F384862

General Info

Members Datasets Scaffolds Average Seq Length
282 169 564 189

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100016844|Ga0075428_1000168444
Length 214
Sequence MPRFARSVMNRECSLIDWILERREGMRLRGWLGMVLTSVALPLGVAAQAPAAGPLTLTTTAFPDGGQIPAKHTQAGDQISPALTWTNVPPGTVSFVLHMRDPDVARNKTTEDQVHWLVWNIPGTATGMPEGVPKGPELKDGSRQISASGPVYRGPGAPANGPMHHYTFELYALDTKVDLPAGADAWETRTAVWKVMQDHVLGKAVYVGLFRRPQ

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.42
Rhizosphere 97.87
Stem 0
Stem Tuber 0
Unclassified 18.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100016844 3300006844 Bacteria 8073
2 JGI25406J46586_10003163 3300003203 Bacteria 7742
3 JGI25406J46586_10024610 3300003203 Bacteria 2355
4 Ga0065715_10238486 3300005293 Bacteria 1208
5 Ga0065707_10296028 3300005295 Bacteria 1010
6 Ga0070676_10190465 3300005328 Bacteria 1339
7 Ga0070690_100296501 3300005330 Bacteria 1158
8 Ga0070670_100030096 3300005331 Bacteria 4675
9 Ga0070670_100152977 3300005331 Bacteria 1997
10 Ga0070670_100307455 3300005331 Unclassified 1387
11 Ga0070677_10166988 3300005333 Bacteria 1037
12 Ga0070677_10277389 3300005333 Bacteria 843
13 Ga0068869_100139287 3300005334 Bacteria 1872
14 Ga0068869_100314680 3300005334 Unclassified 1268
15 Ga0070666_10038798 3300005335 Bacteria 3171
16 Ga0068868_100057669 3300005338 Bacteria 3068
17 Ga0070689_100876768 3300005340 Bacteria 793
18 Ga0070668_100120762 3300005347 Unclassified 2094
19 Ga0070669_100045101 3300005353 Bacteria 3212
20 Ga0070669_100076243 3300005353 Bacteria 2488
21 Ga0070669_100212731 3300005353 Bacteria 1526
22 Ga0070669_100366976 3300005353 Bacteria 1172
23 Ga0070675_100012154 3300005354 Bacteria 6750
24 Ga0070675_100017908 3300005354 Bacteria 5635
25 Ga0070675_100077307 3300005354 Unclassified 2770
26 Ga0070675_100450302 3300005354 Bacteria 1154
27 Ga0070671_100103218 3300005355 Unclassified 2392
28 Ga0070671_100311965 3300005355 Bacteria 1340
29 Ga0070674_100005790 3300005356 Bacteria 7175
30 Ga0070674_100125503 3300005356 Bacteria 1905
31 Ga0070673_100023484 3300005364 Bacteria 4505
32 Ga0070673_100632637 3300005364 Unclassified 978
33 Ga0070688_100081675 3300005365 Bacteria 2094
34 Ga0070667_100678753 3300005367 Bacteria 952
35 Ga0070667_101409028 3300005367 Bacteria 654
36 Ga0070700_100068149 3300005441 Unclassified 2262
37 Ga0070700_100088006 3300005441 Bacteria 2020
38 Ga0070700_100261809 3300005441 Bacteria 1246
39 Ga0070700_100466564 3300005441 Bacteria 964
40 Ga0070700_100532011 3300005441 Bacteria 910
41 Ga0070708_100040676 3300005445 Bacteria 4072
42 Ga0070678_100494288 3300005456 Bacteria 1078
43 Ga0070662_100500013 3300005457 Bacteria 1014
44 Ga0068867_100054198 3300005459 Bacteria 2962
45 Ga0068867_100455759 3300005459 Unclassified 1091
46 Ga0068867_100488289 3300005459 Bacteria 1056
47 Ga0070707_101160959 3300005468 Bacteria 738
48 Ga0070698_100310419 3300005471 Bacteria 1508
49 Ga0070699_100021546 3300005518 Bacteria 5558
50 Ga0070672_100019760 3300005543 Bacteria 4897
51 Ga0070686_100027536 3300005544 Bacteria 3440
52 Ga0070686_100407548 3300005544 Bacteria 1035
53 Ga0070695_100301881 3300005545 Bacteria 1184
54 Ga0070665_100049030 3300005548 Bacteria 4239
55 Ga0070704_100711343 3300005549 Unclassified 892
56 Ga0070664_101109946 3300005564 Bacteria 745
57 Ga0068857_100730751 3300005577 Bacteria 942
58 Ga0068852_100606512 3300005616 Unclassified 1099
59 Ga0068859_100095976 3300005617 Bacteria 3018
60 Ga0068859_100309366 3300005617 Bacteria 1674
61 Ga0068859_100371883 3300005617 Bacteria 1525
62 Ga0068859_101863202 3300005617 Unclassified 664
63 Ga0068864_100138527 3300005618 Bacteria 2193
64 Ga0068864_100160272 3300005618 Bacteria 2045
65 Ga0068866_10193533 3300005718 Bacteria 1210
66 Ga0068861_100163276 3300005719 Bacteria 1839
67 Ga0068870_10036805 3300005840 Bacteria 2519
68 Ga0068870_10252242 3300005840 Bacteria 1094
69 Ga0068863_101079857 3300005841 Unclassified 807
70 Ga0068860_100143240 3300005843 Unclassified 2298
71 Ga0068862_100564878 3300005844 Bacteria 1088
72 Ga0068862_100782196 3300005844 Bacteria 931
73 Ga0081539_10000010 3300005985 Bacteria 484386
74 Ga0081539_10000237 3300005985 Bacteria 129370
75 Ga0081539_10005535 3300005985 Bacteria 12807
76 Ga0097621_100015861 3300006237 Bacteria 5681
77 Ga0097621_100950598 3300006237 Bacteria 802
78 Ga0068871_100022262 3300006358 Bacteria 4886
79 Ga0075428_100024860 3300006844 Bacteria 6626
80 Ga0075428_100194640 3300006844 Bacteria 2193
81 Ga0075428_100944804 3300006844 Bacteria 914
82 Ga0075428_101245944 3300006844 Bacteria 783
83 Ga0075430_100218806 3300006846 Unclassified 1580
84 Ga0075430_100374981 3300006846 Bacteria 1174
85 Ga0075431_100063637 3300006847 Bacteria 3807
86 Ga0075433_10183255 3300006852 Unclassified 1863
87 Ga0075434_100304710 3300006871 Bacteria 1613
88 Ga0075434_101252348 3300006871 Unclassified 753
89 Ga0075429_100155438 3300006880 Bacteria 2003
90 Ga0075429_100182928 3300006880 Unclassified 1836
91 Ga0068865_100046492 3300006881 Bacteria 2978
92 Ga0068865_100103617 3300006881 Unclassified 2087
93 Ga0097620_100095979 3300006931 Bacteria 3018
94 Ga0097620_100309364 3300006931 Bacteria 1674
95 Ga0097620_100371910 3300006931 Bacteria 1525
96 Ga0097620_101863245 3300006931 Unclassified 664
97 Ga0099794_10147158 3300007265 Bacteria 1195
98 Ga0105240_10344188 3300009093 Bacteria 1693
99 Ga0111539_10013813 3300009094 Bacteria 10091
100 Ga0111539_10023024 3300009094 Bacteria 7650
101 Ga0111539_10075508 3300009094 Bacteria 3970
102 Ga0111539_10428890 3300009094 Bacteria 1540
103 Ga0111539_11178584 3300009094 Bacteria 890
104 Ga0111539_11979151 3300009094 Unclassified 676
105 Ga0105245_10006743 3300009098 Bacteria 10071
106 Ga0105245_10010587 3300009098 Bacteria 8024
107 Ga0105245_10534460 3300009098 Bacteria 1193
108 Ga0114129_10002128 3300009147 Bacteria 27300
109 Ga0114129_10508942 3300009147 Bacteria 1571
110 Ga0114129_10629701 3300009147 Bacteria 1387
111 Ga0105243_11468192 3300009148 Bacteria 705
112 Ga0105242_10007280 3300009176 Bacteria 8534
113 Ga0105242_10318050 3300009176 Unclassified 1427
114 Ga0105237_10117046 3300009545 Unclassified 2658
115 Ga0105249_10322599 3300009553 Bacteria 1556
116 Ga0157374_10413762 3300013296 Bacteria 1346
117 Ga0157374_10976795 3300013296 Unclassified 866
118 Ga0157378_10038262 3300013297 Unclassified 4251
119 Ga0157378_10199677 3300013297 Bacteria 1891
120 Ga0157378_10667624 3300013297 Bacteria 1056
121 Ga0163162_10025248 3300013306 Bacteria 5871
122 Ga0157375_10073415 3300013308 Bacteria 3440
123 Ga0163163_10401180 3300014325 Unclassified 1429
124 Ga0163163_10687960 3300014325 Unclassified 1086
125 Ga0163163_11512722 3300014325 Unclassified 732
126 Ga0157380_10009125 3300014326 Bacteria 7091
127 Ga0157380_10091387 3300014326 Bacteria 2513
128 Ga0157380_10181051 3300014326 Unclassified 1851
129 Ga0157380_10472005 3300014326 Bacteria 1211
130 Ga0157380_10914592 3300014326 Bacteria 904
131 Ga0157377_10030813 3300014745 Bacteria 2909
132 Ga0157379_10388662 3300014968 Unclassified 1281
133 Ga0157376_10050576 3300014969 Bacteria 3448
134 Ga0157376_10329769 3300014969 Bacteria 1454
135 Ga0163161_10268191 3300017792 Bacteria 1335
136 Ga0213875_10143645 3300021388 Bacteria 1117
137 Ga0207642_10134493 3300025899 Bacteria 1295
138 Ga0207645_10030248 3300025907 Bacteria 3489
139 Ga0207645_10649279 3300025907 Unclassified 717
140 Ga0207643_10020977 3300025908 Bacteria 3587
141 Ga0207643_10057175 3300025908 Bacteria 2220
142 Ga0207643_10114574 3300025908 Unclassified 1591
143 Ga0207695_10414975 3300025913 Bacteria 1230
144 Ga0207671_10029451 3300025914 Unclassified 4099
145 Ga0207681_10021390 3300025923 Bacteria 4111
146 Ga0207681_10068523 3300025923 Bacteria 2465
147 Ga0207681_10178775 3300025923 Bacteria 1614
148 Ga0207681_10323126 3300025923 Bacteria 1228
149 Ga0207650_10016930 3300025925 Bacteria 5099
150 Ga0207650_10118647 3300025925 Bacteria 2057
151 Ga0207650_10427720 3300025925 Bacteria 1099
152 Ga0207659_10058835 3300025926 Bacteria 2760
153 Ga0207659_10286224 3300025926 Unclassified 1349
154 Ga0207659_10327045 3300025926 Bacteria 1266
155 Ga0207687_10070251 3300025927 Bacteria 2499
156 Ga0207687_10135779 3300025927 Bacteria 1860
157 Ga0207664_10658478 3300025929 Unclassified 941
158 Ga0207644_10070923 3300025931 Bacteria 2548
159 Ga0207644_10306257 3300025931 Bacteria 1282
160 Ga0207686_10210849 3300025934 Bacteria 1396
161 Ga0207686_10224999 3300025934 Unclassified 1357
162 Ga0207709_11041913 3300025935 Bacteria 670
163 Ga0207669_10015340 3300025937 Bacteria 3862
164 Ga0207669_10299641 3300025937 Unclassified 1221
165 Ga0207704_10009202 3300025938 Bacteria 4756
166 Ga0207704_10375734 3300025938 Bacteria 1114
167 Ga0207691_10030789 3300025940 Bacteria 5012
168 Ga0207691_10158793 3300025940 Bacteria 1985
169 Ga0207689_10048720 3300025942 Bacteria 3495
170 Ga0207689_10118674 3300025942 Bacteria 2176
171 Ga0207679_10373301 3300025945 Bacteria 1249
172 Ga0207679_10501845 3300025945 Bacteria 1083
173 Ga0207651_10522098 3300025960 Bacteria 1029
174 Ga0207651_10561729 3300025960 Unclassified 993
175 Ga0207712_10366731 3300025961 Bacteria 1201
176 Ga0207668_10069367 3300025972 Bacteria 2510
177 Ga0207668_10185873 3300025972 Bacteria 1643
178 Ga0207668_11206401 3300025972 Bacteria 680
179 Ga0207658_10516836 3300025986 Bacteria 1065
180 Ga0207703_10455729 3300026035 Bacteria 1195
181 Ga0207708_10208953 3300026075 Bacteria 1560
182 Ga0207648_10017381 3300026089 Bacteria 6545
183 Ga0207648_10177371 3300026089 Bacteria 1885
184 Ga0207648_10196694 3300026089 Bacteria 1788
185 Ga0207648_10618575 3300026089 Bacteria 999
186 Ga0207648_10622517 3300026089 Bacteria 996
187 Ga0207676_10090944 3300026095 Bacteria 2506
188 Ga0207683_10010809 3300026121 Bacteria 7783
189 Ga0207683_10152877 3300026121 Bacteria 2083
190 Ga0207683_10456480 3300026121 Bacteria 1178
191 Ga0207428_10033237 3300027907 Unclassified 4238
192 Ga0207428_10050471 3300027907 Bacteria 3328
193 Ga0268266_10592632 3300028379 Bacteria 1064
194 Ga0268265_10457585 3300028380 Bacteria 1193
195 Ga0268265_11082341 3300028380 Bacteria 795
196 Ga0268264_10087421 3300028381 Unclassified 2680
197 Ga0268264_10936881 3300028381 Bacteria 871
198 Ga0265338_10186909 3300028800 Bacteria 1574
199 Ga0265338_10345081 3300028800 Bacteria 1072
200 Ga0265770_1010649 3300030878 Bacteria 1338
201 Ga0265760_10160658 3300031090 Unclassified 741
202 Ga0265332_10290040 3300031238 Unclassified 676
203 Ga0265325_10091112 3300031241 Bacteria 1503
204 Ga0265329_10111640 3300031242 Unclassified 874
205 Ga0265316_10066015 3300031344 Bacteria 2801
206 Ga0307408_100016256 3300031548 Bacteria 4964
207 Ga0307410_10685629 3300031852 Bacteria 862
208 Ga0307407_10428742 3300031903 Bacteria 955
209 Ga0307412_10445698 3300031911 Bacteria 1065
210 Ga0307409_101152191 3300031995 Bacteria 798
211 Ga0307416_100032369 3300032002 Bacteria 3950
212 Ga0307416_101705046 3300032002 Bacteria 735
213 Ga0307414_10141413 3300032004 Bacteria 1885
214 Ga0373933_0000430 3300035724 Bacteria 26421
215 Ga0373937_0000207 3300036401 Bacteria 56741
216 Ga0436364_0918732 3300037853 Bacteria 8035
217 Ga0451807_1438550 3300041486 Bacteria 1275
218 Ga0466957_1009596 3300044842 Unclassified 598
219 Ga0466958_0179100 3300045836 Bacteria 1345
220 Ga0495592_0001450 3300046454 Bacteria 16473
221 Ga0495651_0002632 3300046462 Bacteria 13902
222 Ga0495651_0011834 3300046462 Bacteria 6708
223 Ga0495653_0023488 3300046463 Bacteria 4980
224 Ga0495653_0279024 3300046463 Bacteria 1097
225 Ga0495582_0016593 3300046473 Bacteria 4032
226 Ga0495664_0155781 3300046477 Unclassified 1386
227 Ga0495608_0001162 3300046511 Bacteria 18628
228 Ga0495608_0143196 3300046511 Bacteria 1525
229 Ga0495608_0332856 3300046511 Bacteria 936
230 Ga0495618_0008996 3300046514 Bacteria 6027
231 Ga0495628_0000647 3300046516 Bacteria 31863
232 Ga0495628_0336850 3300046516 Bacteria 1111
233 Ga0495630_0105101 3300046517 Unclassified 2137
234 Ga0495643_0058501 3300046522 Bacteria 2051
235 Ga0495652_0008382 3300046529 Bacteria 9439
236 Ga0495586_0087214 3300046535 Bacteria 1721
237 Ga0495587_0000145 3300046536 Bacteria 52947
238 Ga0495587_0001504 3300046536 Bacteria 15501
239 Ga0495587_0111370 3300046536 Bacteria 1572
240 Ga0495645_0020983 3300046543 Bacteria 4720
241 Ga0495622_0003075 3300046557 Bacteria 7911
242 Ga0495667_0001173 3300046559 Bacteria 17117
243 Ga0495656_0322616 3300046615 Bacteria 796
244 Ga0495634_0026430 3300046642 Unclassified 4051
245 Ga0495657_0018243 3300046675 Bacteria 5084
246 Ga0495657_0160751 3300046675 Bacteria 1390
247 Ga0495657_0177289 3300046675 Bacteria 1310
248 Ga0495599_0048881 3300046678 Bacteria 2652
249 Ga0495623_0059300 3300046679 Bacteria 2404
250 Ga0495613_0061476 3300046689 Unclassified 2750
251 Ga0495600_0036791 3300046809 Bacteria 3181
252 Ga0495604_0042873 3300047317 Bacteria 3544
253 Ga0495604_0069152 3300047317 Unclassified 2677
254 Ga0495674_0097767 3300047319 Unclassified 2500
255 Ga0495680_0010509 3300047322 Bacteria 8260
256 Ga0495675_0002029 3300047444 Bacteria 12097
257 Ga0495675_0002661 3300047444 Bacteria 10701
258 Ga0495684_0003791 3300047471 Bacteria 11783
259 Ga0495602_0000224 3300048088 Bacteria 52889
260 Ga0495602_0078096 3300048088 Bacteria 2797
261 Ga0496104_0566221 3300048907 Bacteria 1047
262 Ga0496112_0069305 3300048915 Bacteria 3484
263 Ga0496114_0183507 3300048917 Bacteria 1828
264 Ga0501081_0112217 3300049743 Unclassified 1935
265 Ga0501083_0156852 3300049744 Bacteria 1490
266 Ga0501035_0263516 3300049822 Bacteria 1460
267 Ga0501044_0234154 3300049823 Unclassified 1783
268 Ga0501045_0341398 3300049824 Bacteria 1115
269 nmdc:mga05p37_227607_c1 3300050507 Bacteria 2248
270 nmdc:mga05p37_434354_c1 3300050507 Bacteria 1525
271 nmdc:mga0qj67_26275_c1 3300050509 Bacteria 4507
272 nmdc:mga0qj67_410114_c1 3300050509 Unclassified 1093
273 nmdc:mga06r32_196587_c1 3300050510 Bacteria 2004
274 nmdc:mga08y16_106077_c1 3300050511 Bacteria 2925
275 nmdc:mga08y16_15079_c1 3300050511 Bacteria 8126
276 nmdc:mga08y16_16713_c1 3300050511 Bacteria 7722
277 nmdc:mga08y16_33201_c1 3300050511 Bacteria 5421
278 nmdc:mga08y16_5875_c1 3300050511 Bacteria 12858
279 nmdc:mga0n895_448794_c1 3300050512 Unclassified 832
280 nmdc:mga0a205_141261_c1 3300050515 Bacteria 2308
281 nmdc:mga0a205_258538_c1 3300050515 Bacteria 1619
282 Ga0495619_0432248 3300053085 Bacteria 908
283 Ga0075428_100016844
284 JGI25406J46586_10003163
285 JGI25406J46586_10024610
286 Ga0065715_10238486
287 Ga0065707_10296028
288 Ga0070676_10190465
289 Ga0070690_100296501
290 Ga0070670_100030096
291 Ga0070670_100152977
292 Ga0070670_100307455
293 Ga0070677_10166988
294 Ga0070677_10277389
295 Ga0068869_100139287
296 Ga0068869_100314680
297 Ga0070666_10038798
298 Ga0068868_100057669
299 Ga0070689_100876768
300 Ga0070668_100120762
301 Ga0070669_100045101
302 Ga0070669_100076243
303 Ga0070669_100212731
304 Ga0070669_100366976
305 Ga0070675_100012154
306 Ga0070675_100017908
307 Ga0070675_100077307
308 Ga0070675_100450302
309 Ga0070671_100103218
310 Ga0070671_100311965
311 Ga0070674_100005790
312 Ga0070674_100125503
313 Ga0070673_100023484
314 Ga0070673_100632637
315 Ga0070688_100081675
316 Ga0070667_100678753
317 Ga0070667_101409028
318 Ga0070700_100068149
319 Ga0070700_100088006
320 Ga0070700_100261809
321 Ga0070700_100466564
322 Ga0070700_100532011
323 Ga0070708_100040676
324 Ga0070678_100494288
325 Ga0070662_100500013
326 Ga0068867_100054198
327 Ga0068867_100455759
328 Ga0068867_100488289
329 Ga0070707_101160959
330 Ga0070698_100310419
331 Ga0070699_100021546
332 Ga0070672_100019760
333 Ga0070686_100027536
334 Ga0070686_100407548
335 Ga0070695_100301881
336 Ga0070665_100049030
337 Ga0070704_100711343
338 Ga0070664_101109946
339 Ga0068857_100730751
340 Ga0068852_100606512
341 Ga0068859_100095976
342 Ga0068859_100309366
343 Ga0068859_100371883
344 Ga0068859_101863202
345 Ga0068864_100138527
346 Ga0068864_100160272
347 Ga0068866_10193533
348 Ga0068861_100163276
349 Ga0068870_10036805
350 Ga0068870_10252242
351 Ga0068863_101079857
352 Ga0068860_100143240
353 Ga0068862_100564878
354 Ga0068862_100782196
355 Ga0081539_10000010
356 Ga0081539_10000237
357 Ga0081539_10005535
358 Ga0097621_100015861
359 Ga0097621_100950598
360 Ga0068871_100022262
361 Ga0075428_100024860
362 Ga0075428_100194640
363 Ga0075428_100944804
364 Ga0075428_101245944
365 Ga0075430_100218806
366 Ga0075430_100374981
367 Ga0075431_100063637
368 Ga0075433_10183255
369 Ga0075434_100304710
370 Ga0075434_101252348
371 Ga0075429_100155438
372 Ga0075429_100182928
373 Ga0068865_100046492
374 Ga0068865_100103617
375 Ga0097620_100095979
376 Ga0097620_100309364
377 Ga0097620_100371910
378 Ga0097620_101863245
379 Ga0099794_10147158
380 Ga0105240_10344188
381 Ga0111539_10013813
382 Ga0111539_10023024
383 Ga0111539_10075508
384 Ga0111539_10428890
385 Ga0111539_11178584
386 Ga0111539_11979151
387 Ga0105245_10006743
388 Ga0105245_10010587
389 Ga0105245_10534460
390 Ga0114129_10002128
391 Ga0114129_10508942
392 Ga0114129_10629701
393 Ga0105243_11468192
394 Ga0105242_10007280
395 Ga0105242_10318050
396 Ga0105237_10117046
397 Ga0105249_10322599
398 Ga0157374_10413762
399 Ga0157374_10976795
400 Ga0157378_10038262
401 Ga0157378_10199677
402 Ga0157378_10667624
403 Ga0163162_10025248
404 Ga0157375_10073415
405 Ga0163163_10401180
406 Ga0163163_10687960
407 Ga0163163_11512722
408 Ga0157380_10009125
409 Ga0157380_10091387
410 Ga0157380_10181051
411 Ga0157380_10472005
412 Ga0157380_10914592
413 Ga0157377_10030813
414 Ga0157379_10388662
415 Ga0157376_10050576
416 Ga0157376_10329769
417 Ga0163161_10268191
418 Ga0213875_10143645
419 Ga0207642_10134493
420 Ga0207645_10030248
421 Ga0207645_10649279
422 Ga0207643_10020977
423 Ga0207643_10057175
424 Ga0207643_10114574
425 Ga0207695_10414975
426 Ga0207671_10029451
427 Ga0207681_10021390
428 Ga0207681_10068523
429 Ga0207681_10178775
430 Ga0207681_10323126
431 Ga0207650_10016930
432 Ga0207650_10118647
433 Ga0207650_10427720
434 Ga0207659_10058835
435 Ga0207659_10286224
436 Ga0207659_10327045
437 Ga0207687_10070251
438 Ga0207687_10135779
439 Ga0207664_10658478
440 Ga0207644_10070923
441 Ga0207644_10306257
442 Ga0207686_10210849
443 Ga0207686_10224999
444 Ga0207709_11041913
445 Ga0207669_10015340
446 Ga0207669_10299641
447 Ga0207704_10009202
448 Ga0207704_10375734
449 Ga0207691_10030789
450 Ga0207691_10158793
451 Ga0207689_10048720
452 Ga0207689_10118674
453 Ga0207679_10373301
454 Ga0207679_10501845
455 Ga0207651_10522098
456 Ga0207651_10561729
457 Ga0207712_10366731
458 Ga0207668_10069367
459 Ga0207668_10185873
460 Ga0207668_11206401
461 Ga0207658_10516836
462 Ga0207703_10455729
463 Ga0207708_10208953
464 Ga0207648_10017381
465 Ga0207648_10177371
466 Ga0207648_10196694
467 Ga0207648_10618575
468 Ga0207648_10622517
469 Ga0207676_10090944
470 Ga0207683_10010809
471 Ga0207683_10152877
472 Ga0207683_10456480
473 Ga0207428_10033237
474 Ga0207428_10050471
475 Ga0268266_10592632
476 Ga0268265_10457585
477 Ga0268265_11082341
478 Ga0268264_10087421
479 Ga0268264_10936881
480 Ga0265338_10186909
481 Ga0265338_10345081
482 Ga0265770_1010649
483 Ga0265760_10160658
484 Ga0265332_10290040
485 Ga0265325_10091112
486 Ga0265329_10111640
487 Ga0265316_10066015
488 Ga0307408_100016256
489 Ga0307410_10685629
490 Ga0307407_10428742
491 Ga0307412_10445698
492 Ga0307409_101152191
493 Ga0307416_100032369
494 Ga0307416_101705046
495 Ga0307414_10141413
496 Ga0373933_0000430
497 Ga0373937_0000207
498 Ga0436364_0918732
499 Ga0451807_1438550
500 Ga0466957_1009596
501 Ga0466958_0179100
502 Ga0495592_0001450
503 Ga0495651_0002632
504 Ga0495651_0011834
505 Ga0495653_0023488
506 Ga0495653_0279024
507 Ga0495582_0016593
508 Ga0495664_0155781
509 Ga0495608_0001162
510 Ga0495608_0143196
511 Ga0495608_0332856
512 Ga0495618_0008996
513 Ga0495628_0000647
514 Ga0495628_0336850
515 Ga0495630_0105101
516 Ga0495643_0058501
517 Ga0495652_0008382
518 Ga0495586_0087214
519 Ga0495587_0000145
520 Ga0495587_0001504
521 Ga0495587_0111370
522 Ga0495645_0020983
523 Ga0495622_0003075
524 Ga0495667_0001173
525 Ga0495656_0322616
526 Ga0495634_0026430
527 Ga0495657_0018243
528 Ga0495657_0160751
529 Ga0495657_0177289
530 Ga0495599_0048881
531 Ga0495623_0059300
532 Ga0495613_0061476
533 Ga0495600_0036791
534 Ga0495604_0042873
535 Ga0495604_0069152
536 Ga0495674_0097767
537 Ga0495680_0010509
538 Ga0495675_0002029
539 Ga0495675_0002661
540 Ga0495684_0003791
541 Ga0495602_0000224
542 Ga0495602_0078096
543 Ga0496104_0566221
544 Ga0496112_0069305
545 Ga0496114_0183507
546 Ga0501081_0112217
547 Ga0501083_0156852
548 Ga0501035_0263516
549 Ga0501044_0234154
550 Ga0501045_0341398
551 nmdc:mga05p37_227607_c1
552 nmdc:mga05p37_434354_c1
553 nmdc:mga0qj67_26275_c1
554 nmdc:mga0qj67_410114_c1
555 nmdc:mga06r32_196587_c1
556 nmdc:mga08y16_106077_c1
557 nmdc:mga08y16_15079_c1
558 nmdc:mga08y16_16713_c1
559 nmdc:mga08y16_33201_c1
560 nmdc:mga08y16_5875_c1
561 nmdc:mga0n895_448794_c1
562 nmdc:mga0a205_141261_c1
563 nmdc:mga0a205_258538_c1
564 Ga0495619_0432248

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01161

PBP

Phosphatidylethanolamine-binding protein

67

210

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n08-assembly1.cif.gz_B crystal structure of a putative phosphatidylethanolamine-binding protein (pebp) homolog ct736 from chlamydia trachomatis d/uw-3/cx 0.8556 31 186
1vi3-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.854 31 186
1fux-assembly1.cif.gz_B crystal structure of e.coli ybcl, a new member of the mammalian pebp family 0.8412 31 186
1fjj-assembly1.cif.gz_A-2 crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family 0.8303 31 184
1vi3-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.829 31 186
ID Description Score Start End Superfamily
4begB00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8527 27 186 3.90.280.10
af_P77368_20_183_3.90.280.10 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8508 31 188 3.90.280.10
3n08A00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8371 28 186 3.90.280.10
1fjjA00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8229 31 182 3.90.280.10
3n08A00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8215 28 186 3.90.280.10
ID Description Score Start End GO Terms
AF-A0A2V8C557-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9884 26 188
AF-A0A1F2S8S7-F1-model_v4 PBP family phospholipid-binding protein 0.988 31 188
AF-A0A1F2VKC2-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9829 31 186
AF-A0A7V0UJA5-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9786 26 188
AF-A0A346ADJ6-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9768 31 186

Map