F384831

General Info

Members Datasets Scaffolds Average Seq Length
282 194 281 170

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100710946|Ga0068862_1007109461
Length 196
Sequence MRYHVASNGSAHGDAPGIGQGDFIRQLVRPLAGIACAIAVAGLFGTAPAQAREVVAFRDGSVSAGTIVVRTGERRLYYVMGDGRAIRYPVXXXKASKQWTGTTRIDGKYVKPAWSPPQEVRRDKPSLPDVIPGGSPRNPMGVAAMTLAGGEYAIHGTNVPSSIGGFVSYGCIRMFNQDVVDLYSRVSVGTTVMVVR

Samples

Sample ID Description Type Environment
1 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
93 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
96 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
97 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
98 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
99 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
100 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
101 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
102 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
136 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
142 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
187 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
188 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
191 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
192 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.9
Nodule 0.35
Rhizoplane 3.19
Rhizosphere 91.13
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10007080 3300003203 Bacteria 5140
2 JGI25406J46586_10042057 3300003203 Bacteria 1603
3 Ga0065712_10562463 3300005290 Bacteria 611
4 Ga0070676_10419164 3300005328 Bacteria 935
5 Ga0070670_100477555 3300005331 Bacteria 1107
6 Ga0070670_100493083 3300005331 Bacteria 1089
7 Ga0068868_100097148 3300005338 Bacteria 2380
8 Ga0068868_100272661 3300005338 Bacteria 1430
9 Ga0070689_100636568 3300005340 Bacteria 926
10 Ga0070671_100948741 3300005355 Bacteria 752
11 Ga0070674_100008903 3300005356 Bacteria 5993
12 Ga0070673_100062659 3300005364 Bacteria 2955
13 Ga0070673_101164175 3300005364 Bacteria 722
14 Ga0070688_100598560 3300005365 Bacteria 843
15 Ga0070659_100937205 3300005366 Bacteria 758
16 Ga0070709_10092715 3300005434 Unclassified 1995
17 Ga0070709_10273701 3300005434 Unclassified 1224
18 Ga0070714_100046889 3300005435 Unclassified 3668
19 Ga0070713_100007056 3300005436 Bacteria 7850
20 Ga0070713_100186947 3300005436 Unclassified 1865
21 Ga0070710_10024090 3300005437 Bacteria 3207
22 Ga0070711_100016233 3300005439 Unclassified 4726
23 Ga0070711_100509065 3300005439 Bacteria 994
24 Ga0070711_100805960 3300005439 Unclassified 797
25 Ga0070694_100835483 3300005444 Bacteria 757
26 Ga0070678_100003451 3300005456 Bacteria 8815
27 Ga0068867_100005652 3300005459 Bacteria 8864
28 Ga0070699_100080686 3300005518 Bacteria 2835
29 Ga0070672_100027477 3300005543 Bacteria 4244
30 Ga0070686_100125730 3300005544 Bacteria 1766
31 Ga0068857_100064125 3300005577 Bacteria 3266
32 Ga0068854_100981631 3300005578 Bacteria 747
33 Ga0068852_100725741 3300005616 Bacteria 1005
34 Ga0068864_100017854 3300005618 Bacteria 5918
35 Ga0068866_10455923 3300005718 Bacteria 837
36 Ga0068862_100294337 3300005844 Bacteria 1492
37 Ga0068862_100710946 3300005844 Bacteria 974
38 Ga0081455_10009303 3300005937 Bacteria 10116
39 Ga0081455_10010247 3300005937 Bacteria 9531
40 Ga0081455_10022249 3300005937 Bacteria 5929
41 Ga0081539_10000966 3300005985 Bacteria 53690
42 Ga0081539_10005675 3300005985 Bacteria 12525
43 Ga0070717_10006183 3300006028 Bacteria 8789
44 Ga0070717_10139525 3300006028 Bacteria 2090
45 Ga0070717_10356844 3300006028 Bacteria 1308
46 Ga0070717_10979444 3300006028 Bacteria 770
47 Ga0075364_10037409 3300006051 Bacteria 3142
48 Ga0075432_10228466 3300006058 Bacteria 747
49 Ga0070715_10000386 3300006163 Bacteria 11051
50 Ga0070716_100021061 3300006173 Unclassified 3431
51 Ga0070712_100004185 3300006175 Bacteria 8876
52 Ga0070712_100188945 3300006175 Bacteria 1610
53 Ga0075362_10064801 3300006177 Bacteria 1658
54 Ga0075366_10014633 3300006195 Bacteria 4483
55 Ga0075428_100492365 3300006844 Unclassified 1312
56 Ga0075430_100000509 3300006846 Bacteria 29219
57 Ga0075431_100215285 3300006847 Bacteria 1961
58 Ga0075433_10313177 3300006852 Bacteria 1389
59 Ga0075434_100270090 3300006871 Bacteria 1720
60 Ga0075429_100253439 3300006880 Bacteria 1541
61 Ga0075429_100643476 3300006880 Bacteria 929
62 Ga0068865_100363381 3300006881 Bacteria 1176
63 Ga0075435_100523320 3300007076 Bacteria 1026
64 Ga0105240_11061450 3300009093 Bacteria 864
65 Ga0105243_10082079 3300009148 Bacteria 2634
66 Ga0105241_10723702 3300009174 Bacteria 910
67 Ga0105242_10855317 3300009176 Bacteria 905
68 Ga0105238_10021249 3300009551 Bacteria 6614
69 Ga0105238_10087339 3300009551 Bacteria 3106
70 Ga0105249_10521539 3300009553 Bacteria 1236
71 Ga0105249_10863117 3300009553 Bacteria 971
72 Ga0105249_12141475 3300009553 Bacteria 632
73 Ga0157378_10317368 3300013297 Bacteria 1513
74 Ga0157375_11062300 3300013308 Bacteria 947
75 Ga0163163_10054773 3300014325 Bacteria 3941
76 Ga0157380_10041355 3300014326 Bacteria 3597
77 Ga0157379_10228760 3300014968 Bacteria 1686
78 Ga0207682_10001074 3300025893 Bacteria 12601
79 Ga0207692_10044207 3300025898 Bacteria 2221
80 Ga0207642_10393693 3300025899 Bacteria 827
81 Ga0207685_10036450 3300025905 Unclassified 1804
82 Ga0207699_10018555 3300025906 Bacteria 3688
83 Ga0207645_10063809 3300025907 Bacteria 2354
84 Ga0207643_10086498 3300025908 Bacteria 1822
85 Ga0207693_10000434 3300025915 Bacteria 38124
86 Ga0207693_10080339 3300025915 Unclassified 2553
87 Ga0207663_10087422 3300025916 Bacteria 2058
88 Ga0207663_10483963 3300025916 Unclassified 959
89 Ga0207657_10439092 3300025919 Bacteria 1025
90 Ga0207650_10078523 3300025925 Bacteria 2497
91 Ga0207659_10251880 3300025926 Bacteria 1433
92 Ga0207659_10979613 3300025926 Bacteria 727
93 Ga0207700_10009301 3300025928 Bacteria 6131
94 Ga0207700_10222910 3300025928 Bacteria 1599
95 Ga0207700_10505715 3300025928 Bacteria 1069
96 Ga0207664_10373188 3300025929 Bacteria 1265
97 Ga0207644_10070167 3300025931 Bacteria 2560
98 Ga0207706_10231943 3300025933 Bacteria 1615
99 Ga0207709_10102229 3300025935 Bacteria 1897
100 Ga0207669_10002350 3300025937 Bacteria 8037
101 Ga0207669_10850924 3300025937 Bacteria 759
102 Ga0207665_10009694 3300025939 Bacteria 6323
103 Ga0207665_10197339 3300025939 Bacteria 1465
104 Ga0207691_10001292 3300025940 Bacteria 24983
105 Ga0207661_10118826 3300025944 Bacteria 2248
106 Ga0207651_10056609 3300025960 Bacteria 2699
107 Ga0207668_10739791 3300025972 Bacteria 867
108 Ga0207639_10336929 3300026041 Bacteria 1344
109 Ga0207641_10286222 3300026088 Bacteria 1552
110 Ga0207648_10006883 3300026089 Bacteria 11270
111 Ga0207676_11260512 3300026095 Bacteria 733
112 Ga0207674_10018581 3300026116 Bacteria 7550
113 Ga0207675_100159792 3300026118 Bacteria 2149
114 Ga0207683_10001466 3300026121 Bacteria 21270
115 Ga0268265_10386378 3300028380 Bacteria 1289
116 Ga0265342_10519394 3300031712 Bacteria 606
117 Ga0307413_10137679 3300031824 Bacteria 1682
118 Ga0373944_0094843 3300035089 Bacteria 1001
119 Ga0373923_0029897 3300035111 Bacteria 2188
120 Ga0373936_0129456 3300035113 Unclassified 1083
121 Ga0373945_0339111 3300035116 Unclassified 650
122 Ga0373945_0449415 3300035116 Bacteria 570
123 Ga0373953_0134385 3300035117 Bacteria 1056
124 Ga0373954_0098400 3300035118 Unclassified 1410
125 Ga0373957_0081604 3300035120 Bacteria 1277
126 Ga0373943_0550398 3300035170 Unclassified 677
127 Ga0373946_0160871 3300035171 Bacteria 1054
128 Ga0373955_0016279 3300035172 Unclassified 3657
129 Ga0373955_0032717 3300035172 Bacteria 2732
130 Ga0373924_0022518 3300035410 Unclassified 2463
131 Ga0373935_0017787 3300035692 Bacteria 4318
132 Ga0373935_0486650 3300035692 Bacteria 895
133 Ga0373927_0288338 3300035695 Unclassified 1080
134 Ga0373933_0026069 3300035724 Unclassified 3354
135 Ga0373933_0055523 3300035724 Bacteria 2376
136 Ga0373933_0070210 3300035724 Bacteria 2130
137 Ga0373947_0164715 3300035725 Bacteria 1435
138 Ga0373947_0232778 3300035725 Unclassified 1214
139 Ga0373937_0005874 3300036401 Bacteria 10558
140 Ga0373937_0034921 3300036401 Bacteria 4574
141 Ga0373937_0097992 3300036401 Bacteria 2719
142 Ga0373937_0433959 3300036401 Bacteria 1247
143 Ga0373925_0108309 3300037068 Bacteria 2144
144 Ga0373925_0150014 3300037068 Bacteria 1830
145 Ga0395899_0559870 3300037312 Bacteria 733
146 Ga0395900_0059755 3300037418 Bacteria 3924
147 Ga0395901_0114064 3300038443 Bacteria 2838
148 Ga0436365_0726510 3300039437 Bacteria 711
149 Ga0436365_0840537 3300039437 Bacteria 4304
150 Ga0436365_1850866 3300039437 Bacteria 621
151 Ga0436361_1014794 3300039447 Bacteria 5855
152 Ga0495592_0012744 3300046454 Bacteria 6392
153 Ga0495592_0023422 3300046454 Bacteria 4696
154 Ga0495629_0066171 3300046459 Plasmid 2522
155 Ga0495651_0004121 3300046462 Bacteria 11128
156 Ga0495651_0013254 3300046462 Bacteria 6375
157 Ga0495651_0071810 3300046462 Bacteria 2631
158 Ga0495653_0052503 3300046463 Bacteria 3124
159 Ga0495653_0085114 3300046463 Unclassified 2327
160 Ga0495653_0186591 3300046463 Bacteria 1418
161 Ga0495653_0500837 3300046463 Unclassified 757
162 Ga0495662_0125961 3300046476 Bacteria 1258
163 Ga0495664_0025183 3300046477 Bacteria 3463
164 Ga0495664_0074198 3300046477 Bacteria 2035
165 Ga0495608_0160113 3300046511 Unclassified 1431
166 Ga0495610_0327786 3300046512 Bacteria 583
167 Ga0495618_0072084 3300046514 Unclassified 2198
168 Ga0495628_0022345 3300046516 Bacteria 5196
169 Ga0495630_0023725 3300046517 Bacteria 4534
170 Ga0495632_0215077 3300046519 Bacteria 871
171 Ga0495663_0030147 3300046525 Bacteria 1606
172 Ga0495652_0055014 3300046529 Unclassified 3386
173 Ga0495652_0225545 3300046529 Bacteria 1405
174 Ga0495640_0051996 3300046533 Bacteria 2814
175 Ga0495640_0178035 3300046533 Bacteria 1356
176 Ga0495587_0010045 3300046536 Bacteria 6045
177 Ga0495587_0033245 3300046536 Bacteria 3114
178 Ga0495587_0047114 3300046536 Bacteria 2557
179 Ga0495598_0273936 3300046537 Bacteria 631
180 Ga0495621_0166760 3300046539 Bacteria 873
181 Ga0495645_0021049 3300046543 Bacteria 4713
182 Ga0495645_0027689 3300046543 Bacteria 4118
183 Ga0495645_0187453 3300046543 Bacteria 1412
184 Ga0495633_0328976 3300046558 Bacteria 693
185 Ga0495667_0034031 3300046559 Bacteria 3407
186 Ga0495667_0035989 3300046559 Bacteria 3306
187 Ga0495656_0381396 3300046615 Bacteria 735
188 Ga0495656_0477652 3300046615 Bacteria 659
189 Ga0495668_0288861 3300046616 Bacteria 899
190 Ga0495635_0009003 3300046663 Bacteria 6965
191 Ga0495657_0080781 3300046675 Unclassified 2104
192 Ga0495657_0523329 3300046675 Unclassified 690
193 Ga0495599_0060827 3300046678 Bacteria 2361
194 Ga0495623_0024754 3300046679 Bacteria 3866
195 Ga0495623_0320012 3300046679 Unclassified 852
196 Ga0495623_0400863 3300046679 Unclassified 738
197 Ga0495646_0044914 3300046680 Plasmid 2700
198 Ga0495647_0254962 3300046681 Bacteria 782
199 Ga0495613_0154711 3300046689 Bacteria 1634
200 Ga0495624_0248661 3300046690 Bacteria 1075
201 Ga0495600_0019017 3300046809 Bacteria 4384
202 Ga0495600_0109747 3300046809 Unclassified 1796
203 Ga0495604_0008798 3300047317 Bacteria 7980
204 Ga0495604_0011702 3300047317 Bacteria 6977
205 Ga0495674_0039099 3300047319 Bacteria 4253
206 Ga0495674_0175349 3300047319 Bacteria 1787
207 Ga0495674_0274108 3300047319 Bacteria 1383
208 Ga0495676_0222568 3300047321 Bacteria 1300
209 Ga0495676_0346858 3300047321 Unclassified 993
210 Ga0495680_0007713 3300047322 Bacteria 9828
211 Ga0495680_0073359 3300047322 Bacteria 2601
212 Ga0495684_0220121 3300047471 Unclassified 1392
213 Ga0495684_0596357 3300047471 Unclassified 746
214 Ga0495593_0093798 3300047673 Unclassified 1544
215 Ga0495602_0019971 3300048088 Bacteria 6632
216 Ga0495602_0037578 3300048088 Plasmid 4490
217 Ga0495602_0109984 3300048088 Bacteria 2241
218 Ga0495615_0083005 3300048090 Bacteria 882
219 Ga0495615_0096975 3300048090 Bacteria 828
220 Ga0496102_0127078 3300048905 Bacteria 2384
221 Ga0496104_0013527 3300048907 Bacteria 7353
222 Ga0496105_0069122 3300048908 Bacteria 2919
223 Ga0496105_1012434 3300048908 Bacteria 621
224 Ga0496107_0238858 3300048910 Bacteria 1352
225 Ga0496109_0395433 3300048912 Bacteria 1306
226 Ga0496110_0712305 3300048913 Bacteria 906
227 Ga0496115_0489965 3300048918 Bacteria 989
228 Ga0496115_0642146 3300048918 Bacteria 840
229 Ga0496126_0009492 3300048929 Bacteria 10322
230 Ga0501033_0178964 3300049570 Bacteria 1521
231 Ga0501034_0006268 3300049571 Bacteria 12796
232 Ga0501037_0572118 3300049573 Bacteria 761
233 Ga0501039_0282527 3300049575 Bacteria 1305
234 Ga0501041_0214358 3300049577 Bacteria 1208
235 Ga0501043_0245500 3300049579 Bacteria 1380
236 Ga0501047_0102985 3300049581 Bacteria 2734
237 Ga0501047_0103546 3300049581 Bacteria 2727
238 Ga0501067_0227544 3300049583 Bacteria 1038
239 Ga0501067_0335370 3300049583 Bacteria 842
240 Ga0501070_0047131 3300049586 Bacteria 3583
241 Ga0501071_0013890 3300049587 Bacteria 5499
242 Ga0501071_0339392 3300049587 Bacteria 1142
243 Ga0501083_0170010 3300049744 Unclassified 1425
244 Ga0501083_0414068 3300049744 Bacteria 877
245 Ga0501035_0078239 3300049822 Bacteria 2922
246 Ga0501044_0201330 3300049823 Bacteria 1949
247 Ga0501044_0465624 3300049823 Bacteria 1169
248 Ga0501044_0720031 3300049823 Bacteria 882
249 nmdc:mga03683_165391_c1 3300050489 Bacteria 1004
250 nmdc:mga00v17_800617_c1 3300050491 Bacteria 600
251 nmdc:mga0k408_270927_c1 3300050493 Bacteria 1014
252 nmdc:mga06z11_554604_c1 3300050494 Bacteria 698
253 nmdc:mga0qj67_412_c1 3300050509 Bacteria 29289
254 nmdc:mga0qj67_56980_c1 3300050509 Bacteria 1973
255 nmdc:mga06r32_24825_c1 3300050510 Bacteria 5570
256 nmdc:mga0n895_1499360_c1 3300050512 Bacteria 641
257 nmdc:mga0n895_305656_c1 3300050512 Bacteria 1612
258 nmdc:mga0rr50_194073_c1 3300050513 Unclassified 1665
259 nmdc:mga0rr50_643507_c1 3300050513 Bacteria 904
260 nmdc:mga08x19_256030_c1 3300050514 Bacteria 1209
261 nmdc:mga0a205_1144207_c1 3300050515 Bacteria 626
262 Ga0495601_0000936 3300053077 Bacteria 15866
263 Ga0495601_0007030 3300053077 Bacteria 6594
264 Ga0495601_0155044 3300053077 Bacteria 1495
265 Ga0495612_0002878 3300053078 Bacteria 7131
266 Ga0495612_0007051 3300053078 Bacteria 4598
267 Ga0495612_0077777 3300053078 Bacteria 1390
268 Ga0500610_0072668 3300053079 Bacteria 1794
269 Ga0495595_0003768 3300053084 Bacteria 6031
270 Ga0495595_0036650 3300053084 Bacteria 2226
271 Ga0495595_0248644 3300053084 Bacteria 890
272 Ga0495619_0009550 3300053085 Bacteria 6121
273 Ga0495619_0013649 3300053085 Bacteria 5120
274 Ga0495619_0024462 3300053085 Bacteria 3873
275 Ga0495619_0262173 3300053085 Bacteria 1197
276 Ga0500593_013416 3300053117 Bacteria 3499
277 Ga0500636_0035571 3300053177 Bacteria 2947
278 Ga0500645_135445 3300053730 Bacteria 683
279 Ga0501084_0729428 3300054114 Bacteria 835
280 Ga0501082_0000099 3300060353 Bacteria 66846
281 Ga0501082_0164686 3300060353 Bacteria 1927

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035116 Ga0373945_0449415 Ga0373945_0449415_11_436 141
2 3300050491 nmdc:mga00v17_800617_c1 nmdc:mga00v17_800617_c1_62_520 142
3 3300046615 Ga0495656_0477652 Ga0495656_0477652_217_648 143
4 3300050494 nmdc:mga06z11_554604_c1 nmdc:mga06z11_554604_c1_217_687 144
5 3300005290 Ga0065712_10562463 Ga0065712_105624631 147
6 3300005328 Ga0070676_10419164 Ga0070676_104191641 147
7 3300005331 Ga0070670_100477555 Ga0070670_1004775551 147
8 3300005338 Ga0068868_100097148 Ga0068868_1000971484 147
9 3300005355 Ga0070671_100948741 Ga0070671_1009487411 147
10 3300005356 Ga0070674_100008903 Ga0070674_1000089032 147
11 3300005364 Ga0070673_100062659 Ga0070673_1000626592 147
12 3300005365 Ga0070688_100598560 Ga0070688_1005985601 147
13 3300005456 Ga0070678_100003451 Ga0070678_1000034514 147
14 3300005459 Ga0068867_100005652 Ga0068867_1000056523 147
15 3300005543 Ga0070672_100027477 Ga0070672_1000274774 147
16 3300005544 Ga0070686_100125730 Ga0070686_1001257301 147
17 3300005718 Ga0068866_10455923 Ga0068866_104559232 147
18 3300006881 Ga0068865_100363381 Ga0068865_1003633813 147
19 3300013297 Ga0157378_10317368 Ga0157378_103173682 147
20 3300014326 Ga0157380_10041355 Ga0157380_100413555 147
21 3300025893 Ga0207682_10001074 Ga0207682_100010746 147
22 3300025899 Ga0207642_10393693 Ga0207642_103936931 147
23 3300025907 Ga0207645_10063809 Ga0207645_100638093 147
24 3300025926 Ga0207659_10251880 Ga0207659_102518802 147
25 3300025931 Ga0207644_10070167 Ga0207644_100701674 147
26 3300025937 Ga0207669_10002350 Ga0207669_100023503 147
27 3300025940 Ga0207691_10001292 Ga0207691_100012923 147
28 3300025960 Ga0207651_10056609 Ga0207651_100566095 147
29 3300026089 Ga0207648_10006883 Ga0207648_100068835 147
30 3300026121 Ga0207683_10001466 Ga0207683_100014664 147
31 3300046525 Ga0495663_0030147 Ga0495663_0030147_130_648 147
32 3300046537 Ga0495598_0273936 Ga0495598_0273936_41_553 147
33 3300046539 Ga0495621_0166760 Ga0495621_0166760_321_839 147
34 3300046558 Ga0495633_0328976 Ga0495633_0328976_123_641 147
35 3300048090 Ga0495615_0096975 Ga0495615_0096975_131_643 147
36 3300025926 Ga0207659_10979613 Ga0207659_109796131 148
37 3300005340 Ga0070689_100636568 Ga0070689_1006365681 149
38 3300005435 Ga0070714_100046889 Ga0070714_1000468892 149
39 3300005439 Ga0070711_100016233 Ga0070711_1000162332 149
40 3300006175 Ga0070712_100188945 Ga0070712_1001889452 149
41 3300006844 Ga0075428_100492365 Ga0075428_1004923652 149
42 3300006852 Ga0075433_10313177 Ga0075433_103131772 149
43 3300009553 Ga0105249_12141475 Ga0105249_121414751 149
44 3300025898 Ga0207692_10044207 Ga0207692_100442072 149
45 3300025906 Ga0207699_10018555 Ga0207699_100185553 149
46 3300025916 Ga0207663_10087422 Ga0207663_100874222 149
47 3300025929 Ga0207664_10373188 Ga0207664_103731882 149
48 3300048910 Ga0496107_0238858 Ga0496107_0238858_235_693 149
49 3300048913 Ga0496110_0712305 Ga0496110_0712305_158_751 149
50 3300050512 nmdc:mga0n895_1499360_c1 nmdc:mga0n895_1499360_c1_40_498 149
51 3300050515 nmdc:mga0a205_1144207_c1 nmdc:mga0a205_1144207_c1_61_519 149
52 3300035117 Ga0373953_0134385 Ga0373953_0134385_554_1015 150
53 3300035170 Ga0373943_0550398 Ga0373943_0550398_150_611 150
54 3300035172 Ga0373955_0016279 Ga0373955_0016279_3173_3634 150
55 3300047471 Ga0495684_0596357 Ga0495684_0596357_213_674 150
56 3300005364 Ga0070673_101164175 Ga0070673_1011641751 151
57 3300053079 Ga0500610_0072668 Ga0500610_0072668_29_487 152
58 3300006880 Ga0075429_100643476 Ga0075429_1006434762 153
59 3300050513 nmdc:mga0rr50_194073_c1 nmdc:mga0rr50_194073_c1_50_520 153
60 3300049570 Ga0501033_0178964 Ga0501033_0178964_217_693 156
61 3300049823 Ga0501044_0720031 Ga0501044_0720031_253_729 156
62 3300050513 nmdc:mga0rr50_643507_c1 nmdc:mga0rr50_643507_c1_34_549 156
63 3300005518 Ga0070699_100080686 Ga0070699_1000806863 158
64 3300048088 Ga0495602_0109984 Ga0495602_0109984_57_608 160
65 3300025933 Ga0207706_10231943 Ga0207706_102319433 161
66 3300046519 Ga0495632_0215077 Ga0495632_0215077_313_828 161
67 3300048912 Ga0496109_0395433 Ga0496109_0395433_107_670 161
68 3300050509 nmdc:mga0qj67_412_c1 nmdc:mga0qj67_412_c1_18816_19313 163
69 3300053730 Ga0500645_135445 Ga0500645_135445_147_644 163
70 iso_pu_bacteria 2894232714 2894233330 163
71 3300005436 Ga0070713_100186947 Ga0070713_1001869472 164
72 3300005434 Ga0070709_10273701 Ga0070709_102737012 165
73 3300005439 Ga0070711_100805960 Ga0070711_1008059601 165
74 3300005937 Ga0081455_10010247 Ga0081455_100102476 165
75 3300025916 Ga0207663_10483963 Ga0207663_104839632 165
76 3300035118 Ga0373954_0098400 Ga0373954_0098400_170_676 165
77 3300035724 Ga0373933_0026069 Ga0373933_0026069_660_1166 165
78 3300036401 Ga0373937_0005874 Ga0373937_0005874_1940_2446 165
79 3300037068 Ga0373925_0108309 Ga0373925_0108309_911_1417 165
80 3300037068 Ga0373925_0150014 Ga0373925_0150014_829_1341 165
81 3300046454 Ga0495592_0012744 Ga0495592_0012744_1095_1601 165
82 3300046462 Ga0495651_0013254 Ga0495651_0013254_700_1206 165
83 3300046463 Ga0495653_0085114 Ga0495653_0085114_1395_1901 165
84 3300046477 Ga0495664_0074198 Ga0495664_0074198_720_1226 165
85 3300046511 Ga0495608_0160113 Ga0495608_0160113_901_1407 165
86 3300046514 Ga0495618_0072084 Ga0495618_0072084_348_860 165
87 3300046529 Ga0495652_0055014 Ga0495652_0055014_435_941 165
88 3300046536 Ga0495587_0010045 Ga0495587_0010045_3190_3696 165
89 3300046543 Ga0495645_0021049 Ga0495645_0021049_35_541 165
90 3300046559 Ga0495667_0034031 Ga0495667_0034031_295_801 165
91 3300046675 Ga0495657_0523329 Ga0495657_0523329_15_521 165
92 3300046679 Ga0495623_0024754 Ga0495623_0024754_911_1417 165
93 3300046809 Ga0495600_0019017 Ga0495600_0019017_455_961 165
94 3300047317 Ga0495604_0011702 Ga0495604_0011702_4695_5201 165
95 3300047319 Ga0495674_0175349 Ga0495674_0175349_333_839 165
96 3300048088 Ga0495602_0037578 Ga0495602_0037578_2451_2957 165
97 3300048090 Ga0495615_0083005 Ga0495615_0083005_55_558 165
98 3300048907 Ga0496104_0013527 Ga0496104_0013527_3494_4000 165
99 3300048908 Ga0496105_0069122 Ga0496105_0069122_2373_2879 165
100 3300049571 Ga0501034_0006268 Ga0501034_0006268_9123_9623 165
101 3300049581 Ga0501047_0103546 Ga0501047_0103546_501_1001 165
102 3300049586 Ga0501070_0047131 Ga0501070_0047131_446_946 165
103 3300049587 Ga0501071_0013890 Ga0501071_0013890_725_1225 165
104 3300049744 Ga0501083_0170010 Ga0501083_0170010_785_1285 165
105 3300049823 Ga0501044_0201330 Ga0501044_0201330_725_1225 165
106 3300053077 Ga0495601_0000936 Ga0495601_0000936_9434_9940 165
107 3300053078 Ga0495612_0002878 Ga0495612_0002878_1437_1943 165
108 3300053084 Ga0495595_0003768 Ga0495595_0003768_2363_2869 165
109 3300053085 Ga0495619_0009550 Ga0495619_0009550_2256_2762 165
110 3300053177 Ga0500636_0035571 Ga0500636_0035571_1160_1780 165
111 3300009093 Ga0105240_11061450 Ga0105240_110614501 166
112 3300013308 Ga0157375_11062300 Ga0157375_110623001 166
113 3300025919 Ga0207657_10439092 Ga0207657_104390921 166
114 3300035172 Ga0373955_0032717 Ga0373955_0032717_538_1056 166
115 3300035724 Ga0373933_0055523 Ga0373933_0055523_1640_2158 166
116 3300036401 Ga0373937_0097992 Ga0373937_0097992_1685_2203 166
117 3300037312 Ga0395899_0559870 Ga0395899_0559870_59_577 166
118 3300037418 Ga0395900_0059755 Ga0395900_0059755_2833_3351 166
119 3300038443 Ga0395901_0114064 Ga0395901_0114064_1750_2268 166
120 3300039437 Ga0436365_1850866 Ga0436365_1850866_58_558 166
121 3300046462 Ga0495651_0071810 Ga0495651_0071810_441_959 166
122 3300046463 Ga0495653_0500837 Ga0495653_0500837_63_581 166
123 3300046536 Ga0495587_0047114 Ga0495587_0047114_557_1075 166
124 3300046679 Ga0495623_0400863 Ga0495623_0400863_208_726 166
125 3300047322 Ga0495680_0073359 Ga0495680_0073359_2037_2555 166
126 3300048905 Ga0496102_0127078 Ga0496102_0127078_110_685 166
127 3300048918 Ga0496115_0489965 Ga0496115_0489965_146_646 166
128 3300053084 Ga0495595_0036650 Ga0495595_0036650_1691_2209 166
129 3300053085 Ga0495619_0024462 Ga0495619_0024462_2656_3174 166
130 3300003203 JGI25406J46586_10042057 JGI25406J46586_100420572 167
131 3300005616 Ga0068852_100725741 Ga0068852_1007257412 167
132 3300005985 Ga0081539_10005675 Ga0081539_100056757 167
133 3300006058 Ga0075432_10228466 Ga0075432_102284661 167
134 3300009553 Ga0105249_10521539 Ga0105249_105215392 167
135 3300025937 Ga0207669_10850924 Ga0207669_108509241 167
136 3300025972 Ga0207668_10739791 Ga0207668_107397912 167
137 3300031824 Ga0307413_10137679 Ga0307413_101376792 167
138 3300039447 Ga0436361_1014794 Ga0436361_1014794_2158_2673 167
139 3300046615 Ga0495656_0381396 Ga0495656_0381396_215_721 167
140 3300049573 Ga0501037_0572118 Ga0501037_0572118_95_613 167
141 3300049579 Ga0501043_0245500 Ga0501043_0245500_73_663 167
142 3300049581 Ga0501047_0102985 Ga0501047_0102985_634_1224 167
143 3300049583 Ga0501067_0335370 Ga0501067_0335370_108_620 167
144 3300049822 Ga0501035_0078239 Ga0501035_0078239_312_902 167
145 3300049823 Ga0501044_0465624 Ga0501044_0465624_207_725 167
146 3300060353 Ga0501082_0164686 Ga0501082_0164686_591_1103 167
147 3300005331 Ga0070670_100493083 Ga0070670_1004930831 168
148 3300005338 Ga0068868_100272661 Ga0068868_1002726611 168
149 3300005366 Ga0070659_100937205 Ga0070659_1009372051 168
150 3300005434 Ga0070709_10092715 Ga0070709_100927151 168
151 3300005436 Ga0070713_100007056 Ga0070713_1000070565 168
152 3300005437 Ga0070710_10024090 Ga0070710_100240902 168
153 3300005439 Ga0070711_100509065 Ga0070711_1005090653 168
154 3300005444 Ga0070694_100835483 Ga0070694_1008354831 168
155 3300005577 Ga0068857_100064125 Ga0068857_1000641252 168
156 3300005578 Ga0068854_100981631 Ga0068854_1009816311 168
157 3300005618 Ga0068864_100017854 Ga0068864_1000178543 168
158 3300005844 Ga0068862_100294337 Ga0068862_1002943372 168
159 3300005937 Ga0081455_10009303 Ga0081455_100093033 168
160 3300006028 Ga0070717_10006183 Ga0070717_100061832 168
161 3300006028 Ga0070717_10139525 Ga0070717_101395254 168
162 3300006163 Ga0070715_10000386 Ga0070715_1000038612 168
163 3300006173 Ga0070716_100021061 Ga0070716_1000210616 168
164 3300006846 Ga0075430_100000509 Ga0075430_1000005098 168
165 3300006847 Ga0075431_100215285 Ga0075431_1002152853 168
166 3300009174 Ga0105241_10723702 Ga0105241_107237021 168
167 3300009551 Ga0105238_10021249 Ga0105238_100212496 168
168 3300009551 Ga0105238_10087339 Ga0105238_100873395 168
169 3300009553 Ga0105249_10863117 Ga0105249_108631172 168
170 3300014325 Ga0163163_10054773 Ga0163163_100547733 168
171 3300014968 Ga0157379_10228760 Ga0157379_102287602 168
172 3300025905 Ga0207685_10036450 Ga0207685_100364502 168
173 3300025908 Ga0207643_10086498 Ga0207643_100864982 168
174 3300025915 Ga0207693_10080339 Ga0207693_100803392 168
175 3300025925 Ga0207650_10078523 Ga0207650_100785232 168
176 3300025928 Ga0207700_10009301 Ga0207700_100093015 168
177 3300025928 Ga0207700_10505715 Ga0207700_105057151 168
178 3300025935 Ga0207709_10102229 Ga0207709_101022292 168
179 3300025939 Ga0207665_10009694 Ga0207665_100096941 168
180 3300025939 Ga0207665_10197339 Ga0207665_101973393 168
181 3300025944 Ga0207661_10118826 Ga0207661_101188263 168
182 3300026041 Ga0207639_10336929 Ga0207639_103369292 168
183 3300026088 Ga0207641_10286222 Ga0207641_102862222 168
184 3300026095 Ga0207676_11260512 Ga0207676_112605121 168
185 3300026116 Ga0207674_10018581 Ga0207674_100185813 168
186 3300026118 Ga0207675_100159792 Ga0207675_1001597922 168
187 3300028380 Ga0268265_10386378 Ga0268265_103863782 168
188 3300035111 Ga0373923_0029897 Ga0373923_0029897_1521_2072 168
189 3300035113 Ga0373936_0129456 Ga0373936_0129456_447_998 168
190 3300035116 Ga0373945_0339111 Ga0373945_0339111_22_573 168
191 3300035120 Ga0373957_0081604 Ga0373957_0081604_531_1052 168
192 3300035410 Ga0373924_0022518 Ga0373924_0022518_1027_1578 168
193 3300035692 Ga0373935_0017787 Ga0373935_0017787_402_953 168
194 3300035695 Ga0373927_0288338 Ga0373927_0288338_146_697 168
195 3300035724 Ga0373933_0070210 Ga0373933_0070210_1402_1953 168
196 3300035725 Ga0373947_0232778 Ga0373947_0232778_63_614 168
197 3300036401 Ga0373937_0034921 Ga0373937_0034921_1058_1609 168
198 3300039437 Ga0436365_0726510 Ga0436365_0726510_108_614 168
199 3300039437 Ga0436365_0840537 Ga0436365_0840537_2515_3099 168
200 3300046454 Ga0495592_0023422 Ga0495592_0023422_1062_1613 168
201 3300046459 Ga0495629_0066171 Ga0495629_0066171_976_1527 168
202 3300046462 Ga0495651_0004121 Ga0495651_0004121_1402_1953 168
203 3300046463 Ga0495653_0052503 Ga0495653_0052503_1853_2404 168
204 3300046516 Ga0495628_0022345 Ga0495628_0022345_3735_4286 168
205 3300046533 Ga0495640_0051996 Ga0495640_0051996_402_953 168
206 3300046536 Ga0495587_0033245 Ga0495587_0033245_2414_2965 168
207 3300046543 Ga0495645_0027689 Ga0495645_0027689_772_1323 168
208 3300046559 Ga0495667_0035989 Ga0495667_0035989_111_662 168
209 3300046663 Ga0495635_0009003 Ga0495635_0009003_1002_1553 168
210 3300046675 Ga0495657_0080781 Ga0495657_0080781_1087_1638 168
211 3300046678 Ga0495599_0060827 Ga0495599_0060827_892_1443 168
212 3300046679 Ga0495623_0320012 Ga0495623_0320012_17_568 168
213 3300046680 Ga0495646_0044914 Ga0495646_0044914_1335_1886 168
214 3300046689 Ga0495613_0154711 Ga0495613_0154711_569_1120 168
215 3300046809 Ga0495600_0109747 Ga0495600_0109747_1001_1522 168
216 3300047317 Ga0495604_0008798 Ga0495604_0008798_3886_4437 168
217 3300047319 Ga0495674_0039099 Ga0495674_0039099_1054_1605 168
218 3300047321 Ga0495676_0346858 Ga0495676_0346858_325_876 168
219 3300047322 Ga0495680_0007713 Ga0495680_0007713_5639_6190 168
220 3300047471 Ga0495684_0220121 Ga0495684_0220121_855_1376 168
221 3300047673 Ga0495593_0093798 Ga0495593_0093798_63_614 168
222 3300048088 Ga0495602_0019971 Ga0495602_0019971_1932_2483 168
223 3300048908 Ga0496105_1012434 Ga0496105_1012434_67_606 168
224 3300048918 Ga0496115_0642146 Ga0496115_0642146_56_577 168
225 3300049575 Ga0501039_0282527 Ga0501039_0282527_10_528 168
226 3300049577 Ga0501041_0214358 Ga0501041_0214358_482_1000 168
227 3300049587 Ga0501071_0339392 Ga0501071_0339392_50_568 168
228 3300049744 Ga0501083_0414068 Ga0501083_0414068_112_630 168
229 3300050509 nmdc:mga0qj67_56980_c1 nmdc:mga0qj67_56980_c1_1087_1665 168
230 3300050510 nmdc:mga06r32_24825_c1 nmdc:mga06r32_24825_c1_63_641 168
231 3300050514 nmdc:mga08x19_256030_c1 nmdc:mga08x19_256030_c1_585_1097 168
232 3300053077 Ga0495601_0007030 Ga0495601_0007030_745_1296 168
233 3300053078 Ga0495612_0007051 Ga0495612_0007051_2918_3469 168
234 3300053085 Ga0495619_0013649 Ga0495619_0013649_4482_5033 168
235 3300054114 Ga0501084_0729428 Ga0501084_0729428_149_658 168
236 3300006028 Ga0070717_10356844 Ga0070717_103568442 169
237 3300006028 Ga0070717_10979444 Ga0070717_109794441 169
238 3300006175 Ga0070712_100004185 Ga0070712_1000041855 169
239 3300006880 Ga0075429_100253439 Ga0075429_1002534392 169
240 3300007076 Ga0075435_100523320 Ga0075435_1005233202 169
241 3300025915 Ga0207693_10000434 Ga0207693_1000043422 169
242 3300025928 Ga0207700_10222910 Ga0207700_102229103 169
243 3300031712 Ga0265342_10519394 Ga0265342_105193941 169
244 3300035089 Ga0373944_0094843 Ga0373944_0094843_66_581 169
245 3300035171 Ga0373946_0160871 Ga0373946_0160871_225_740 169
246 3300035692 Ga0373935_0486650 Ga0373935_0486650_261_776 169
247 3300035725 Ga0373947_0164715 Ga0373947_0164715_550_1065 169
248 3300036401 Ga0373937_0433959 Ga0373937_0433959_684_1199 169
249 3300046463 Ga0495653_0186591 Ga0495653_0186591_202_717 169
250 3300046476 Ga0495662_0125961 Ga0495662_0125961_225_740 169
251 3300046477 Ga0495664_0025183 Ga0495664_0025183_701_1216 169
252 3300046517 Ga0495630_0023725 Ga0495630_0023725_729_1244 169
253 3300046529 Ga0495652_0225545 Ga0495652_0225545_219_734 169
254 3300046533 Ga0495640_0178035 Ga0495640_0178035_705_1220 169
255 3300046543 Ga0495645_0187453 Ga0495645_0187453_729_1244 169
256 3300046681 Ga0495647_0254962 Ga0495647_0254962_238_753 169
257 3300046690 Ga0495624_0248661 Ga0495624_0248661_357_872 169
258 3300047319 Ga0495674_0274108 Ga0495674_0274108_701_1216 169
259 3300047321 Ga0495676_0222568 Ga0495676_0222568_322_837 169
260 3300053077 Ga0495601_0155044 Ga0495601_0155044_729_1244 169
261 3300053078 Ga0495612_0077777 Ga0495612_0077777_701_1216 169
262 3300053084 Ga0495595_0248644 Ga0495595_0248644_251_766 169
263 3300053085 Ga0495619_0262173 Ga0495619_0262173_640_1155 169
264 3300005844 Ga0068862_100710946 Ga0068862_1007109461 170
265 3300009148 Ga0105243_10082079 Ga0105243_100820792 170
266 3300053117 Ga0500593_013416 Ga0500593_013416_1346_1900 170
267 3300060353 Ga0501082_0000099 Ga0501082_0000099_52895_53413 170
268 3300003203 JGI25406J46586_10007080 JGI25406J46586_100070802 171
269 3300005937 Ga0081455_10022249 Ga0081455_100222494 171
270 3300005985 Ga0081539_10000966 Ga0081539_100009665 171
271 3300006051 Ga0075364_10037409 Ga0075364_100374091 171
272 3300006177 Ga0075362_10064801 Ga0075362_100648013 171
273 3300006195 Ga0075366_10014633 Ga0075366_100146331 171
274 3300006871 Ga0075434_100270090 Ga0075434_1002700902 171
275 3300009176 Ga0105242_10855317 Ga0105242_108553172 171
276 3300046512 Ga0495610_0327786 Ga0495610_0327786_12_527 171
277 3300046616 Ga0495668_0288861 Ga0495668_0288861_212_727 171
278 3300048929 Ga0496126_0009492 Ga0496126_0009492_4436_4981 171
279 3300049583 Ga0501067_0227544 Ga0501067_0227544_90_605 171
280 3300050489 nmdc:mga03683_165391_c1 nmdc:mga03683_165391_c1_167_688 171
281 3300050493 nmdc:mga0k408_270927_c1 nmdc:mga0k408_270927_c1_90_611 171
282 3300050512 nmdc:mga0n895_305656_c1 nmdc:mga0n895_305656_c1_47_562 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03734

YkuD

L,D-transpeptidase catalytic domain

64

194

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a1i-assembly1.cif.gz_A ykud from b.subtilis 0.9313 38 171
2mtz-assembly1.cif.gz_A haddock model of bacillus subtilis l,d-transpeptidase in complex with a peptidoglycan hexamuropeptide 0.8854 41 168
4lzh-assembly1.cif.gz_A l,d-transpeptidase from klebsiella pneumoniae 0.8429 36 169
2hkl-assembly3.cif.gz_C crystal structure of enterococcus faecium l,d-transpeptidase c442s mutant 0.8397 41 170
6fj1-assembly2.cif.gz_B structure of the ldtfm-avibactam carbamoyl enzyme 0.8297 37 171
ID Description Score Start End Superfamily
4a1iC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.928 38 171 2.40.440.10
af_P75954_98_241_2.40.440.10 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.9051 37 170 2.40.440.10
4a1iC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.875 38 171 2.40.440.10
af_P75954_98_241_2.40.440.10 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.839 37 170 2.40.440.10
5uwvD03 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8207 41 171 2.40.440.10
ID Description Score Start End GO Terms
AF-A0A6L9MI58-F1-model_v4 L,D-transpeptidase family protein 0.9876 44 171 GO:0005576
GO:0008360
GO:0016757
GO:0018104
GO:0071555
GO:0071972
AF-A0A7G6U4F9-F1-model_v4 L,D-transpeptidase 0.9815 30 170 GO:0005576
GO:0008360
GO:0016757
GO:0018104
GO:0071555
GO:0071972
AF-A0A6L9MI58-F1-model_v4 L,D-transpeptidase family protein 0.9725 44 171 GO:0005576
GO:0008360
GO:0016757
GO:0018104
GO:0071555
GO:0071972
AF-A0A1U7D061-F1-model_v4 Ykud domain-containing protein 0.9696 63 170 GO:0005576
GO:0008360
GO:0016757
GO:0018104
GO:0071555
GO:0071972
AF-A0A2S5MX16-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.9682 27 170 GO:0005576
GO:0008360
GO:0016757
GO:0018104
GO:0071555
GO:0071972

Feature Viewer

pLDDT pTM Quality
85.02 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map