F384831
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 282 | 194 | 281 | 170 |
Family's Representative Sequence
| Representative Sequence | 3300005844|Ga0068862_100710946|Ga0068862_1007109461 |
| Length | 196 |
| Sequence | MRYHVASNGSAHGDAPGIGQGDFIRQLVRPLAGIACAIAVAGLFGTAPAQAREVVAFRDGSVSAGTIVVRTGERRLYYVMGDGRAIRYPVXXXKASKQWTGTTRIDGKYVKPAWSPPQEVRRDKPSLPDVIPGGSPRNPMGVAAMTLAGGEYAIHGTNVPSSIGGFVSYGCIRMFNQDVVDLYSRVSVGTTVMVVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 21 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 28 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 29 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 30 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 31 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 32 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 34 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 35 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 39 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 40 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 41 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 42 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 43 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 44 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 45 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 91 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 92 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 93 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 94 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 95 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 96 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 97 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 98 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 99 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 100 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 101 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 102 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 103 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 104 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 105 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 106 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 107 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 108 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 109 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 110 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 111 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 112 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 113 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 114 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 155 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 156 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 157 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 158 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 160 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 161 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 162 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 176 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 177 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 178 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 179 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 188 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 191 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 192 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 193 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.65 |
| Metatranscriptomes | 0 |
| Isolates | 0.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.9 |
| Nodule | 0.35 |
| Rhizoplane | 3.19 |
| Rhizosphere | 91.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10007080 | 3300003203 | Bacteria | 5140 |
| 2 | JGI25406J46586_10042057 | 3300003203 | Bacteria | 1603 |
| 3 | Ga0065712_10562463 | 3300005290 | Bacteria | 611 |
| 4 | Ga0070676_10419164 | 3300005328 | Bacteria | 935 |
| 5 | Ga0070670_100477555 | 3300005331 | Bacteria | 1107 |
| 6 | Ga0070670_100493083 | 3300005331 | Bacteria | 1089 |
| 7 | Ga0068868_100097148 | 3300005338 | Bacteria | 2380 |
| 8 | Ga0068868_100272661 | 3300005338 | Bacteria | 1430 |
| 9 | Ga0070689_100636568 | 3300005340 | Bacteria | 926 |
| 10 | Ga0070671_100948741 | 3300005355 | Bacteria | 752 |
| 11 | Ga0070674_100008903 | 3300005356 | Bacteria | 5993 |
| 12 | Ga0070673_100062659 | 3300005364 | Bacteria | 2955 |
| 13 | Ga0070673_101164175 | 3300005364 | Bacteria | 722 |
| 14 | Ga0070688_100598560 | 3300005365 | Bacteria | 843 |
| 15 | Ga0070659_100937205 | 3300005366 | Bacteria | 758 |
| 16 | Ga0070709_10092715 | 3300005434 | Unclassified | 1995 |
| 17 | Ga0070709_10273701 | 3300005434 | Unclassified | 1224 |
| 18 | Ga0070714_100046889 | 3300005435 | Unclassified | 3668 |
| 19 | Ga0070713_100007056 | 3300005436 | Bacteria | 7850 |
| 20 | Ga0070713_100186947 | 3300005436 | Unclassified | 1865 |
| 21 | Ga0070710_10024090 | 3300005437 | Bacteria | 3207 |
| 22 | Ga0070711_100016233 | 3300005439 | Unclassified | 4726 |
| 23 | Ga0070711_100509065 | 3300005439 | Bacteria | 994 |
| 24 | Ga0070711_100805960 | 3300005439 | Unclassified | 797 |
| 25 | Ga0070694_100835483 | 3300005444 | Bacteria | 757 |
| 26 | Ga0070678_100003451 | 3300005456 | Bacteria | 8815 |
| 27 | Ga0068867_100005652 | 3300005459 | Bacteria | 8864 |
| 28 | Ga0070699_100080686 | 3300005518 | Bacteria | 2835 |
| 29 | Ga0070672_100027477 | 3300005543 | Bacteria | 4244 |
| 30 | Ga0070686_100125730 | 3300005544 | Bacteria | 1766 |
| 31 | Ga0068857_100064125 | 3300005577 | Bacteria | 3266 |
| 32 | Ga0068854_100981631 | 3300005578 | Bacteria | 747 |
| 33 | Ga0068852_100725741 | 3300005616 | Bacteria | 1005 |
| 34 | Ga0068864_100017854 | 3300005618 | Bacteria | 5918 |
| 35 | Ga0068866_10455923 | 3300005718 | Bacteria | 837 |
| 36 | Ga0068862_100294337 | 3300005844 | Bacteria | 1492 |
| 37 | Ga0068862_100710946 | 3300005844 | Bacteria | 974 |
| 38 | Ga0081455_10009303 | 3300005937 | Bacteria | 10116 |
| 39 | Ga0081455_10010247 | 3300005937 | Bacteria | 9531 |
| 40 | Ga0081455_10022249 | 3300005937 | Bacteria | 5929 |
| 41 | Ga0081539_10000966 | 3300005985 | Bacteria | 53690 |
| 42 | Ga0081539_10005675 | 3300005985 | Bacteria | 12525 |
| 43 | Ga0070717_10006183 | 3300006028 | Bacteria | 8789 |
| 44 | Ga0070717_10139525 | 3300006028 | Bacteria | 2090 |
| 45 | Ga0070717_10356844 | 3300006028 | Bacteria | 1308 |
| 46 | Ga0070717_10979444 | 3300006028 | Bacteria | 770 |
| 47 | Ga0075364_10037409 | 3300006051 | Bacteria | 3142 |
| 48 | Ga0075432_10228466 | 3300006058 | Bacteria | 747 |
| 49 | Ga0070715_10000386 | 3300006163 | Bacteria | 11051 |
| 50 | Ga0070716_100021061 | 3300006173 | Unclassified | 3431 |
| 51 | Ga0070712_100004185 | 3300006175 | Bacteria | 8876 |
| 52 | Ga0070712_100188945 | 3300006175 | Bacteria | 1610 |
| 53 | Ga0075362_10064801 | 3300006177 | Bacteria | 1658 |
| 54 | Ga0075366_10014633 | 3300006195 | Bacteria | 4483 |
| 55 | Ga0075428_100492365 | 3300006844 | Unclassified | 1312 |
| 56 | Ga0075430_100000509 | 3300006846 | Bacteria | 29219 |
| 57 | Ga0075431_100215285 | 3300006847 | Bacteria | 1961 |
| 58 | Ga0075433_10313177 | 3300006852 | Bacteria | 1389 |
| 59 | Ga0075434_100270090 | 3300006871 | Bacteria | 1720 |
| 60 | Ga0075429_100253439 | 3300006880 | Bacteria | 1541 |
| 61 | Ga0075429_100643476 | 3300006880 | Bacteria | 929 |
| 62 | Ga0068865_100363381 | 3300006881 | Bacteria | 1176 |
| 63 | Ga0075435_100523320 | 3300007076 | Bacteria | 1026 |
| 64 | Ga0105240_11061450 | 3300009093 | Bacteria | 864 |
| 65 | Ga0105243_10082079 | 3300009148 | Bacteria | 2634 |
| 66 | Ga0105241_10723702 | 3300009174 | Bacteria | 910 |
| 67 | Ga0105242_10855317 | 3300009176 | Bacteria | 905 |
| 68 | Ga0105238_10021249 | 3300009551 | Bacteria | 6614 |
| 69 | Ga0105238_10087339 | 3300009551 | Bacteria | 3106 |
| 70 | Ga0105249_10521539 | 3300009553 | Bacteria | 1236 |
| 71 | Ga0105249_10863117 | 3300009553 | Bacteria | 971 |
| 72 | Ga0105249_12141475 | 3300009553 | Bacteria | 632 |
| 73 | Ga0157378_10317368 | 3300013297 | Bacteria | 1513 |
| 74 | Ga0157375_11062300 | 3300013308 | Bacteria | 947 |
| 75 | Ga0163163_10054773 | 3300014325 | Bacteria | 3941 |
| 76 | Ga0157380_10041355 | 3300014326 | Bacteria | 3597 |
| 77 | Ga0157379_10228760 | 3300014968 | Bacteria | 1686 |
| 78 | Ga0207682_10001074 | 3300025893 | Bacteria | 12601 |
| 79 | Ga0207692_10044207 | 3300025898 | Bacteria | 2221 |
| 80 | Ga0207642_10393693 | 3300025899 | Bacteria | 827 |
| 81 | Ga0207685_10036450 | 3300025905 | Unclassified | 1804 |
| 82 | Ga0207699_10018555 | 3300025906 | Bacteria | 3688 |
| 83 | Ga0207645_10063809 | 3300025907 | Bacteria | 2354 |
| 84 | Ga0207643_10086498 | 3300025908 | Bacteria | 1822 |
| 85 | Ga0207693_10000434 | 3300025915 | Bacteria | 38124 |
| 86 | Ga0207693_10080339 | 3300025915 | Unclassified | 2553 |
| 87 | Ga0207663_10087422 | 3300025916 | Bacteria | 2058 |
| 88 | Ga0207663_10483963 | 3300025916 | Unclassified | 959 |
| 89 | Ga0207657_10439092 | 3300025919 | Bacteria | 1025 |
| 90 | Ga0207650_10078523 | 3300025925 | Bacteria | 2497 |
| 91 | Ga0207659_10251880 | 3300025926 | Bacteria | 1433 |
| 92 | Ga0207659_10979613 | 3300025926 | Bacteria | 727 |
| 93 | Ga0207700_10009301 | 3300025928 | Bacteria | 6131 |
| 94 | Ga0207700_10222910 | 3300025928 | Bacteria | 1599 |
| 95 | Ga0207700_10505715 | 3300025928 | Bacteria | 1069 |
| 96 | Ga0207664_10373188 | 3300025929 | Bacteria | 1265 |
| 97 | Ga0207644_10070167 | 3300025931 | Bacteria | 2560 |
| 98 | Ga0207706_10231943 | 3300025933 | Bacteria | 1615 |
| 99 | Ga0207709_10102229 | 3300025935 | Bacteria | 1897 |
| 100 | Ga0207669_10002350 | 3300025937 | Bacteria | 8037 |
| 101 | Ga0207669_10850924 | 3300025937 | Bacteria | 759 |
| 102 | Ga0207665_10009694 | 3300025939 | Bacteria | 6323 |
| 103 | Ga0207665_10197339 | 3300025939 | Bacteria | 1465 |
| 104 | Ga0207691_10001292 | 3300025940 | Bacteria | 24983 |
| 105 | Ga0207661_10118826 | 3300025944 | Bacteria | 2248 |
| 106 | Ga0207651_10056609 | 3300025960 | Bacteria | 2699 |
| 107 | Ga0207668_10739791 | 3300025972 | Bacteria | 867 |
| 108 | Ga0207639_10336929 | 3300026041 | Bacteria | 1344 |
| 109 | Ga0207641_10286222 | 3300026088 | Bacteria | 1552 |
| 110 | Ga0207648_10006883 | 3300026089 | Bacteria | 11270 |
| 111 | Ga0207676_11260512 | 3300026095 | Bacteria | 733 |
| 112 | Ga0207674_10018581 | 3300026116 | Bacteria | 7550 |
| 113 | Ga0207675_100159792 | 3300026118 | Bacteria | 2149 |
| 114 | Ga0207683_10001466 | 3300026121 | Bacteria | 21270 |
| 115 | Ga0268265_10386378 | 3300028380 | Bacteria | 1289 |
| 116 | Ga0265342_10519394 | 3300031712 | Bacteria | 606 |
| 117 | Ga0307413_10137679 | 3300031824 | Bacteria | 1682 |
| 118 | Ga0373944_0094843 | 3300035089 | Bacteria | 1001 |
| 119 | Ga0373923_0029897 | 3300035111 | Bacteria | 2188 |
| 120 | Ga0373936_0129456 | 3300035113 | Unclassified | 1083 |
| 121 | Ga0373945_0339111 | 3300035116 | Unclassified | 650 |
| 122 | Ga0373945_0449415 | 3300035116 | Bacteria | 570 |
| 123 | Ga0373953_0134385 | 3300035117 | Bacteria | 1056 |
| 124 | Ga0373954_0098400 | 3300035118 | Unclassified | 1410 |
| 125 | Ga0373957_0081604 | 3300035120 | Bacteria | 1277 |
| 126 | Ga0373943_0550398 | 3300035170 | Unclassified | 677 |
| 127 | Ga0373946_0160871 | 3300035171 | Bacteria | 1054 |
| 128 | Ga0373955_0016279 | 3300035172 | Unclassified | 3657 |
| 129 | Ga0373955_0032717 | 3300035172 | Bacteria | 2732 |
| 130 | Ga0373924_0022518 | 3300035410 | Unclassified | 2463 |
| 131 | Ga0373935_0017787 | 3300035692 | Bacteria | 4318 |
| 132 | Ga0373935_0486650 | 3300035692 | Bacteria | 895 |
| 133 | Ga0373927_0288338 | 3300035695 | Unclassified | 1080 |
| 134 | Ga0373933_0026069 | 3300035724 | Unclassified | 3354 |
| 135 | Ga0373933_0055523 | 3300035724 | Bacteria | 2376 |
| 136 | Ga0373933_0070210 | 3300035724 | Bacteria | 2130 |
| 137 | Ga0373947_0164715 | 3300035725 | Bacteria | 1435 |
| 138 | Ga0373947_0232778 | 3300035725 | Unclassified | 1214 |
| 139 | Ga0373937_0005874 | 3300036401 | Bacteria | 10558 |
| 140 | Ga0373937_0034921 | 3300036401 | Bacteria | 4574 |
| 141 | Ga0373937_0097992 | 3300036401 | Bacteria | 2719 |
| 142 | Ga0373937_0433959 | 3300036401 | Bacteria | 1247 |
| 143 | Ga0373925_0108309 | 3300037068 | Bacteria | 2144 |
| 144 | Ga0373925_0150014 | 3300037068 | Bacteria | 1830 |
| 145 | Ga0395899_0559870 | 3300037312 | Bacteria | 733 |
| 146 | Ga0395900_0059755 | 3300037418 | Bacteria | 3924 |
| 147 | Ga0395901_0114064 | 3300038443 | Bacteria | 2838 |
| 148 | Ga0436365_0726510 | 3300039437 | Bacteria | 711 |
| 149 | Ga0436365_0840537 | 3300039437 | Bacteria | 4304 |
| 150 | Ga0436365_1850866 | 3300039437 | Bacteria | 621 |
| 151 | Ga0436361_1014794 | 3300039447 | Bacteria | 5855 |
| 152 | Ga0495592_0012744 | 3300046454 | Bacteria | 6392 |
| 153 | Ga0495592_0023422 | 3300046454 | Bacteria | 4696 |
| 154 | Ga0495629_0066171 | 3300046459 | Plasmid | 2522 |
| 155 | Ga0495651_0004121 | 3300046462 | Bacteria | 11128 |
| 156 | Ga0495651_0013254 | 3300046462 | Bacteria | 6375 |
| 157 | Ga0495651_0071810 | 3300046462 | Bacteria | 2631 |
| 158 | Ga0495653_0052503 | 3300046463 | Bacteria | 3124 |
| 159 | Ga0495653_0085114 | 3300046463 | Unclassified | 2327 |
| 160 | Ga0495653_0186591 | 3300046463 | Bacteria | 1418 |
| 161 | Ga0495653_0500837 | 3300046463 | Unclassified | 757 |
| 162 | Ga0495662_0125961 | 3300046476 | Bacteria | 1258 |
| 163 | Ga0495664_0025183 | 3300046477 | Bacteria | 3463 |
| 164 | Ga0495664_0074198 | 3300046477 | Bacteria | 2035 |
| 165 | Ga0495608_0160113 | 3300046511 | Unclassified | 1431 |
| 166 | Ga0495610_0327786 | 3300046512 | Bacteria | 583 |
| 167 | Ga0495618_0072084 | 3300046514 | Unclassified | 2198 |
| 168 | Ga0495628_0022345 | 3300046516 | Bacteria | 5196 |
| 169 | Ga0495630_0023725 | 3300046517 | Bacteria | 4534 |
| 170 | Ga0495632_0215077 | 3300046519 | Bacteria | 871 |
| 171 | Ga0495663_0030147 | 3300046525 | Bacteria | 1606 |
| 172 | Ga0495652_0055014 | 3300046529 | Unclassified | 3386 |
| 173 | Ga0495652_0225545 | 3300046529 | Bacteria | 1405 |
| 174 | Ga0495640_0051996 | 3300046533 | Bacteria | 2814 |
| 175 | Ga0495640_0178035 | 3300046533 | Bacteria | 1356 |
| 176 | Ga0495587_0010045 | 3300046536 | Bacteria | 6045 |
| 177 | Ga0495587_0033245 | 3300046536 | Bacteria | 3114 |
| 178 | Ga0495587_0047114 | 3300046536 | Bacteria | 2557 |
| 179 | Ga0495598_0273936 | 3300046537 | Bacteria | 631 |
| 180 | Ga0495621_0166760 | 3300046539 | Bacteria | 873 |
| 181 | Ga0495645_0021049 | 3300046543 | Bacteria | 4713 |
| 182 | Ga0495645_0027689 | 3300046543 | Bacteria | 4118 |
| 183 | Ga0495645_0187453 | 3300046543 | Bacteria | 1412 |
| 184 | Ga0495633_0328976 | 3300046558 | Bacteria | 693 |
| 185 | Ga0495667_0034031 | 3300046559 | Bacteria | 3407 |
| 186 | Ga0495667_0035989 | 3300046559 | Bacteria | 3306 |
| 187 | Ga0495656_0381396 | 3300046615 | Bacteria | 735 |
| 188 | Ga0495656_0477652 | 3300046615 | Bacteria | 659 |
| 189 | Ga0495668_0288861 | 3300046616 | Bacteria | 899 |
| 190 | Ga0495635_0009003 | 3300046663 | Bacteria | 6965 |
| 191 | Ga0495657_0080781 | 3300046675 | Unclassified | 2104 |
| 192 | Ga0495657_0523329 | 3300046675 | Unclassified | 690 |
| 193 | Ga0495599_0060827 | 3300046678 | Bacteria | 2361 |
| 194 | Ga0495623_0024754 | 3300046679 | Bacteria | 3866 |
| 195 | Ga0495623_0320012 | 3300046679 | Unclassified | 852 |
| 196 | Ga0495623_0400863 | 3300046679 | Unclassified | 738 |
| 197 | Ga0495646_0044914 | 3300046680 | Plasmid | 2700 |
| 198 | Ga0495647_0254962 | 3300046681 | Bacteria | 782 |
| 199 | Ga0495613_0154711 | 3300046689 | Bacteria | 1634 |
| 200 | Ga0495624_0248661 | 3300046690 | Bacteria | 1075 |
| 201 | Ga0495600_0019017 | 3300046809 | Bacteria | 4384 |
| 202 | Ga0495600_0109747 | 3300046809 | Unclassified | 1796 |
| 203 | Ga0495604_0008798 | 3300047317 | Bacteria | 7980 |
| 204 | Ga0495604_0011702 | 3300047317 | Bacteria | 6977 |
| 205 | Ga0495674_0039099 | 3300047319 | Bacteria | 4253 |
| 206 | Ga0495674_0175349 | 3300047319 | Bacteria | 1787 |
| 207 | Ga0495674_0274108 | 3300047319 | Bacteria | 1383 |
| 208 | Ga0495676_0222568 | 3300047321 | Bacteria | 1300 |
| 209 | Ga0495676_0346858 | 3300047321 | Unclassified | 993 |
| 210 | Ga0495680_0007713 | 3300047322 | Bacteria | 9828 |
| 211 | Ga0495680_0073359 | 3300047322 | Bacteria | 2601 |
| 212 | Ga0495684_0220121 | 3300047471 | Unclassified | 1392 |
| 213 | Ga0495684_0596357 | 3300047471 | Unclassified | 746 |
| 214 | Ga0495593_0093798 | 3300047673 | Unclassified | 1544 |
| 215 | Ga0495602_0019971 | 3300048088 | Bacteria | 6632 |
| 216 | Ga0495602_0037578 | 3300048088 | Plasmid | 4490 |
| 217 | Ga0495602_0109984 | 3300048088 | Bacteria | 2241 |
| 218 | Ga0495615_0083005 | 3300048090 | Bacteria | 882 |
| 219 | Ga0495615_0096975 | 3300048090 | Bacteria | 828 |
| 220 | Ga0496102_0127078 | 3300048905 | Bacteria | 2384 |
| 221 | Ga0496104_0013527 | 3300048907 | Bacteria | 7353 |
| 222 | Ga0496105_0069122 | 3300048908 | Bacteria | 2919 |
| 223 | Ga0496105_1012434 | 3300048908 | Bacteria | 621 |
| 224 | Ga0496107_0238858 | 3300048910 | Bacteria | 1352 |
| 225 | Ga0496109_0395433 | 3300048912 | Bacteria | 1306 |
| 226 | Ga0496110_0712305 | 3300048913 | Bacteria | 906 |
| 227 | Ga0496115_0489965 | 3300048918 | Bacteria | 989 |
| 228 | Ga0496115_0642146 | 3300048918 | Bacteria | 840 |
| 229 | Ga0496126_0009492 | 3300048929 | Bacteria | 10322 |
| 230 | Ga0501033_0178964 | 3300049570 | Bacteria | 1521 |
| 231 | Ga0501034_0006268 | 3300049571 | Bacteria | 12796 |
| 232 | Ga0501037_0572118 | 3300049573 | Bacteria | 761 |
| 233 | Ga0501039_0282527 | 3300049575 | Bacteria | 1305 |
| 234 | Ga0501041_0214358 | 3300049577 | Bacteria | 1208 |
| 235 | Ga0501043_0245500 | 3300049579 | Bacteria | 1380 |
| 236 | Ga0501047_0102985 | 3300049581 | Bacteria | 2734 |
| 237 | Ga0501047_0103546 | 3300049581 | Bacteria | 2727 |
| 238 | Ga0501067_0227544 | 3300049583 | Bacteria | 1038 |
| 239 | Ga0501067_0335370 | 3300049583 | Bacteria | 842 |
| 240 | Ga0501070_0047131 | 3300049586 | Bacteria | 3583 |
| 241 | Ga0501071_0013890 | 3300049587 | Bacteria | 5499 |
| 242 | Ga0501071_0339392 | 3300049587 | Bacteria | 1142 |
| 243 | Ga0501083_0170010 | 3300049744 | Unclassified | 1425 |
| 244 | Ga0501083_0414068 | 3300049744 | Bacteria | 877 |
| 245 | Ga0501035_0078239 | 3300049822 | Bacteria | 2922 |
| 246 | Ga0501044_0201330 | 3300049823 | Bacteria | 1949 |
| 247 | Ga0501044_0465624 | 3300049823 | Bacteria | 1169 |
| 248 | Ga0501044_0720031 | 3300049823 | Bacteria | 882 |
| 249 | nmdc:mga03683_165391_c1 | 3300050489 | Bacteria | 1004 |
| 250 | nmdc:mga00v17_800617_c1 | 3300050491 | Bacteria | 600 |
| 251 | nmdc:mga0k408_270927_c1 | 3300050493 | Bacteria | 1014 |
| 252 | nmdc:mga06z11_554604_c1 | 3300050494 | Bacteria | 698 |
| 253 | nmdc:mga0qj67_412_c1 | 3300050509 | Bacteria | 29289 |
| 254 | nmdc:mga0qj67_56980_c1 | 3300050509 | Bacteria | 1973 |
| 255 | nmdc:mga06r32_24825_c1 | 3300050510 | Bacteria | 5570 |
| 256 | nmdc:mga0n895_1499360_c1 | 3300050512 | Bacteria | 641 |
| 257 | nmdc:mga0n895_305656_c1 | 3300050512 | Bacteria | 1612 |
| 258 | nmdc:mga0rr50_194073_c1 | 3300050513 | Unclassified | 1665 |
| 259 | nmdc:mga0rr50_643507_c1 | 3300050513 | Bacteria | 904 |
| 260 | nmdc:mga08x19_256030_c1 | 3300050514 | Bacteria | 1209 |
| 261 | nmdc:mga0a205_1144207_c1 | 3300050515 | Bacteria | 626 |
| 262 | Ga0495601_0000936 | 3300053077 | Bacteria | 15866 |
| 263 | Ga0495601_0007030 | 3300053077 | Bacteria | 6594 |
| 264 | Ga0495601_0155044 | 3300053077 | Bacteria | 1495 |
| 265 | Ga0495612_0002878 | 3300053078 | Bacteria | 7131 |
| 266 | Ga0495612_0007051 | 3300053078 | Bacteria | 4598 |
| 267 | Ga0495612_0077777 | 3300053078 | Bacteria | 1390 |
| 268 | Ga0500610_0072668 | 3300053079 | Bacteria | 1794 |
| 269 | Ga0495595_0003768 | 3300053084 | Bacteria | 6031 |
| 270 | Ga0495595_0036650 | 3300053084 | Bacteria | 2226 |
| 271 | Ga0495595_0248644 | 3300053084 | Bacteria | 890 |
| 272 | Ga0495619_0009550 | 3300053085 | Bacteria | 6121 |
| 273 | Ga0495619_0013649 | 3300053085 | Bacteria | 5120 |
| 274 | Ga0495619_0024462 | 3300053085 | Bacteria | 3873 |
| 275 | Ga0495619_0262173 | 3300053085 | Bacteria | 1197 |
| 276 | Ga0500593_013416 | 3300053117 | Bacteria | 3499 |
| 277 | Ga0500636_0035571 | 3300053177 | Bacteria | 2947 |
| 278 | Ga0500645_135445 | 3300053730 | Bacteria | 683 |
| 279 | Ga0501084_0729428 | 3300054114 | Bacteria | 835 |
| 280 | Ga0501082_0000099 | 3300060353 | Bacteria | 66846 |
| 281 | Ga0501082_0164686 | 3300060353 | Bacteria | 1927 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035116 | Ga0373945_0449415 | Ga0373945_0449415_11_436 | 141 |
| 2 | 3300050491 | nmdc:mga00v17_800617_c1 | nmdc:mga00v17_800617_c1_62_520 | 142 |
| 3 | 3300046615 | Ga0495656_0477652 | Ga0495656_0477652_217_648 | 143 |
| 4 | 3300050494 | nmdc:mga06z11_554604_c1 | nmdc:mga06z11_554604_c1_217_687 | 144 |
| 5 | 3300005290 | Ga0065712_10562463 | Ga0065712_105624631 | 147 |
| 6 | 3300005328 | Ga0070676_10419164 | Ga0070676_104191641 | 147 |
| 7 | 3300005331 | Ga0070670_100477555 | Ga0070670_1004775551 | 147 |
| 8 | 3300005338 | Ga0068868_100097148 | Ga0068868_1000971484 | 147 |
| 9 | 3300005355 | Ga0070671_100948741 | Ga0070671_1009487411 | 147 |
| 10 | 3300005356 | Ga0070674_100008903 | Ga0070674_1000089032 | 147 |
| 11 | 3300005364 | Ga0070673_100062659 | Ga0070673_1000626592 | 147 |
| 12 | 3300005365 | Ga0070688_100598560 | Ga0070688_1005985601 | 147 |
| 13 | 3300005456 | Ga0070678_100003451 | Ga0070678_1000034514 | 147 |
| 14 | 3300005459 | Ga0068867_100005652 | Ga0068867_1000056523 | 147 |
| 15 | 3300005543 | Ga0070672_100027477 | Ga0070672_1000274774 | 147 |
| 16 | 3300005544 | Ga0070686_100125730 | Ga0070686_1001257301 | 147 |
| 17 | 3300005718 | Ga0068866_10455923 | Ga0068866_104559232 | 147 |
| 18 | 3300006881 | Ga0068865_100363381 | Ga0068865_1003633813 | 147 |
| 19 | 3300013297 | Ga0157378_10317368 | Ga0157378_103173682 | 147 |
| 20 | 3300014326 | Ga0157380_10041355 | Ga0157380_100413555 | 147 |
| 21 | 3300025893 | Ga0207682_10001074 | Ga0207682_100010746 | 147 |
| 22 | 3300025899 | Ga0207642_10393693 | Ga0207642_103936931 | 147 |
| 23 | 3300025907 | Ga0207645_10063809 | Ga0207645_100638093 | 147 |
| 24 | 3300025926 | Ga0207659_10251880 | Ga0207659_102518802 | 147 |
| 25 | 3300025931 | Ga0207644_10070167 | Ga0207644_100701674 | 147 |
| 26 | 3300025937 | Ga0207669_10002350 | Ga0207669_100023503 | 147 |
| 27 | 3300025940 | Ga0207691_10001292 | Ga0207691_100012923 | 147 |
| 28 | 3300025960 | Ga0207651_10056609 | Ga0207651_100566095 | 147 |
| 29 | 3300026089 | Ga0207648_10006883 | Ga0207648_100068835 | 147 |
| 30 | 3300026121 | Ga0207683_10001466 | Ga0207683_100014664 | 147 |
| 31 | 3300046525 | Ga0495663_0030147 | Ga0495663_0030147_130_648 | 147 |
| 32 | 3300046537 | Ga0495598_0273936 | Ga0495598_0273936_41_553 | 147 |
| 33 | 3300046539 | Ga0495621_0166760 | Ga0495621_0166760_321_839 | 147 |
| 34 | 3300046558 | Ga0495633_0328976 | Ga0495633_0328976_123_641 | 147 |
| 35 | 3300048090 | Ga0495615_0096975 | Ga0495615_0096975_131_643 | 147 |
| 36 | 3300025926 | Ga0207659_10979613 | Ga0207659_109796131 | 148 |
| 37 | 3300005340 | Ga0070689_100636568 | Ga0070689_1006365681 | 149 |
| 38 | 3300005435 | Ga0070714_100046889 | Ga0070714_1000468892 | 149 |
| 39 | 3300005439 | Ga0070711_100016233 | Ga0070711_1000162332 | 149 |
| 40 | 3300006175 | Ga0070712_100188945 | Ga0070712_1001889452 | 149 |
| 41 | 3300006844 | Ga0075428_100492365 | Ga0075428_1004923652 | 149 |
| 42 | 3300006852 | Ga0075433_10313177 | Ga0075433_103131772 | 149 |
| 43 | 3300009553 | Ga0105249_12141475 | Ga0105249_121414751 | 149 |
| 44 | 3300025898 | Ga0207692_10044207 | Ga0207692_100442072 | 149 |
| 45 | 3300025906 | Ga0207699_10018555 | Ga0207699_100185553 | 149 |
| 46 | 3300025916 | Ga0207663_10087422 | Ga0207663_100874222 | 149 |
| 47 | 3300025929 | Ga0207664_10373188 | Ga0207664_103731882 | 149 |
| 48 | 3300048910 | Ga0496107_0238858 | Ga0496107_0238858_235_693 | 149 |
| 49 | 3300048913 | Ga0496110_0712305 | Ga0496110_0712305_158_751 | 149 |
| 50 | 3300050512 | nmdc:mga0n895_1499360_c1 | nmdc:mga0n895_1499360_c1_40_498 | 149 |
| 51 | 3300050515 | nmdc:mga0a205_1144207_c1 | nmdc:mga0a205_1144207_c1_61_519 | 149 |
| 52 | 3300035117 | Ga0373953_0134385 | Ga0373953_0134385_554_1015 | 150 |
| 53 | 3300035170 | Ga0373943_0550398 | Ga0373943_0550398_150_611 | 150 |
| 54 | 3300035172 | Ga0373955_0016279 | Ga0373955_0016279_3173_3634 | 150 |
| 55 | 3300047471 | Ga0495684_0596357 | Ga0495684_0596357_213_674 | 150 |
| 56 | 3300005364 | Ga0070673_101164175 | Ga0070673_1011641751 | 151 |
| 57 | 3300053079 | Ga0500610_0072668 | Ga0500610_0072668_29_487 | 152 |
| 58 | 3300006880 | Ga0075429_100643476 | Ga0075429_1006434762 | 153 |
| 59 | 3300050513 | nmdc:mga0rr50_194073_c1 | nmdc:mga0rr50_194073_c1_50_520 | 153 |
| 60 | 3300049570 | Ga0501033_0178964 | Ga0501033_0178964_217_693 | 156 |
| 61 | 3300049823 | Ga0501044_0720031 | Ga0501044_0720031_253_729 | 156 |
| 62 | 3300050513 | nmdc:mga0rr50_643507_c1 | nmdc:mga0rr50_643507_c1_34_549 | 156 |
| 63 | 3300005518 | Ga0070699_100080686 | Ga0070699_1000806863 | 158 |
| 64 | 3300048088 | Ga0495602_0109984 | Ga0495602_0109984_57_608 | 160 |
| 65 | 3300025933 | Ga0207706_10231943 | Ga0207706_102319433 | 161 |
| 66 | 3300046519 | Ga0495632_0215077 | Ga0495632_0215077_313_828 | 161 |
| 67 | 3300048912 | Ga0496109_0395433 | Ga0496109_0395433_107_670 | 161 |
| 68 | 3300050509 | nmdc:mga0qj67_412_c1 | nmdc:mga0qj67_412_c1_18816_19313 | 163 |
| 69 | 3300053730 | Ga0500645_135445 | Ga0500645_135445_147_644 | 163 |
| 70 | iso_pu_bacteria | 2894232714 | 2894233330 | 163 |
| 71 | 3300005436 | Ga0070713_100186947 | Ga0070713_1001869472 | 164 |
| 72 | 3300005434 | Ga0070709_10273701 | Ga0070709_102737012 | 165 |
| 73 | 3300005439 | Ga0070711_100805960 | Ga0070711_1008059601 | 165 |
| 74 | 3300005937 | Ga0081455_10010247 | Ga0081455_100102476 | 165 |
| 75 | 3300025916 | Ga0207663_10483963 | Ga0207663_104839632 | 165 |
| 76 | 3300035118 | Ga0373954_0098400 | Ga0373954_0098400_170_676 | 165 |
| 77 | 3300035724 | Ga0373933_0026069 | Ga0373933_0026069_660_1166 | 165 |
| 78 | 3300036401 | Ga0373937_0005874 | Ga0373937_0005874_1940_2446 | 165 |
| 79 | 3300037068 | Ga0373925_0108309 | Ga0373925_0108309_911_1417 | 165 |
| 80 | 3300037068 | Ga0373925_0150014 | Ga0373925_0150014_829_1341 | 165 |
| 81 | 3300046454 | Ga0495592_0012744 | Ga0495592_0012744_1095_1601 | 165 |
| 82 | 3300046462 | Ga0495651_0013254 | Ga0495651_0013254_700_1206 | 165 |
| 83 | 3300046463 | Ga0495653_0085114 | Ga0495653_0085114_1395_1901 | 165 |
| 84 | 3300046477 | Ga0495664_0074198 | Ga0495664_0074198_720_1226 | 165 |
| 85 | 3300046511 | Ga0495608_0160113 | Ga0495608_0160113_901_1407 | 165 |
| 86 | 3300046514 | Ga0495618_0072084 | Ga0495618_0072084_348_860 | 165 |
| 87 | 3300046529 | Ga0495652_0055014 | Ga0495652_0055014_435_941 | 165 |
| 88 | 3300046536 | Ga0495587_0010045 | Ga0495587_0010045_3190_3696 | 165 |
| 89 | 3300046543 | Ga0495645_0021049 | Ga0495645_0021049_35_541 | 165 |
| 90 | 3300046559 | Ga0495667_0034031 | Ga0495667_0034031_295_801 | 165 |
| 91 | 3300046675 | Ga0495657_0523329 | Ga0495657_0523329_15_521 | 165 |
| 92 | 3300046679 | Ga0495623_0024754 | Ga0495623_0024754_911_1417 | 165 |
| 93 | 3300046809 | Ga0495600_0019017 | Ga0495600_0019017_455_961 | 165 |
| 94 | 3300047317 | Ga0495604_0011702 | Ga0495604_0011702_4695_5201 | 165 |
| 95 | 3300047319 | Ga0495674_0175349 | Ga0495674_0175349_333_839 | 165 |
| 96 | 3300048088 | Ga0495602_0037578 | Ga0495602_0037578_2451_2957 | 165 |
| 97 | 3300048090 | Ga0495615_0083005 | Ga0495615_0083005_55_558 | 165 |
| 98 | 3300048907 | Ga0496104_0013527 | Ga0496104_0013527_3494_4000 | 165 |
| 99 | 3300048908 | Ga0496105_0069122 | Ga0496105_0069122_2373_2879 | 165 |
| 100 | 3300049571 | Ga0501034_0006268 | Ga0501034_0006268_9123_9623 | 165 |
| 101 | 3300049581 | Ga0501047_0103546 | Ga0501047_0103546_501_1001 | 165 |
| 102 | 3300049586 | Ga0501070_0047131 | Ga0501070_0047131_446_946 | 165 |
| 103 | 3300049587 | Ga0501071_0013890 | Ga0501071_0013890_725_1225 | 165 |
| 104 | 3300049744 | Ga0501083_0170010 | Ga0501083_0170010_785_1285 | 165 |
| 105 | 3300049823 | Ga0501044_0201330 | Ga0501044_0201330_725_1225 | 165 |
| 106 | 3300053077 | Ga0495601_0000936 | Ga0495601_0000936_9434_9940 | 165 |
| 107 | 3300053078 | Ga0495612_0002878 | Ga0495612_0002878_1437_1943 | 165 |
| 108 | 3300053084 | Ga0495595_0003768 | Ga0495595_0003768_2363_2869 | 165 |
| 109 | 3300053085 | Ga0495619_0009550 | Ga0495619_0009550_2256_2762 | 165 |
| 110 | 3300053177 | Ga0500636_0035571 | Ga0500636_0035571_1160_1780 | 165 |
| 111 | 3300009093 | Ga0105240_11061450 | Ga0105240_110614501 | 166 |
| 112 | 3300013308 | Ga0157375_11062300 | Ga0157375_110623001 | 166 |
| 113 | 3300025919 | Ga0207657_10439092 | Ga0207657_104390921 | 166 |
| 114 | 3300035172 | Ga0373955_0032717 | Ga0373955_0032717_538_1056 | 166 |
| 115 | 3300035724 | Ga0373933_0055523 | Ga0373933_0055523_1640_2158 | 166 |
| 116 | 3300036401 | Ga0373937_0097992 | Ga0373937_0097992_1685_2203 | 166 |
| 117 | 3300037312 | Ga0395899_0559870 | Ga0395899_0559870_59_577 | 166 |
| 118 | 3300037418 | Ga0395900_0059755 | Ga0395900_0059755_2833_3351 | 166 |
| 119 | 3300038443 | Ga0395901_0114064 | Ga0395901_0114064_1750_2268 | 166 |
| 120 | 3300039437 | Ga0436365_1850866 | Ga0436365_1850866_58_558 | 166 |
| 121 | 3300046462 | Ga0495651_0071810 | Ga0495651_0071810_441_959 | 166 |
| 122 | 3300046463 | Ga0495653_0500837 | Ga0495653_0500837_63_581 | 166 |
| 123 | 3300046536 | Ga0495587_0047114 | Ga0495587_0047114_557_1075 | 166 |
| 124 | 3300046679 | Ga0495623_0400863 | Ga0495623_0400863_208_726 | 166 |
| 125 | 3300047322 | Ga0495680_0073359 | Ga0495680_0073359_2037_2555 | 166 |
| 126 | 3300048905 | Ga0496102_0127078 | Ga0496102_0127078_110_685 | 166 |
| 127 | 3300048918 | Ga0496115_0489965 | Ga0496115_0489965_146_646 | 166 |
| 128 | 3300053084 | Ga0495595_0036650 | Ga0495595_0036650_1691_2209 | 166 |
| 129 | 3300053085 | Ga0495619_0024462 | Ga0495619_0024462_2656_3174 | 166 |
| 130 | 3300003203 | JGI25406J46586_10042057 | JGI25406J46586_100420572 | 167 |
| 131 | 3300005616 | Ga0068852_100725741 | Ga0068852_1007257412 | 167 |
| 132 | 3300005985 | Ga0081539_10005675 | Ga0081539_100056757 | 167 |
| 133 | 3300006058 | Ga0075432_10228466 | Ga0075432_102284661 | 167 |
| 134 | 3300009553 | Ga0105249_10521539 | Ga0105249_105215392 | 167 |
| 135 | 3300025937 | Ga0207669_10850924 | Ga0207669_108509241 | 167 |
| 136 | 3300025972 | Ga0207668_10739791 | Ga0207668_107397912 | 167 |
| 137 | 3300031824 | Ga0307413_10137679 | Ga0307413_101376792 | 167 |
| 138 | 3300039447 | Ga0436361_1014794 | Ga0436361_1014794_2158_2673 | 167 |
| 139 | 3300046615 | Ga0495656_0381396 | Ga0495656_0381396_215_721 | 167 |
| 140 | 3300049573 | Ga0501037_0572118 | Ga0501037_0572118_95_613 | 167 |
| 141 | 3300049579 | Ga0501043_0245500 | Ga0501043_0245500_73_663 | 167 |
| 142 | 3300049581 | Ga0501047_0102985 | Ga0501047_0102985_634_1224 | 167 |
| 143 | 3300049583 | Ga0501067_0335370 | Ga0501067_0335370_108_620 | 167 |
| 144 | 3300049822 | Ga0501035_0078239 | Ga0501035_0078239_312_902 | 167 |
| 145 | 3300049823 | Ga0501044_0465624 | Ga0501044_0465624_207_725 | 167 |
| 146 | 3300060353 | Ga0501082_0164686 | Ga0501082_0164686_591_1103 | 167 |
| 147 | 3300005331 | Ga0070670_100493083 | Ga0070670_1004930831 | 168 |
| 148 | 3300005338 | Ga0068868_100272661 | Ga0068868_1002726611 | 168 |
| 149 | 3300005366 | Ga0070659_100937205 | Ga0070659_1009372051 | 168 |
| 150 | 3300005434 | Ga0070709_10092715 | Ga0070709_100927151 | 168 |
| 151 | 3300005436 | Ga0070713_100007056 | Ga0070713_1000070565 | 168 |
| 152 | 3300005437 | Ga0070710_10024090 | Ga0070710_100240902 | 168 |
| 153 | 3300005439 | Ga0070711_100509065 | Ga0070711_1005090653 | 168 |
| 154 | 3300005444 | Ga0070694_100835483 | Ga0070694_1008354831 | 168 |
| 155 | 3300005577 | Ga0068857_100064125 | Ga0068857_1000641252 | 168 |
| 156 | 3300005578 | Ga0068854_100981631 | Ga0068854_1009816311 | 168 |
| 157 | 3300005618 | Ga0068864_100017854 | Ga0068864_1000178543 | 168 |
| 158 | 3300005844 | Ga0068862_100294337 | Ga0068862_1002943372 | 168 |
| 159 | 3300005937 | Ga0081455_10009303 | Ga0081455_100093033 | 168 |
| 160 | 3300006028 | Ga0070717_10006183 | Ga0070717_100061832 | 168 |
| 161 | 3300006028 | Ga0070717_10139525 | Ga0070717_101395254 | 168 |
| 162 | 3300006163 | Ga0070715_10000386 | Ga0070715_1000038612 | 168 |
| 163 | 3300006173 | Ga0070716_100021061 | Ga0070716_1000210616 | 168 |
| 164 | 3300006846 | Ga0075430_100000509 | Ga0075430_1000005098 | 168 |
| 165 | 3300006847 | Ga0075431_100215285 | Ga0075431_1002152853 | 168 |
| 166 | 3300009174 | Ga0105241_10723702 | Ga0105241_107237021 | 168 |
| 167 | 3300009551 | Ga0105238_10021249 | Ga0105238_100212496 | 168 |
| 168 | 3300009551 | Ga0105238_10087339 | Ga0105238_100873395 | 168 |
| 169 | 3300009553 | Ga0105249_10863117 | Ga0105249_108631172 | 168 |
| 170 | 3300014325 | Ga0163163_10054773 | Ga0163163_100547733 | 168 |
| 171 | 3300014968 | Ga0157379_10228760 | Ga0157379_102287602 | 168 |
| 172 | 3300025905 | Ga0207685_10036450 | Ga0207685_100364502 | 168 |
| 173 | 3300025908 | Ga0207643_10086498 | Ga0207643_100864982 | 168 |
| 174 | 3300025915 | Ga0207693_10080339 | Ga0207693_100803392 | 168 |
| 175 | 3300025925 | Ga0207650_10078523 | Ga0207650_100785232 | 168 |
| 176 | 3300025928 | Ga0207700_10009301 | Ga0207700_100093015 | 168 |
| 177 | 3300025928 | Ga0207700_10505715 | Ga0207700_105057151 | 168 |
| 178 | 3300025935 | Ga0207709_10102229 | Ga0207709_101022292 | 168 |
| 179 | 3300025939 | Ga0207665_10009694 | Ga0207665_100096941 | 168 |
| 180 | 3300025939 | Ga0207665_10197339 | Ga0207665_101973393 | 168 |
| 181 | 3300025944 | Ga0207661_10118826 | Ga0207661_101188263 | 168 |
| 182 | 3300026041 | Ga0207639_10336929 | Ga0207639_103369292 | 168 |
| 183 | 3300026088 | Ga0207641_10286222 | Ga0207641_102862222 | 168 |
| 184 | 3300026095 | Ga0207676_11260512 | Ga0207676_112605121 | 168 |
| 185 | 3300026116 | Ga0207674_10018581 | Ga0207674_100185813 | 168 |
| 186 | 3300026118 | Ga0207675_100159792 | Ga0207675_1001597922 | 168 |
| 187 | 3300028380 | Ga0268265_10386378 | Ga0268265_103863782 | 168 |
| 188 | 3300035111 | Ga0373923_0029897 | Ga0373923_0029897_1521_2072 | 168 |
| 189 | 3300035113 | Ga0373936_0129456 | Ga0373936_0129456_447_998 | 168 |
| 190 | 3300035116 | Ga0373945_0339111 | Ga0373945_0339111_22_573 | 168 |
| 191 | 3300035120 | Ga0373957_0081604 | Ga0373957_0081604_531_1052 | 168 |
| 192 | 3300035410 | Ga0373924_0022518 | Ga0373924_0022518_1027_1578 | 168 |
| 193 | 3300035692 | Ga0373935_0017787 | Ga0373935_0017787_402_953 | 168 |
| 194 | 3300035695 | Ga0373927_0288338 | Ga0373927_0288338_146_697 | 168 |
| 195 | 3300035724 | Ga0373933_0070210 | Ga0373933_0070210_1402_1953 | 168 |
| 196 | 3300035725 | Ga0373947_0232778 | Ga0373947_0232778_63_614 | 168 |
| 197 | 3300036401 | Ga0373937_0034921 | Ga0373937_0034921_1058_1609 | 168 |
| 198 | 3300039437 | Ga0436365_0726510 | Ga0436365_0726510_108_614 | 168 |
| 199 | 3300039437 | Ga0436365_0840537 | Ga0436365_0840537_2515_3099 | 168 |
| 200 | 3300046454 | Ga0495592_0023422 | Ga0495592_0023422_1062_1613 | 168 |
| 201 | 3300046459 | Ga0495629_0066171 | Ga0495629_0066171_976_1527 | 168 |
| 202 | 3300046462 | Ga0495651_0004121 | Ga0495651_0004121_1402_1953 | 168 |
| 203 | 3300046463 | Ga0495653_0052503 | Ga0495653_0052503_1853_2404 | 168 |
| 204 | 3300046516 | Ga0495628_0022345 | Ga0495628_0022345_3735_4286 | 168 |
| 205 | 3300046533 | Ga0495640_0051996 | Ga0495640_0051996_402_953 | 168 |
| 206 | 3300046536 | Ga0495587_0033245 | Ga0495587_0033245_2414_2965 | 168 |
| 207 | 3300046543 | Ga0495645_0027689 | Ga0495645_0027689_772_1323 | 168 |
| 208 | 3300046559 | Ga0495667_0035989 | Ga0495667_0035989_111_662 | 168 |
| 209 | 3300046663 | Ga0495635_0009003 | Ga0495635_0009003_1002_1553 | 168 |
| 210 | 3300046675 | Ga0495657_0080781 | Ga0495657_0080781_1087_1638 | 168 |
| 211 | 3300046678 | Ga0495599_0060827 | Ga0495599_0060827_892_1443 | 168 |
| 212 | 3300046679 | Ga0495623_0320012 | Ga0495623_0320012_17_568 | 168 |
| 213 | 3300046680 | Ga0495646_0044914 | Ga0495646_0044914_1335_1886 | 168 |
| 214 | 3300046689 | Ga0495613_0154711 | Ga0495613_0154711_569_1120 | 168 |
| 215 | 3300046809 | Ga0495600_0109747 | Ga0495600_0109747_1001_1522 | 168 |
| 216 | 3300047317 | Ga0495604_0008798 | Ga0495604_0008798_3886_4437 | 168 |
| 217 | 3300047319 | Ga0495674_0039099 | Ga0495674_0039099_1054_1605 | 168 |
| 218 | 3300047321 | Ga0495676_0346858 | Ga0495676_0346858_325_876 | 168 |
| 219 | 3300047322 | Ga0495680_0007713 | Ga0495680_0007713_5639_6190 | 168 |
| 220 | 3300047471 | Ga0495684_0220121 | Ga0495684_0220121_855_1376 | 168 |
| 221 | 3300047673 | Ga0495593_0093798 | Ga0495593_0093798_63_614 | 168 |
| 222 | 3300048088 | Ga0495602_0019971 | Ga0495602_0019971_1932_2483 | 168 |
| 223 | 3300048908 | Ga0496105_1012434 | Ga0496105_1012434_67_606 | 168 |
| 224 | 3300048918 | Ga0496115_0642146 | Ga0496115_0642146_56_577 | 168 |
| 225 | 3300049575 | Ga0501039_0282527 | Ga0501039_0282527_10_528 | 168 |
| 226 | 3300049577 | Ga0501041_0214358 | Ga0501041_0214358_482_1000 | 168 |
| 227 | 3300049587 | Ga0501071_0339392 | Ga0501071_0339392_50_568 | 168 |
| 228 | 3300049744 | Ga0501083_0414068 | Ga0501083_0414068_112_630 | 168 |
| 229 | 3300050509 | nmdc:mga0qj67_56980_c1 | nmdc:mga0qj67_56980_c1_1087_1665 | 168 |
| 230 | 3300050510 | nmdc:mga06r32_24825_c1 | nmdc:mga06r32_24825_c1_63_641 | 168 |
| 231 | 3300050514 | nmdc:mga08x19_256030_c1 | nmdc:mga08x19_256030_c1_585_1097 | 168 |
| 232 | 3300053077 | Ga0495601_0007030 | Ga0495601_0007030_745_1296 | 168 |
| 233 | 3300053078 | Ga0495612_0007051 | Ga0495612_0007051_2918_3469 | 168 |
| 234 | 3300053085 | Ga0495619_0013649 | Ga0495619_0013649_4482_5033 | 168 |
| 235 | 3300054114 | Ga0501084_0729428 | Ga0501084_0729428_149_658 | 168 |
| 236 | 3300006028 | Ga0070717_10356844 | Ga0070717_103568442 | 169 |
| 237 | 3300006028 | Ga0070717_10979444 | Ga0070717_109794441 | 169 |
| 238 | 3300006175 | Ga0070712_100004185 | Ga0070712_1000041855 | 169 |
| 239 | 3300006880 | Ga0075429_100253439 | Ga0075429_1002534392 | 169 |
| 240 | 3300007076 | Ga0075435_100523320 | Ga0075435_1005233202 | 169 |
| 241 | 3300025915 | Ga0207693_10000434 | Ga0207693_1000043422 | 169 |
| 242 | 3300025928 | Ga0207700_10222910 | Ga0207700_102229103 | 169 |
| 243 | 3300031712 | Ga0265342_10519394 | Ga0265342_105193941 | 169 |
| 244 | 3300035089 | Ga0373944_0094843 | Ga0373944_0094843_66_581 | 169 |
| 245 | 3300035171 | Ga0373946_0160871 | Ga0373946_0160871_225_740 | 169 |
| 246 | 3300035692 | Ga0373935_0486650 | Ga0373935_0486650_261_776 | 169 |
| 247 | 3300035725 | Ga0373947_0164715 | Ga0373947_0164715_550_1065 | 169 |
| 248 | 3300036401 | Ga0373937_0433959 | Ga0373937_0433959_684_1199 | 169 |
| 249 | 3300046463 | Ga0495653_0186591 | Ga0495653_0186591_202_717 | 169 |
| 250 | 3300046476 | Ga0495662_0125961 | Ga0495662_0125961_225_740 | 169 |
| 251 | 3300046477 | Ga0495664_0025183 | Ga0495664_0025183_701_1216 | 169 |
| 252 | 3300046517 | Ga0495630_0023725 | Ga0495630_0023725_729_1244 | 169 |
| 253 | 3300046529 | Ga0495652_0225545 | Ga0495652_0225545_219_734 | 169 |
| 254 | 3300046533 | Ga0495640_0178035 | Ga0495640_0178035_705_1220 | 169 |
| 255 | 3300046543 | Ga0495645_0187453 | Ga0495645_0187453_729_1244 | 169 |
| 256 | 3300046681 | Ga0495647_0254962 | Ga0495647_0254962_238_753 | 169 |
| 257 | 3300046690 | Ga0495624_0248661 | Ga0495624_0248661_357_872 | 169 |
| 258 | 3300047319 | Ga0495674_0274108 | Ga0495674_0274108_701_1216 | 169 |
| 259 | 3300047321 | Ga0495676_0222568 | Ga0495676_0222568_322_837 | 169 |
| 260 | 3300053077 | Ga0495601_0155044 | Ga0495601_0155044_729_1244 | 169 |
| 261 | 3300053078 | Ga0495612_0077777 | Ga0495612_0077777_701_1216 | 169 |
| 262 | 3300053084 | Ga0495595_0248644 | Ga0495595_0248644_251_766 | 169 |
| 263 | 3300053085 | Ga0495619_0262173 | Ga0495619_0262173_640_1155 | 169 |
| 264 | 3300005844 | Ga0068862_100710946 | Ga0068862_1007109461 | 170 |
| 265 | 3300009148 | Ga0105243_10082079 | Ga0105243_100820792 | 170 |
| 266 | 3300053117 | Ga0500593_013416 | Ga0500593_013416_1346_1900 | 170 |
| 267 | 3300060353 | Ga0501082_0000099 | Ga0501082_0000099_52895_53413 | 170 |
| 268 | 3300003203 | JGI25406J46586_10007080 | JGI25406J46586_100070802 | 171 |
| 269 | 3300005937 | Ga0081455_10022249 | Ga0081455_100222494 | 171 |
| 270 | 3300005985 | Ga0081539_10000966 | Ga0081539_100009665 | 171 |
| 271 | 3300006051 | Ga0075364_10037409 | Ga0075364_100374091 | 171 |
| 272 | 3300006177 | Ga0075362_10064801 | Ga0075362_100648013 | 171 |
| 273 | 3300006195 | Ga0075366_10014633 | Ga0075366_100146331 | 171 |
| 274 | 3300006871 | Ga0075434_100270090 | Ga0075434_1002700902 | 171 |
| 275 | 3300009176 | Ga0105242_10855317 | Ga0105242_108553172 | 171 |
| 276 | 3300046512 | Ga0495610_0327786 | Ga0495610_0327786_12_527 | 171 |
| 277 | 3300046616 | Ga0495668_0288861 | Ga0495668_0288861_212_727 | 171 |
| 278 | 3300048929 | Ga0496126_0009492 | Ga0496126_0009492_4436_4981 | 171 |
| 279 | 3300049583 | Ga0501067_0227544 | Ga0501067_0227544_90_605 | 171 |
| 280 | 3300050489 | nmdc:mga03683_165391_c1 | nmdc:mga03683_165391_c1_167_688 | 171 |
| 281 | 3300050493 | nmdc:mga0k408_270927_c1 | nmdc:mga0k408_270927_c1_90_611 | 171 |
| 282 | 3300050512 | nmdc:mga0n895_305656_c1 | nmdc:mga0n895_305656_c1_47_562 | 171 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4a1i-assembly1.cif.gz_A | ykud from b.subtilis | 0.9313 | 38 | 171 |
| 2mtz-assembly1.cif.gz_A | haddock model of bacillus subtilis l,d-transpeptidase in complex with a peptidoglycan hexamuropeptide | 0.8854 | 41 | 168 |
| 4lzh-assembly1.cif.gz_A | l,d-transpeptidase from klebsiella pneumoniae | 0.8429 | 36 | 169 |
| 2hkl-assembly3.cif.gz_C | crystal structure of enterococcus faecium l,d-transpeptidase c442s mutant | 0.8397 | 41 | 170 |
| 6fj1-assembly2.cif.gz_B | structure of the ldtfm-avibactam carbamoyl enzyme | 0.8297 | 37 | 171 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4a1iC02 | Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like | 0.928 | 38 | 171 | 2.40.440.10 |
| af_P75954_98_241_2.40.440.10 | Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like | 0.9051 | 37 | 170 | 2.40.440.10 |
| 4a1iC02 | Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like | 0.875 | 38 | 171 | 2.40.440.10 |
| af_P75954_98_241_2.40.440.10 | Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like | 0.839 | 37 | 170 | 2.40.440.10 |
| 5uwvD03 | Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like | 0.8207 | 41 | 171 | 2.40.440.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L9MI58-F1-model_v4 | L,D-transpeptidase family protein | 0.9876 | 44 | 171 |
GO:0005576
GO:0008360 GO:0016757 GO:0018104 GO:0071555 GO:0071972 |
| AF-A0A7G6U4F9-F1-model_v4 | L,D-transpeptidase | 0.9815 | 30 | 170 |
GO:0005576
GO:0008360 GO:0016757 GO:0018104 GO:0071555 GO:0071972 |
| AF-A0A6L9MI58-F1-model_v4 | L,D-transpeptidase family protein | 0.9725 | 44 | 171 |
GO:0005576
GO:0008360 GO:0016757 GO:0018104 GO:0071555 GO:0071972 |
| AF-A0A1U7D061-F1-model_v4 | Ykud domain-containing protein | 0.9696 | 63 | 170 |
GO:0005576
GO:0008360 GO:0016757 GO:0018104 GO:0071555 GO:0071972 |
| AF-A0A2S5MX16-F1-model_v4 | L,D-TPase catalytic domain-containing protein | 0.9682 | 27 | 170 |
GO:0005576
GO:0008360 GO:0016757 GO:0018104 GO:0071555 GO:0071972 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar