_0923430
547 nmdc:mga05p37_1179757_c1
548 nmdc:mga09592_561733_c1
549 nmdc:mga09592_876285_c1
550 nmdc:mga09592_99821_c1
551 nmdc:mga0qj67_149686_c1
552 nmdc:mga0qj67_57957_c1
553 nmdc:mga0qj67_75833_c1
554 nmdc:mga06r32_1023432_c1
555 nmdc:mga06r32_316425_c1
556 nmdc:mga08y16_599665_c1
557 nmdc:mga0n895_732927_c1
558 nmdc:mga0rr50_1240542_c1
559 Ga0495612_0050793
560 Ga0495595_0256477
561 Ga0495619_0011107
562 Ga0495619_0092476
563 Ga0501082_0064381
564 Ga0530510_0480434

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

61

136

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wlu-assembly1.cif.gz_A crystal structure of tt0310 protein from thermus thermophilus hb8 0.9603 20 136
2dsl-assembly1.cif.gz_A mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 0.9573 20 136
2fs2-assembly1.cif.gz_B structure of the e. coli paai protein from the phyenylacetic acid degradation operon 0.9527 4 139
2dsl-assembly1.cif.gz_A mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 0.9492 20 136
4xy5-assembly1.cif.gz_A crystal structure of mutant (asp52ala) hypothetical thioesterase protein sp_1851 from streptococcus pneumoniae tigr4 0.9388 28 136
ID Description Score Start End Superfamily
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9603 20 136 3.10.129.10
2fs2B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9485 4 139 3.10.129.10
4xy5A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9388 28 136 3.10.129.10
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9365 20 136 3.10.129.10
af_A0A1D6K9H0_1_80_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9323 78 137 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7Y4RTC7-F1-model_v4 Hydroxyphenylacetyl-CoA thioesterase PaaI 0.9757 2 140 GO:0016289
AF-A0A0C1LIL7-F1-model_v4 Thioesterase 0.9751 9 139 GO:0016289
AF-A0A838T232-F1-model_v4 Hydroxyphenylacetyl-CoA thioesterase PaaI 0.9739 17 142 GO:0016289
AF-A0A4P5WEW1-F1-model_v4 Thioesterase domain-containing protein 0.9719 5 142 GO:0016289
AF-A0A437QWI7-F1-model_v4 Hydroxyphenylacetyl-CoA thioesterase PaaI 0.9701 5 139 GO:0016289

Map