F384834

General Info

Members Datasets Scaffolds Average Seq Length
282 191 564 174

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10067678|Ga0081455_100676782
Length 195
Sequence MSRKSAEGDLLPFGDMSDHAKQLLLDAFGRVREHVIDLTDRLTDDIATYRPDPEANSIAWLIWHLSRIQDDHVADLAQVDQAWDEWRERFGLPFSKRATGYGQGPKEVATVRASGDLLSRYHQAVHDLTLRYLNSITAEELDRIVDTRWDPPVTAAVRLVSVIGDTMQHLGQAAYLRGLAERRDSAWHQPGVADR

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
32 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
97 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
98 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
99 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
100 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
101 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
102 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
103 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
104 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
105 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
106 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
107 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
108 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
109 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
124 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
138 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
139 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
140 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
180 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
181 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
182 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
183 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
184 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
185 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
186 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
187 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
188 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
189 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
190 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
191 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.33
Metatranscriptomes 1.06
Isolates 4.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.42
Nodule 0
Rhizoplane 8.16
Rhizosphere 86.17
Stem 0
Stem Tuber 0
Unclassified 2.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10067678 3300005937 Bacteria 2975
2 Ga0065714_10004593 3300005288 Bacteria 5758
3 Ga0065714_10070818 3300005288 Bacteria 3756
4 Ga0065714_10127271 3300005288 Bacteria 1283
5 Ga0070670_100053453 3300005331 Bacteria 3468
6 Ga0070677_10514312 3300005333 Bacteria 651
7 Ga0068869_100221839 3300005334 Bacteria 1499
8 Ga0070666_10078334 3300005335 Bacteria 2256
9 Ga0070692_10062861 3300005345 Bacteria 1960
10 Ga0070668_100103036 3300005347 Bacteria 2264
11 Ga0070668_100482291 3300005347 Bacteria 1071
12 Ga0070669_100038446 3300005353 Bacteria 3475
13 Ga0070674_100102725 3300005356 Bacteria 2085
14 Ga0070674_100346042 3300005356 Bacteria 1199
15 Ga0070673_100263013 3300005364 Bacteria 1508
16 Ga0070667_100087005 3300005367 Bacteria 2682
17 Ga0070700_100982337 3300005441 Unclassified 693
18 Ga0070662_100026140 3300005457 Bacteria 4040
19 Ga0070698_100385607 3300005471 Bacteria 1334
20 Ga0070672_100041144 3300005543 Bacteria 3551
21 Ga0070665_100326814 3300005548 Bacteria 1538
22 Ga0068854_100634169 3300005578 Unclassified 916
23 Ga0070702_100122607 3300005615 Bacteria 1629
24 Ga0068852_100077702 3300005616 Bacteria 2935
25 Ga0068866_10020414 3300005718 Bacteria 3035
26 Ga0068861_100031309 3300005719 Bacteria 3907
27 Ga0068860_100716058 3300005843 Bacteria 1011
28 Ga0081455_10001034 3300005937 Bacteria 35141
29 Ga0081455_10005369 3300005937 Bacteria 14071
30 Ga0081455_10009615 3300005937 Bacteria 9930
31 Ga0081455_10053534 3300005937 Bacteria 3447
32 Ga0081455_10194348 3300005937 Bacteria 1525
33 Ga0081538_10000056 3300005981 Bacteria 103929
34 Ga0075364_11001506 3300006051 Bacteria 568
35 Ga0075432_10000050 3300006058 Bacteria 22789
36 Ga0075432_10006896 3300006058 Bacteria 3868
37 Ga0075432_10355280 3300006058 Bacteria 622
38 Ga0075428_100127027 3300006844 Bacteria 2774
39 Ga0075434_100000012 3300006871 Bacteria 83539
40 Ga0068865_100100748 3300006881 Bacteria 2114
41 Ga0075436_100000674 3300006914 Bacteria 22490
42 Ga0105251_10226508 3300009011 Bacteria 842
43 Ga0105244_10031195 3300009036 Bacteria 2829
44 Ga0111539_10078889 3300009094 Bacteria 3872
45 Ga0105245_10020169 3300009098 Bacteria 5843
46 Ga0105245_10636728 3300009098 Bacteria 1096
47 Ga0114129_10100713 3300009147 Bacteria 3997
48 Ga0114129_10486559 3300009147 Bacteria 1614
49 Ga0105243_10025725 3300009148 Bacteria 4501
50 Ga0105243_10041930 3300009148 Bacteria 3581
51 Ga0105242_10138022 3300009176 Bacteria 2113
52 Ga0105242_11007561 3300009176 Bacteria 841
53 Ga0105248_10132421 3300009177 Bacteria 2813
54 Ga0105239_10152362 3300010375 Bacteria 2580
55 Ga0105246_10040421 3300011119 Bacteria 3147
56 Ga0105246_10091572 3300011119 Bacteria 2192
57 Ga0105246_10348094 3300011119 Bacteria 1213
58 Ga0157371_10035632 3300013102 Bacteria 3566
59 Ga0157371_10114430 3300013102 Bacteria 1916
60 Ga0157369_10016150 3300013105 Bacteria 8404
61 Ga0157369_10080087 3300013105 Bacteria 3498
62 Ga0157369_10212659 3300013105 Bacteria 2026
63 Ga0163162_10039566 3300013306 Bacteria 4712
64 Ga0163162_10064922 3300013306 Bacteria 3696
65 Ga0157372_11386942 3300013307 Unclassified 810
66 Ga0157375_10979871 3300013308 Bacteria 986
67 Ga0157380_10069430 3300014326 Bacteria 2843
68 Ga0157376_11344511 3300014969 Bacteria 745
69 Ga0163161_10022058 3300017792 Bacteria 4481
70 Ga0209148_1002502 3300025254 Bacteria 6212
71 Ga0209148_1015021 3300025254 Bacteria 1361
72 Ga0207697_10004696 3300025315 Bacteria 6477
73 Ga0207655_1032428 3300025728 Bacteria 2387
74 Ga0207688_10047842 3300025901 Bacteria 2389
75 Ga0207680_10527953 3300025903 Bacteria 842
76 Ga0207645_10062794 3300025907 Bacteria 2373
77 Ga0207694_10357878 3300025924 Bacteria 1209
78 Ga0207650_10047787 3300025925 Bacteria 3154
79 Ga0207659_10011096 3300025926 Bacteria 5682
80 Ga0207687_10031524 3300025927 Bacteria 3583
81 Ga0207687_10566037 3300025927 Bacteria 955
82 Ga0207644_11048256 3300025931 Bacteria 685
83 Ga0207690_10449869 3300025932 Bacteria 1035
84 Ga0207706_10048728 3300025933 Bacteria 3747
85 Ga0207686_10074862 3300025934 Unclassified 2189
86 Ga0207669_10310616 3300025937 Bacteria 1202
87 Ga0207704_10089352 3300025938 Bacteria 2018
88 Ga0207691_10000601 3300025940 Bacteria 35990
89 Ga0207711_10154545 3300025941 Bacteria 2073
90 Ga0207689_10879286 3300025942 Unclassified 756
91 Ga0207651_10123216 3300025960 Bacteria 1970
92 Ga0207668_10231532 3300025972 Bacteria 1490
93 Ga0207640_10225122 3300025981 Bacteria 1439
94 Ga0207658_10726783 3300025986 Bacteria 898
95 Ga0207708_10028098 3300026075 Bacteria 4259
96 Ga0207675_100003130 3300026118 Bacteria 16230
97 Ga0207683_10001122 3300026121 Bacteria 24343
98 Ga0207698_10420544 3300026142 Bacteria 1282
99 Ga0207428_10036732 3300027907 Bacteria 3993
100 Ga0207428_10219468 3300027907 Bacteria 1426
101 Ga0268265_10037142 3300028380 Bacteria 3573
102 Ga0265327_10000264 3300031251 Bacteria 103984
103 Ga0265327_10041541 3300031251 Bacteria 2477
104 Ga0307408_100008636 3300031548 Bacteria 6727
105 Ga0307408_100035591 3300031548 Bacteria 3495
106 Ga0307408_100076886 3300031548 Bacteria 2484
107 Ga0307408_100110690 3300031548 Bacteria 2109
108 Ga0307408_100128280 3300031548 Bacteria 1975
109 Ga0307408_100168563 3300031548 Bacteria 1746
110 Ga0307408_100397576 3300031548 Bacteria 1182
111 Ga0307408_100412606 3300031548 Bacteria 1162
112 Ga0307408_100503077 3300031548 Bacteria 1061
113 Ga0307408_101092521 3300031548 Bacteria 739
114 Ga0307405_10082398 3300031731 Bacteria 2105
115 Ga0307405_10160863 3300031731 Bacteria 1590
116 Ga0307405_10230466 3300031731 Bacteria 1365
117 Ga0307405_10793989 3300031731 Bacteria 792
118 Ga0307413_10039223 3300031824 Bacteria 2752
119 Ga0307413_10043360 3300031824 Bacteria 2651
120 Ga0307413_10150591 3300031824 Bacteria 1620
121 Ga0307413_11339665 3300031824 Bacteria 628
122 Ga0307410_10033560 3300031852 Bacteria 3314
123 Ga0307410_10115308 3300031852 Bacteria 1950
124 Ga0307410_10794752 3300031852 Bacteria 804
125 Ga0307410_11328886 3300031852 Bacteria 629
126 Ga0307406_10047470 3300031901 Bacteria 2706
127 Ga0307406_10382932 3300031901 Bacteria 1109
128 Ga0307407_10018152 3300031903 Bacteria 3550
129 Ga0307407_10036962 3300031903 Bacteria 2695
130 Ga0307407_10320540 3300031903 Bacteria 1087
131 Ga0307412_10183235 3300031911 Bacteria 1577
132 Ga0307412_10363313 3300031911 Bacteria 1166
133 Ga0307412_10518974 3300031911 Bacteria 995
134 Ga0307409_100149812 3300031995 Bacteria 2023
135 Ga0307409_100162835 3300031995 Bacteria 1953
136 Ga0307409_100841881 3300031995 Bacteria 927
137 Ga0307409_101292572 3300031995 Bacteria 754
138 Ga0307409_101580618 3300031995 Bacteria 684
139 Ga0307409_101859604 3300031995 Bacteria 631
140 Ga0307416_100198579 3300032002 Bacteria 1900
141 Ga0307416_100214967 3300032002 Bacteria 1838
142 Ga0307416_100263046 3300032002 Bacteria 1687
143 Ga0307416_100412371 3300032002 Bacteria 1392
144 Ga0307414_10149932 3300032004 Bacteria 1838
145 Ga0307414_10196005 3300032004 Bacteria 1639
146 Ga0307414_10244529 3300032004 Bacteria 1487
147 Ga0307411_10030107 3300032005 Bacteria 3324
148 Ga0307411_10062843 3300032005 Bacteria 2478
149 Ga0307411_10500859 3300032005 Bacteria 1027
150 Ga0307415_100670169 3300032126 Bacteria 932
151 Ga0373931_0362618 3300035691 Unclassified 910
152 Ga0395899_0034982 3300037312 Bacteria 3772
153 Ga0395899_0717958 3300037312 Bacteria 625
154 Ga0395900_0159580 3300037418 Bacteria 2301
155 Ga0395898_0035486 3300037466 Bacteria 4957
156 Ga0395898_0268415 3300037466 Bacteria 1627
157 Ga0395901_0103431 3300038443 Bacteria 2988
158 Ga0439436_0036417 3300041404 Bacteria 1419
159 Ga0439438_020542 3300041405 Bacteria 1853
160 Ga0439438_036931 3300041405 Bacteria 1279
161 Ga0439439_0031110 3300041406 Bacteria 1359
162 Ga0439465_0004893 3300041413 Bacteria 4306
163 Ga0439433_0009962 3300041999 Bacteria 2074
164 Ga0439433_0017265 3300041999 Bacteria 1601
165 Ga0439433_0027503 3300041999 Bacteria 1290
166 Ga0439442_015228 3300042002 Bacteria 1584
167 Ga0439432_164571 3300042006 Bacteria 648
168 Ga0439449_0004996 3300042007 Bacteria 5100
169 Ga0439449_0012061 3300042007 Bacteria 3249
170 Ga0439449_0077339 3300042007 Bacteria 1227
171 Ga0439449_0089318 3300042007 Bacteria 1138
172 Ga0439452_040984 3300042010 Bacteria 1091
173 Ga0439454_066558 3300042011 Unclassified 633
174 Ga0439455_0134283 3300042012 Bacteria 699
175 Ga0439462_0010099 3300042015 Bacteria 2390
176 Ga0439462_0092259 3300042015 Bacteria 831
177 Ga0439462_0160724 3300042015 Bacteria 634
178 Ga0450920_030017 3300042122 Bacteria 1068
179 Ga0439434_0109155 3300042435 Bacteria 895
180 Ga0466961_0025615 3300044693 Bacteria 3792
181 Ga0495629_0070715 3300046459 Bacteria 2435
182 Ga0495653_0014274 3300046463 Bacteria 6477
183 Ga0495580_0424061 3300046472 Bacteria 895
184 Ga0495582_0014863 3300046473 Bacteria 4278
185 Ga0495662_0024086 3300046476 Bacteria 2937
186 Ga0495664_0114245 3300046477 Bacteria 1631
187 Ga0495584_0233034 3300046491 Bacteria 936
188 Ga0495594_0032748 3300046499 Bacteria 2823
189 Ga0495594_0220974 3300046499 Bacteria 1080
190 Ga0495594_0536124 3300046499 Bacteria 664
191 Ga0495583_0335920 3300046506 Bacteria 597
192 Ga0495630_0037729 3300046517 Bacteria 3613
193 Ga0495631_0082905 3300046518 Bacteria 1382
194 Ga0495643_0109784 3300046522 Bacteria 1404
195 Ga0495665_0008657 3300046531 Bacteria 5524
196 Ga0495586_0003590 3300046535 Bacteria 8310
197 Ga0495587_0004459 3300046536 Bacteria 9216
198 Ga0495645_0005389 3300046543 Bacteria 8773
199 Ga0495633_0386967 3300046558 Bacteria 633
200 Ga0495667_0003845 3300046559 Bacteria 10083
201 Ga0495656_0007823 3300046615 Bacteria 3796
202 Ga0495635_0059639 3300046663 Bacteria 2624
203 Ga0495588_0005892 3300046674 Bacteria 5493
204 Ga0495588_0088270 3300046674 Bacteria 1623
205 Ga0495623_0042227 3300046679 Bacteria 2906
206 Ga0495670_0084258 3300046691 Bacteria 1622
207 Ga0495670_0134645 3300046691 Bacteria 1289
208 Ga0495600_0032922 3300046809 Bacteria 3363
209 Ga0495581_0011239 3300047315 Bacteria 5175
210 Ga0495604_0151985 3300047317 Bacteria 1644
211 Ga0495680_0028724 3300047322 Bacteria 4559
212 Ga0495677_0058421 3300047445 Bacteria 1427
213 Ga0495685_243914 3300047447 Bacteria 571
214 Ga0495681_0265262 3300047470 Bacteria 674
215 Ga0495684_0063949 3300047471 Bacteria 2797
216 Ga0496100_0071711 3300048903 Bacteria 2313
217 Ga0496101_0034240 3300048904 Bacteria 3586
218 Ga0496101_0129027 3300048904 Bacteria 1918
219 Ga0496102_0065462 3300048905 Bacteria 3331
220 Ga0496102_0294744 3300048905 Bacteria 1529
221 Ga0496102_0614041 3300048905 Bacteria 1010
222 Ga0496103_0080046 3300048906 Bacteria 2054
223 Ga0496104_0151280 3300048907 Bacteria 2227
224 Ga0496105_0133483 3300048908 Bacteria 2045
225 Ga0496106_0385893 3300048909 Bacteria 1125
226 Ga0496106_0477497 3300048909 Bacteria 1001
227 Ga0496108_0021465 3300048911 Bacteria 5307
228 Ga0496109_0042360 3300048912 Bacteria 4123
229 Ga0496109_0087274 3300048912 Bacteria 2881
230 Ga0496109_1190714 3300048912 Bacteria 699
231 Ga0496110_1064616 3300048913 Bacteria 717
232 Ga0496111_0025577 3300048914 Bacteria 4165
233 Ga0496112_0010971 3300048915 Bacteria 8252
234 Ga0496112_0047828 3300048915 Bacteria 4196
235 Ga0496113_0128337 3300048916 Bacteria 1987
236 Ga0496113_0147945 3300048916 Bacteria 1852
237 Ga0496114_0021494 3300048917 Bacteria 5249
238 Ga0496115_0086644 3300048918 Bacteria 2555
239 Ga0496122_0299044 3300048925 Bacteria 869
240 Ga0496124_0099300 3300048927 Bacteria 2361
241 Ga0496126_0000379 3300048929 Bacteria 92123
242 Ga0501032_0011868 3300049569 Bacteria 6241
243 Ga0501036_0180374 3300049572 Bacteria 1778
244 Ga0501036_1029033 3300049572 Bacteria 674
245 Ga0501037_0004423 3300049573 Bacteria 10207
246 Ga0501037_0064851 3300049573 Bacteria 2661
247 Ga0501038_0052005 3300049574 Bacteria 3532
248 Ga0501038_0058692 3300049574 Bacteria 3298
249 Ga0501038_0063791 3300049574 Bacteria 3143
250 Ga0501038_0234580 3300049574 Bacteria 1458
251 Ga0501038_0403573 3300049574 Bacteria 1057
252 Ga0501038_0865151 3300049574 Bacteria 669
253 Ga0501039_0042852 3300049575 Bacteria 3496
254 Ga0501039_0245663 3300049575 Bacteria 1407
255 Ga0501043_0033073 3300049579 Bacteria 4067
256 Ga0501043_0065312 3300049579 Bacteria 2857
257 Ga0501048_0914086 3300049582 Bacteria 631
258 Ga0501073_0253247 3300049589 Bacteria 1215
259 Ga0501207_004083 3300049654 Bacteria 1973
260 Ga0501044_0525701 3300049823 Bacteria 1082
261 nmdc:mga00v17_835995_c1 3300050491 Bacteria 585
262 nmdc:mga08y16_25332_c1 3300050511 Bacteria 6255
263 nmdc:mga0n895_1468_c1 3300050512 Bacteria 17670
264 nmdc:mga08x19_55774_c1 3300050514 Bacteria 2548
265 nmdc:mga0a205_5588_c1 3300050515 Bacteria 11327
266 Ga0501084_0805262 3300054114 Bacteria 791
267 Ga0587090_000254 3300059510 Bacteria 3983
268 Ga0587072_000437 3300059643 Bacteria 4178
269 Ga0587124_029635 3300059660 Bacteria 599
270 2691512921 2690315906 Bacteria 4517044
271 2775656708 2775506735 Bacteria 4556596
272 2808831332 2808606357 Bacteria 4466944
273 2808852605 2808606360 Bacteria 4404006
274 2808879108 2808606366 Bacteria 4415912
275 2808896648 2808606371 Bacteria 4251511
276 2812320972 2811994871 Bacteria 4497550
277 2919393858 2919391150 Bacteria 4884741
278 2945918718 2945916053 Bacteria 4555517
279 2945942858 2945941187 Bacteria 4682474
280 2945959397 2945956166 Bacteria 5110334
281 2946062577 2946059875 Bacteria 4386623
282 2974306715 2974302888 Bacteria 4369871
283 Ga0081455_10067678
284 Ga0065714_10004593
285 Ga0065714_10070818
286 Ga0065714_10127271
287 Ga0070670_100053453
288 Ga0070677_10514312
289 Ga0068869_100221839
290 Ga0070666_10078334
291 Ga0070692_10062861
292 Ga0070668_100103036
293 Ga0070668_100482291
294 Ga0070669_100038446
295 Ga0070674_100102725
296 Ga0070674_100346042
297 Ga0070673_100263013
298 Ga0070667_100087005
299 Ga0070700_100982337
300 Ga0070662_100026140
301 Ga0070698_100385607
302 Ga0070672_100041144
303 Ga0070665_100326814
304 Ga0068854_100634169
305 Ga0070702_100122607
306 Ga0068852_100077702
307 Ga0068866_10020414
308 Ga0068861_100031309
309 Ga0068860_100716058
310 Ga0081455_10001034
311 Ga0081455_10005369
312 Ga0081455_10009615
313 Ga0081455_10053534
314 Ga0081455_10194348
315 Ga0081538_10000056
316 Ga0075364_11001506
317 Ga0075432_10000050
318 Ga0075432_10006896
319 Ga0075432_10355280
320 Ga0075428_100127027
321 Ga0075434_100000012
322 Ga0068865_100100748
323 Ga0075436_100000674
324 Ga0105251_10226508
325 Ga0105244_10031195
326 Ga0111539_10078889
327 Ga0105245_10020169
328 Ga0105245_10636728
329 Ga0114129_10100713
330 Ga0114129_10486559
331 Ga0105243_10025725
332 Ga0105243_10041930
333 Ga0105242_10138022
334 Ga0105242_11007561
335 Ga0105248_10132421
336 Ga0105239_10152362
337 Ga0105246_10040421
338 Ga0105246_10091572
339 Ga0105246_10348094
340 Ga0157371_10035632
341 Ga0157371_10114430
342 Ga0157369_10016150
343 Ga0157369_10080087
344 Ga0157369_10212659
345 Ga0163162_10039566
346 Ga0163162_10064922
347 Ga0157372_11386942
348 Ga0157375_10979871
349 Ga0157380_10069430
350 Ga0157376_11344511
351 Ga0163161_10022058
352 Ga0209148_1002502
353 Ga0209148_1015021
354 Ga0207697_10004696
355 Ga0207655_1032428
356 Ga0207688_10047842
357 Ga0207680_10527953
358 Ga0207645_10062794
359 Ga0207694_10357878
360 Ga0207650_10047787
361 Ga0207659_10011096
362 Ga0207687_10031524
363 Ga0207687_10566037
364 Ga0207644_11048256
365 Ga0207690_10449869
366 Ga0207706_10048728
367 Ga0207686_10074862
368 Ga0207669_10310616
369 Ga0207704_10089352
370 Ga0207691_10000601
371 Ga0207711_10154545
372 Ga0207689_10879286
373 Ga0207651_10123216
374 Ga0207668_10231532
375 Ga0207640_10225122
376 Ga0207658_10726783
377 Ga0207708_10028098
378 Ga0207675_100003130
379 Ga0207683_10001122
380 Ga0207698_10420544
381 Ga0207428_10036732
382 Ga0207428_10219468
383 Ga0268265_10037142
384 Ga0265327_10000264
385 Ga0265327_10041541
386 Ga0307408_100008636
387 Ga0307408_100035591
388 Ga0307408_100076886
389 Ga0307408_100110690
390 Ga0307408_100128280
391 Ga0307408_100168563
392 Ga0307408_100397576
393 Ga0307408_100412606
394 Ga0307408_100503077
395 Ga0307408_101092521
396 Ga0307405_10082398
397 Ga0307405_10160863
398 Ga0307405_10230466
399 Ga0307405_10793989
400 Ga0307413_10039223
401 Ga0307413_10043360
402 Ga0307413_10150591
403 Ga0307413_11339665
404 Ga0307410_10033560
405 Ga0307410_10115308
406 Ga0307410_10794752
407 Ga0307410_11328886
408 Ga0307406_10047470
409 Ga0307406_10382932
410 Ga0307407_10018152
411 Ga0307407_10036962
412 Ga0307407_10320540
413 Ga0307412_10183235
414 Ga0307412_10363313
415 Ga0307412_10518974
416 Ga0307409_100149812
417 Ga0307409_100162835
418 Ga0307409_100841881
419 Ga0307409_101292572
420 Ga0307409_101580618
421 Ga0307409_101859604
422 Ga0307416_100198579
423 Ga0307416_100214967
424 Ga0307416_100263046
425 Ga0307416_100412371
426 Ga0307414_10149932
427 Ga0307414_10196005
428 Ga0307414_10244529
429 Ga0307411_10030107
430 Ga0307411_10062843
431 Ga0307411_10500859
432 Ga0307415_100670169
433 Ga0373931_0362618
434 Ga0395899_0034982
435 Ga0395899_0717958
436 Ga0395900_0159580
437 Ga0395898_0035486
438 Ga0395898_0268415
439 Ga0395901_0103431
440 Ga0439436_0036417
441 Ga0439438_020542
442 Ga0439438_036931
443 Ga0439439_0031110
444 Ga0439465_0004893
445 Ga0439433_0009962
446 Ga0439433_0017265
447 Ga0439433_0027503
448 Ga0439442_015228
449 Ga0439432_164571
450 Ga0439449_0004996
451 Ga0439449_0012061
452 Ga0439449_0077339
453 Ga0439449_0089318
454 Ga0439452_040984
455 Ga0439454_066558
456 Ga0439455_0134283
457 Ga0439462_0010099
458 Ga0439462_0092259
459 Ga0439462_0160724
460 Ga0450920_030017
461 Ga0439434_0109155
462 Ga0466961_0025615
463 Ga0495629_0070715
464 Ga0495653_0014274
465 Ga0495580_0424061
466 Ga0495582_0014863
467 Ga0495662_0024086
468 Ga0495664_0114245
469 Ga0495584_0233034
470 Ga0495594_0032748
471 Ga0495594_0220974
472 Ga0495594_0536124
473 Ga0495583_0335920
474 Ga0495630_0037729
475 Ga0495631_0082905
476 Ga0495643_0109784
477 Ga0495665_0008657
478 Ga0495586_0003590
479 Ga0495587_0004459
480 Ga0495645_0005389
481 Ga0495633_0386967
482 Ga0495667_0003845
483 Ga0495656_0007823
484 Ga0495635_0059639
485 Ga0495588_0005892
486 Ga0495588_0088270
487 Ga0495623_0042227
488 Ga0495670_0084258
489 Ga0495670_0134645
490 Ga0495600_0032922
491 Ga0495581_0011239
492 Ga0495604_0151985
493 Ga0495680_0028724
494 Ga0495677_0058421
495 Ga0495685_243914
496 Ga0495681_0265262
497 Ga0495684_0063949
498 Ga0496100_0071711
499 Ga0496101_0034240
500 Ga0496101_0129027
501 Ga0496102_0065462
502 Ga0496102_0294744
503 Ga0496102_0614041
504 Ga0496103_0080046
505 Ga0496104_0151280
506 Ga0496105_0133483
507 Ga0496106_0385893
508 Ga0496106_0477497
509 Ga0496108_0021465
510 Ga0496109_0042360
511 Ga0496109_0087274
512 Ga0496109_1190714
513 Ga0496110_1064616
514 Ga0496111_0025577
515 Ga0496112_0010971
516 Ga0496112_0047828
517 Ga0496113_0128337
518 Ga0496113_0147945
519 Ga0496114_0021494
520 Ga0496115_0086644
521 Ga0496122_0299044
522 Ga0496124_0099300
523 Ga0496126_0000379
524 Ga0501032_0011868
525 Ga0501036_0180374
526 Ga0501036_1029033
527 Ga0501037_0004423
528 Ga0501037_0064851
529 Ga0501038_0052005
530 Ga0501038_0058692
531 Ga0501038_0063791
532 Ga0501038_0234580
533 Ga0501038_0403573
534 Ga0501038_0865151
535 Ga0501039_0042852
536 Ga0501039_0245663
537 Ga0501043_0033073
538 Ga0501043_0065312
539 Ga0501048_0914086
540 Ga0501073_0253247
541 Ga0501207_004083
542 Ga0501044_0525701
543 nmdc:mga00v17_835995_c1
544 nmdc:mga08y16_25332_c1
545 nmdc:mga0n895_1468_c1
546 nmdc:mga08x19_55774_c1
547 nmdc:mga0a205_5588_c1
548 Ga0501084_0805262
549 Ga0587090_000254
550 Ga0587072_000437
551 Ga0587124_029635
552 2691512921
553 2775656708
554 2808831332
555 2808852605
556 2808879108
557 2808896648
558 2812320972
559 2919393858
560 2945918718
561 2945942858
562 2945959397
563 2946062577
564 2974306715

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04978

DUF664

Protein of unknown function (DUF664)

23

181

0.92

PF12867

DinB_2

DinB superfamily

27

173

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f5v-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis mycothiol s-transferase enzyme in complex with mycothiol and zn2+ 0.9789 3 164
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.9756 3 164
8f5v-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis mycothiol s-transferase enzyme in complex with mycothiol and zn2+ 0.9445 3 164
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.9251 3 164
3cex-assembly1.cif.gz_A crystal structure of the conserved protein of locus ef_3021 from enterococcus faecalis 0.9205 1 162
ID Description Score Start End Superfamily
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9839 3 165 1.20.120.450
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9494 3 165 1.20.120.450
3cexB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9191 1 162 1.20.120.450
3cexB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8823 1 162 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7695 6 163 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A0K8Q9Y1-F1-model_v4 DinB-like domain-containing protein 0.9997 1 162
AF-A0A4P7RQA8-F1-model_v4 DUF664 domain-containing protein 0.9921 3 167
AF-A0A7Y6AL33-F1-model_v4 DUF664 domain-containing protein 0.9896 1 168
AF-A0A1S1QN51-F1-model_v4 DinB-like domain-containing protein 0.9881 3 164
AF-A0A838KCI8-F1-model_v4 DUF664 domain-containing protein 0.988 1 167

Map