F384815

General Info

Members Datasets Scaffolds Average Seq Length
282 202 244 260

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100011152|Ga0070665_10001115210
Length 284
Sequence LTRYSACIEWLFADADGLPGLPGTAAGTMAGAPRPSFADRVRAASVAGLDAVEFWHWSNKDLDAIASALAETGLPLAGILCEPITQITDPATHPAFLEAVRASTATARRLGAAVIIAQAGDNRPGVPRAEQHAALVAVLKRAADILVSSGVVLALEPLNDRVDHPGYYLTSTAEGLDIVDEVGRPEVKLLYDIYHSAMMDERTEEVLAGRVDRVVHAHLADTLGRGEPGSGDMDWRQRVGWLEANGYHGFVGLEYRPTKGTLESLGFRDQRSPIGNSPMPAVDI

Samples

Sample ID Description Type Environment
1 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
2 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
3 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
4 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
5 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
6 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
7 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
8 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
9 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
10 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
11 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
12 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
13 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
14 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
15 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
16 2643221629 Devosia sp. Root105 Isolate Unclassified
17 2643221662 Devosia sp. Root413D1 Isolate Unclassified
18 2643221674 Devosia sp. Root436 Isolate Unclassified
19 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
20 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
21 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
22 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
23 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
24 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
25 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
26 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
27 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
28 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
29 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
30 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
31 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
32 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
33 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
34 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
35 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
36 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
37 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
38 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
39 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
40 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
41 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
42 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
43 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
44 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
45 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
46 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
47 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
48 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
92 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
93 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
96 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
97 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
98 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
134 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
135 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
171 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
172 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
174 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
192 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
197 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
198 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
199 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
200 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
201 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
202 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.52
Metatranscriptomes 0
Isolates 13.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.12
Nodule 4.96
Rhizoplane 2.13
Rhizosphere 64.54
Stem 0
Stem Tuber 0
Unclassified 15.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002036 3300001979 Bacteria 9244
2 JGI25155J39150_1000180 3300002704 Bacteria 27328
3 JGI25156J39149_1000397 3300002705 Bacteria 27328
4 JGI25162J39368_1001025 3300002737 Bacteria 17290
5 JGI25162J39368_1001053 3300002737 Bacteria 16900
6 JGI25154J39366_1000332 3300002738 Bacteria 27328
7 JGI25157J39369_1000430 3300002741 Bacteria 27327
8 JGI25159J45721_1007063 3300002987 Bacteria 3272
9 JGI25165J46597_1000558 3300003214 Bacteria 33858
10 JGI25165J46597_1001704 3300003214 Bacteria 9847
11 JGI25165J46597_1001774 3300003214 Bacteria 9338
12 JGI25165J46597_1003024 3300003214 Bacteria 4595
13 JGI25165J46597_1003629 3300003214 Bacteria 3712
14 rootH2_10070644 3300003320 Bacteria 2299
15 rootH2_10146080 3300003320 Bacteria 4284
16 rootL2_10026763 3300003322 Bacteria 3308
17 rootH1_10214508 3300003323 Bacteria 4333
18 rootH1_10297176 3300003323 Bacteria 1979
19 JGI25160J50197_1000685 3300003354 Bacteria 18760
20 JGI25161J50226_1000461 3300003374 Bacteria 18760
21 Ga0055539_1005204 3300003752 Bacteria 1698
22 Ga0055543_1000648 3300004625 Bacteria 18455
23 Ga0065165_1003041 3300005262 Bacteria 12606
24 Ga0070658_10021407 3300005327 Bacteria 5182
25 Ga0070658_10058610 3300005327 Bacteria 3134
26 Ga0070676_10068607 3300005328 Bacteria 2123
27 Ga0070676_10105056 3300005328 Bacteria 1751
28 Ga0070660_100024008 3300005339 Bacteria 4521
29 Ga0070660_100065209 3300005339 Bacteria 2834
30 Ga0070660_100276188 3300005339 Bacteria 1374
31 Ga0070661_100173301 3300005344 Bacteria 1639
32 Ga0070668_100077073 3300005347 Bacteria 2606
33 Ga0070675_100130398 3300005354 Bacteria 2142
34 Ga0070659_100011039 3300005366 Bacteria 6671
35 Ga0070659_100035379 3300005366 Bacteria 3889
36 Ga0070659_100130133 3300005366 Bacteria 2043
37 Ga0070667_100274943 3300005367 Bacteria 1511
38 Ga0070708_100003107 3300005445 Bacteria 12929
39 Ga0070663_100338547 3300005455 Bacteria 1215
40 Ga0070662_100130639 3300005457 Bacteria 1936
41 Ga0068867_100027446 3300005459 Bacteria 4092
42 Ga0068853_100012627 3300005539 Bacteria 6875
43 Ga0068853_100058639 3300005539 Bacteria 3323
44 Ga0070672_100020606 3300005543 Bacteria 4812
45 Ga0070665_100011152 3300005548 Bacteria 9086
46 Ga0070665_100021288 3300005548 Bacteria 6521
47 Ga0070665_100067620 3300005548 Bacteria 3583
48 Ga0068855_100024797 3300005563 Bacteria 7175
49 Ga0068855_100044668 3300005563 Bacteria 5243
50 Ga0068855_100073628 3300005563 Bacteria 3968
51 Ga0068857_100003574 3300005577 Bacteria 13002
52 Ga0068854_100079923 3300005578 Bacteria 2412
53 Ga0068856_100025868 3300005614 Bacteria 5723
54 Ga0068856_100032293 3300005614 Bacteria 5125
55 Ga0068856_100060824 3300005614 Bacteria 3731
56 Ga0068856_100148223 3300005614 Bacteria 2354
57 Ga0068852_100006552 3300005616 Bacteria 8425
58 Ga0068852_100015257 3300005616 Bacteria 5951
59 Ga0068852_100016216 3300005616 Bacteria 5803
60 Ga0068852_100051427 3300005616 Bacteria 3535
61 Ga0068852_100396663 3300005616 Bacteria 1356
62 Ga0068851_10112073 3300005834 Bacteria 1457
63 Ga0075368_10060153 3300006042 Bacteria 1521
64 Ga0075364_10047735 3300006051 Bacteria 2790
65 Ga0075362_10010268 3300006177 Bacteria 3651
66 Ga0075367_10023382 3300006178 Bacteria 3476
67 Ga0075366_10063773 3300006195 Bacteria 2190
68 Ga0097621_100317178 3300006237 Bacteria 1380
69 Ga0075370_10001784 3300006353 Bacteria 9613
70 Ga0068865_100373970 3300006881 Bacteria 1160
71 Ga0105240_10000310 3300009093 Bacteria 93883
72 Ga0105240_10284425 3300009093 Bacteria 1898
73 Ga0105243_10203500 3300009148 Bacteria 1738
74 Ga0105241_10021721 3300009174 Bacteria 4747
75 Ga0105241_10050943 3300009174 Bacteria 3156
76 Ga0105248_10395386 3300009177 Bacteria 1556
77 Ga0105237_10000071 3300009545 Bacteria 135695
78 Ga0105237_10002603 3300009545 Bacteria 22239
79 Ga0105237_10413872 3300009545 Bacteria 1353
80 Ga0105238_10003959 3300009551 Bacteria 14695
81 Ga0105238_10019979 3300009551 Bacteria 6818
82 Ga0105238_10645413 3300009551 Bacteria 1068
83 Ga0105239_10005097 3300010375 Bacteria 15510
84 Ga0105239_10006004 3300010375 Bacteria 14132
85 Ga0105239_10007502 3300010375 Bacteria 12515
86 Ga0105239_10203204 3300010375 Bacteria 2220
87 Ga0157371_10001278 3300013102 Bacteria 26557
88 Ga0157370_10005855 3300013104 Bacteria 13732
89 Ga0157370_10040447 3300013104 Bacteria 4501
90 Ga0157370_10273868 3300013104 Bacteria 1559
91 Ga0157370_10319931 3300013104 Bacteria 1431
92 Ga0157374_10102182 3300013296 Bacteria 2749
93 Ga0157372_10179452 3300013307 Bacteria 2451
94 Ga0182008_10009148 3300014497 Bacteria 5362
95 Ga0182007_10001527 3300015262 Bacteria 12367
96 Ga0182005_1006812 3300015265 Bacteria 3461
97 Ga0209435_100049 3300025206 Bacteria 92067
98 Ga0209672_104017 3300025228 Bacteria 2846
99 Ga0207427_103186 3300025231 Bacteria 3622
100 Ga0209437_100318 3300025233 Bacteria 63031
101 Ga0209437_100342 3300025233 Bacteria 55164
102 Ga0209437_111601 3300025233 Bacteria 1311
103 Ga0209646_1000159 3300025246 Bacteria 92067
104 Ga0209026_1000183 3300025250 Bacteria 92067
105 Ga0209677_100312 3300025253 Bacteria 31744
106 Ga0209759_1000206 3300025256 Bacteria 92067
107 Ga0209759_1020847 3300025256 Bacteria 1509
108 Ga0209233_1000290 3300025261 Bacteria 64394
109 Ga0209233_1000363 3300025261 Bacteria 41181
110 Ga0209233_1000409 3300025261 Bacteria 33884
111 Ga0209233_1000439 3300025261 Bacteria 29015
112 Ga0209130_1000642 3300025284 Bacteria 32652
113 Ga0207426_1000330 3300025302 Bacteria 89992
114 Ga0207647_10200489 3300025904 Bacteria 1155
115 Ga0207645_10045216 3300025907 Bacteria 2814
116 Ga0207645_10273516 3300025907 Bacteria 1120
117 Ga0207705_10126657 3300025909 Bacteria 1899
118 Ga0207654_10062826 3300025911 Bacteria 2177
119 Ga0207695_10000403 3300025913 Bacteria 96385
120 Ga0207695_10124392 3300025913 Bacteria 2543
121 Ga0207671_10000099 3300025914 Bacteria 132378
122 Ga0207671_10000277 3300025914 Bacteria 76473
123 Ga0207657_10003404 3300025919 Bacteria 16996
124 Ga0207657_10046022 3300025919 Bacteria 3823
125 Ga0207649_10173127 3300025920 Bacteria 1505
126 Ga0207649_10239982 3300025920 Bacteria 1300
127 Ga0207694_10174004 3300025924 Bacteria 1744
128 Ga0207694_10194414 3300025924 Bacteria 1649
129 Ga0207690_10047875 3300025932 Bacteria 2839
130 Ga0207706_10302810 3300025933 Bacteria 1392
131 Ga0207709_10156105 3300025935 Bacteria 1586
132 Ga0207691_10019917 3300025940 Bacteria 6346
133 Ga0207711_10283826 3300025941 Bacteria 1525
134 Ga0207679_10426077 3300025945 Bacteria 1172
135 Ga0207651_10054233 3300025960 Bacteria 2746
136 Ga0207640_10063492 3300025981 Bacteria 2454
137 Ga0207640_10066128 3300025981 Bacteria 2415
138 Ga0207658_10356343 3300025986 Bacteria 1275
139 Ga0207639_10003197 3300026041 Bacteria 11012
140 Ga0207639_10228238 3300026041 Bacteria 1612
141 Ga0207639_10298217 3300026041 Bacteria 1424
142 Ga0207678_10092925 3300026067 Bacteria 2578
143 Ga0207702_10027085 3300026078 Bacteria 4759
144 Ga0207702_10044519 3300026078 Bacteria 3731
145 Ga0207702_10079285 3300026078 Bacteria 2846
146 Ga0207702_10303305 3300026078 Bacteria 1516
147 Ga0207648_10032438 3300026089 Bacteria 4611
148 Ga0207674_10004838 3300026116 Bacteria 16125
149 Ga0207683_10021827 3300026121 Bacteria 5489
150 Ga0207698_10058731 3300026142 Bacteria 2983
151 Ga0207698_10077793 3300026142 Bacteria 2661
152 Ga0207698_10187352 3300026142 Bacteria 1839
153 Ga0207698_10216755 3300026142 Bacteria 1726
154 Ga0207698_10457457 3300026142 Bacteria 1233
155 Ga0209371_1002659 3300027312 Bacteria 9723
156 Ga0268266_10000391 3300028379 Bacteria 66400
157 Ga0268266_10035632 3300028379 Bacteria 4233
158 Ga0265319_1041706 3300028563 Bacteria 1547
159 Ga0265318_10004567 3300028577 Bacteria 6684
160 Ga0265338_10007705 3300028800 Bacteria 13252
161 Ga0268256_1002842 3300030500 Bacteria 8346
162 Ga0265330_10170254 3300031235 Bacteria 924
163 Ga0265332_10091657 3300031238 Bacteria 1284
164 Ga0265320_10060596 3300031240 Bacteria 1806
165 Ga0265339_10007319 3300031249 Bacteria 7149
166 Ga0265331_10062768 3300031250 Bacteria 1752
167 Ga0265327_10102666 3300031251 Bacteria 1377
168 Ga0265327_10122487 3300031251 Bacteria 1231
169 Ga0265316_10059647 3300031344 Bacteria 2967
170 Ga0265313_10000962 3300031595 Bacteria 28567
171 Ga0265314_10068746 3300031711 Bacteria 2380
172 Ga0265342_10055022 3300031712 Bacteria 2363
173 Ga0265342_10178046 3300031712 Unclassified 1166
174 Ga0307406_10037216 3300031901 Bacteria 3004
175 Ga0307409_100400327 3300031995 Bacteria 1311
176 Ga0307416_100974816 3300032002 Bacteria 950
177 Ga0307411_10295913 3300032005 Bacteria 1296
178 Ga0373932_0034536 3300035112 Bacteria 1425
179 Ga0373931_0084050 3300035691 Bacteria 1762
180 Ga0395899_0126859 3300037312 Bacteria 1824
181 Ga0395900_0412037 3300037418 Unclassified 1313
182 Ga0395898_0415902 3300037466 Bacteria 1281
183 Ga0395901_0253848 3300038443 Bacteria 1831
184 Ga0466965_0169706 3300044683 Bacteria 1147
185 Ga0466963_0014756 3300044694 Bacteria 4823
186 Ga0466970_0009780 3300044765 Bacteria 4855
187 Ga0466958_0034087 3300045836 Bacteria 3036
188 Ga0466967_0112521 3300045976 Bacteria 2503
189 Ga0466967_0279072 3300045976 Bacteria 1603
190 Ga0495643_0074991 3300046522 Bacteria 1770
191 Ga0495649_0076639 3300046694 Bacteria 1790
192 Ga0495686_0001962 3300047472 Bacteria 20447
193 Ga0496100_0023931 3300048903 Bacteria 3717
194 Ga0496102_0004052 3300048905 Bacteria 12421
195 Ga0496103_0013697 3300048906 Bacteria 4811
196 Ga0496108_0058012 3300048911 Bacteria 3253
197 Ga0496113_0037807 3300048916 Bacteria 3545
198 Ga0496116_0008011 3300048919 Bacteria 9247
199 Ga0496117_0002901 3300048920 Bacteria 20747
200 Ga0496118_0008609 3300048921 Bacteria 10501
201 Ga0496119_0021261 3300048922 Bacteria 4696
202 Ga0496119_0046301 3300048922 Bacteria 2717
203 Ga0496119_0048355 3300048922 Bacteria 2638
204 Ga0496120_0005137 3300048923 Bacteria 10575
205 Ga0496120_0019313 3300048923 Bacteria 4362
206 Ga0496120_0139814 3300048923 Bacteria 1231
207 Ga0496121_0002391 3300048924 Bacteria 28776
208 Ga0496121_0042251 3300048924 Bacteria 3969
209 Ga0496121_0058646 3300048924 Bacteria 3180
210 Ga0496122_0012134 3300048925 Bacteria 8626
211 Ga0496123_0008118 3300048926 Bacteria 9704
212 Ga0496123_0043647 3300048926 Bacteria 3076
213 Ga0496125_0021079 3300048928 Bacteria 6090
214 Ga0496125_0023023 3300048928 Bacteria 5766
215 Ga0496125_0055424 3300048928 Bacteria 3230
216 Ga0496126_0092066 3300048929 Bacteria 2665
217 Ga0501031_0017179 3300049568 Bacteria 4700
218 Ga0501033_0009593 3300049570 Bacteria 7447
219 Ga0501034_0022756 3300049571 Bacteria 6384
220 Ga0501034_0073667 3300049571 Bacteria 3424
221 Ga0501034_0186265 3300049571 Bacteria 2039
222 Ga0501034_0427448 3300049571 Bacteria 1245
223 Ga0501034_0494310 3300049571 Bacteria 1137
224 Ga0501037_0163434 3300049573 Bacteria 1586
225 Ga0501038_0010544 3300049574 Bacteria 8450
226 Ga0501038_0248510 3300049574 Bacteria 1410
227 Ga0501039_0013306 3300049575 Bacteria 6290
228 Ga0501043_0122291 3300049579 Bacteria 2042
229 Ga0501043_0262446 3300049579 Bacteria 1328
230 Ga0501046_0099657 3300049580 Bacteria 2230
231 Ga0501046_0342289 3300049580 Bacteria 1087
232 Ga0501068_0027158 3300049584 Bacteria 3378
233 Ga0501070_0018019 3300049586 Bacteria 5924
234 Ga0501070_0560058 3300049586 Bacteria 914
235 Ga0501071_0052279 3300049587 Bacteria 2946
236 Ga0501080_0044939 3300049742 Bacteria 4111
237 Ga0501035_0167497 3300049822 Bacteria 1899
238 Ga0501044_0173485 3300049823 Bacteria 2126
239 nmdc:mga03683_37615_c1 3300050489 Bacteria 1973
240 nmdc:mga03n38_46926_c1 3300050490 Bacteria 1909
241 nmdc:mga00v17_50542_c1 3300050491 Bacteria 2526
242 nmdc:mga0k408_21970_c1 3300050493 Bacteria 3589
243 nmdc:mga06z11_114729_c1 3300050494 Bacteria 1496
244 Ga0500618_005112 3300053125 Bacteria 4040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0279072 Ga0466967_0279072_232_987 222
2 3300050491 nmdc:mga00v17_50542_c1 nmdc:mga00v17_50542_c1_412_1176 241
3 3300002737 JGI25162J39368_1001025 JGI25162J39368_10010257 246
4 3300003214 JGI25165J46597_1000558 JGI25165J46597_10005589 246
5 3300025233 Ga0209437_100342 Ga0209437_10034232 246
6 3300025261 Ga0209233_1000409 Ga0209233_10004099 246
7 iso_pu_bacteria 2643221629 2644167995 247
8 iso_pu_bacteria 2643221662 2644348690 247
9 3300005339 Ga0070660_100276188 Ga0070660_1002761882 248
10 3300005548 Ga0070665_100021288 Ga0070665_1000212888 248
11 3300009545 Ga0105237_10000071 Ga0105237_10000071111 248
12 3300010375 Ga0105239_10006004 Ga0105239_1000600415 248
13 3300025914 Ga0207671_10000099 Ga0207671_1000009969 248
14 3300028379 Ga0268266_10000391 Ga0268266_1000039132 248
15 iso_pu_bacteria 2523231067 2523466098 248
16 3300003214 JGI25165J46597_1003024 JGI25165J46597_10030243 249
17 3300025261 Ga0209233_1000290 Ga0209233_100029021 249
18 3300031251 Ga0265327_10122487 Ga0265327_101224872 249
19 3300049579 Ga0501043_0262446 Ga0501043_0262446_109_858 249
20 3300003323 rootH1_10297176 rootH1_102971762 250
21 3300005327 Ga0070658_10058610 Ga0070658_100586101 250
22 3300005539 Ga0068853_100012627 Ga0068853_1000126273 250
23 3300009551 Ga0105238_10645413 Ga0105238_106454131 250
24 3300025231 Ga0207427_103186 Ga0207427_1031862 250
25 3300025909 Ga0207705_10126657 Ga0207705_101266572 250
26 3300026041 Ga0207639_10003197 Ga0207639_100031979 250
27 3300049571 Ga0501034_0427448 Ga0501034_0427448_448_1200 250
28 3300049573 Ga0501037_0163434 Ga0501037_0163434_257_1009 250
29 3300049574 Ga0501038_0248510 Ga0501038_0248510_618_1370 250
30 3300049579 Ga0501043_0122291 Ga0501043_0122291_530_1282 250
31 3300049580 Ga0501046_0099657 Ga0501046_0099657_1055_1807 250
32 3300049586 Ga0501070_0560058 Ga0501070_0560058_34_786 250
33 3300049822 Ga0501035_0167497 Ga0501035_0167497_66_818 250
34 3300049823 Ga0501044_0173485 Ga0501044_0173485_381_1133 250
35 3300003320 rootH2_10070644 rootH2_100706442 251
36 3300005327 Ga0070658_10021407 Ga0070658_100214074 251
37 3300005328 Ga0070676_10068607 Ga0070676_100686072 251
38 3300005328 Ga0070676_10105056 Ga0070676_101050562 251
39 3300005339 Ga0070660_100024008 Ga0070660_1000240084 251
40 3300005347 Ga0070668_100077073 Ga0070668_1000770732 251
41 3300005354 Ga0070675_100130398 Ga0070675_1001303981 251
42 3300005366 Ga0070659_100011039 Ga0070659_1000110395 251
43 3300005366 Ga0070659_100130133 Ga0070659_1001301331 251
44 3300005455 Ga0070663_100338547 Ga0070663_1003385472 251
45 3300005457 Ga0070662_100130639 Ga0070662_1001306392 251
46 3300005459 Ga0068867_100027446 Ga0068867_1000274463 251
47 3300005543 Ga0070672_100020606 Ga0070672_1000206063 251
48 3300005563 Ga0068855_100044668 Ga0068855_1000446685 251
49 3300005577 Ga0068857_100003574 Ga0068857_1000035746 251
50 3300005614 Ga0068856_100025868 Ga0068856_1000258684 251
51 3300005616 Ga0068852_100051427 Ga0068852_1000514271 251
52 3300005616 Ga0068852_100396663 Ga0068852_1003966632 251
53 3300005834 Ga0068851_10112073 Ga0068851_101120732 251
54 3300006042 Ga0075368_10060153 Ga0075368_100601532 251
55 3300006051 Ga0075364_10047735 Ga0075364_100477353 251
56 3300006177 Ga0075362_10010268 Ga0075362_100102682 251
57 3300006178 Ga0075367_10023382 Ga0075367_100233822 251
58 3300006195 Ga0075366_10063773 Ga0075366_100637731 251
59 3300006237 Ga0097621_100317178 Ga0097621_1003171782 251
60 3300006881 Ga0068865_100373970 Ga0068865_1003739701 251
61 3300009174 Ga0105241_10050943 Ga0105241_100509432 251
62 3300009551 Ga0105238_10019979 Ga0105238_100199793 251
63 3300010375 Ga0105239_10007502 Ga0105239_1000750210 251
64 3300010375 Ga0105239_10203204 Ga0105239_102032042 251
65 3300013104 Ga0157370_10319931 Ga0157370_103199312 251
66 3300013296 Ga0157374_10102182 Ga0157374_101021822 251
67 3300025904 Ga0207647_10200489 Ga0207647_102004892 251
68 3300025907 Ga0207645_10045216 Ga0207645_100452163 251
69 3300025907 Ga0207645_10273516 Ga0207645_102735162 251
70 3300025911 Ga0207654_10062826 Ga0207654_100628262 251
71 3300025919 Ga0207657_10003404 Ga0207657_1000340420 251
72 3300025919 Ga0207657_10046022 Ga0207657_100460223 251
73 3300025920 Ga0207649_10173127 Ga0207649_101731272 251
74 3300025924 Ga0207694_10194414 Ga0207694_101944142 251
75 3300025932 Ga0207690_10047875 Ga0207690_100478753 251
76 3300025933 Ga0207706_10302810 Ga0207706_103028101 251
77 3300025940 Ga0207691_10019917 Ga0207691_100199173 251
78 3300025945 Ga0207679_10426077 Ga0207679_104260772 251
79 3300025960 Ga0207651_10054233 Ga0207651_100542333 251
80 3300025981 Ga0207640_10063492 Ga0207640_100634922 251
81 3300026041 Ga0207639_10228238 Ga0207639_102282382 251
82 3300026067 Ga0207678_10092925 Ga0207678_100929253 251
83 3300026078 Ga0207702_10303305 Ga0207702_103033052 251
84 3300026089 Ga0207648_10032438 Ga0207648_100324384 251
85 3300026116 Ga0207674_10004838 Ga0207674_1000483816 251
86 3300026121 Ga0207683_10021827 Ga0207683_100218275 251
87 3300026142 Ga0207698_10216755 Ga0207698_102167552 251
88 3300026142 Ga0207698_10457457 Ga0207698_104574572 251
89 3300028563 Ga0265319_1041706 Ga0265319_10417062 251
90 3300028577 Ga0265318_10004567 Ga0265318_100045672 251
91 3300028800 Ga0265338_10007705 Ga0265338_100077057 251
92 3300031235 Ga0265330_10170254 Ga0265330_101702542 251
93 3300031238 Ga0265332_10091657 Ga0265332_100916572 251
94 3300031240 Ga0265320_10060596 Ga0265320_100605962 251
95 3300031249 Ga0265339_10007319 Ga0265339_100073196 251
96 3300031250 Ga0265331_10062768 Ga0265331_100627681 251
97 3300031251 Ga0265327_10102666 Ga0265327_101026662 251
98 3300031344 Ga0265316_10059647 Ga0265316_100596472 251
99 3300031595 Ga0265313_10000962 Ga0265313_1000096217 251
100 3300031711 Ga0265314_10068746 Ga0265314_100687462 251
101 3300031712 Ga0265342_10055022 Ga0265342_100550222 251
102 3300031712 Ga0265342_10178046 Ga0265342_101780462 251
103 3300031901 Ga0307406_10037216 Ga0307406_100372163 251
104 3300032005 Ga0307411_10295913 Ga0307411_102959132 251
105 3300035112 Ga0373932_0034536 Ga0373932_0034536_363_1172 251
106 3300035691 Ga0373931_0084050 Ga0373931_0084050_193_1002 251
107 3300048911 Ga0496108_0058012 Ga0496108_0058012_451_1260 251
108 3300048922 Ga0496119_0048355 Ga0496119_0048355_858_1667 251
109 3300048923 Ga0496120_0139814 Ga0496120_0139814_410_1219 251
110 3300048924 Ga0496121_0042251 Ga0496121_0042251_2680_3489 251
111 3300049568 Ga0501031_0017179 Ga0501031_0017179_1609_2418 251
112 3300049570 Ga0501033_0009593 Ga0501033_0009593_3333_4142 251
113 3300049571 Ga0501034_0073667 Ga0501034_0073667_1385_2194 251
114 3300049571 Ga0501034_0186265 Ga0501034_0186265_829_1638 251
115 3300049574 Ga0501038_0010544 Ga0501038_0010544_2058_2867 251
116 3300049575 Ga0501039_0013306 Ga0501039_0013306_2227_3036 251
117 3300049580 Ga0501046_0342289 Ga0501046_0342289_97_906 251
118 3300049584 Ga0501068_0027158 Ga0501068_0027158_1109_1918 251
119 3300049586 Ga0501070_0018019 Ga0501070_0018019_4653_5462 251
120 3300049587 Ga0501071_0052279 Ga0501071_0052279_772_1581 251
121 3300049742 Ga0501080_0044939 Ga0501080_0044939_13_822 251
122 3300050489 nmdc:mga03683_37615_c1 nmdc:mga03683_37615_c1_960_1715 251
123 3300050493 nmdc:mga0k408_21970_c1 nmdc:mga0k408_21970_c1_734_1489 251
124 3300050494 nmdc:mga06z11_114729_c1 nmdc:mga06z11_114729_c1_296_1051 251
125 3300044683 Ga0466965_0169706 Ga0466965_0169706_297_1109 252
126 3300049571 Ga0501034_0494310 Ga0501034_0494310_32_844 252
127 3300050490 nmdc:mga03n38_46926_c1 nmdc:mga03n38_46926_c1_34_792 252
128 iso_pu_bacteria 2510917022 2511132177 252
129 iso_pu_bacteria 2524023209 2524462178 252
130 iso_pu_bacteria 2582581307 2585276333 252
131 iso_pu_bacteria 2582581308 2585282498 252
132 iso_pu_bacteria 2582581315 2585328537 252
133 iso_pu_bacteria 2585427527 2585536635 252
134 iso_pu_bacteria 2585427530 2585557154 252
135 iso_pu_bacteria 2585427531 2585564133 252
136 iso_pu_bacteria 2585427608 2585897266 252
137 iso_pu_bacteria 2585427609 2585903020 252
138 iso_pu_bacteria 2585428125 2587978405 252
139 iso_pu_bacteria 2615840626 2616311608 252
140 iso_pu_bacteria 2615840698 2616551745 252
141 iso_pu_bacteria 2617270742 2617385331 252
142 iso_pu_bacteria 2643221674 2644412239 252
143 iso_pu_bacteria 2667528174 2671116308 252
144 iso_pu_bacteria 2775507266 2778179321 252
145 iso_pu_bacteria 2818991448 2819613215 252
146 iso_pu_bacteria 2818991453 2819643685 252
147 iso_pu_bacteria 2838029111 2838034360 252
148 iso_pu_bacteria 2842298080 2842303536 252
149 iso_pu_bacteria 2842357229 2842362807 252
150 iso_pu_bacteria 2842475841 2842481106 252
151 iso_pu_bacteria 2842482326 2842487797 252
152 iso_pu_bacteria 2842502639 2842507762 252
153 iso_pu_bacteria 2842509118 2842515360 252
154 iso_pu_bacteria 2852387548 2852387633 252
155 iso_pu_bacteria 2919408235 2919413998 252
156 iso_pu_bacteria 3005416602 3005419333 252
157 iso_pu_bacteria 8005314921 8005317512 252
158 iso_pu_bacteria 8005484373 8005489252 252
159 iso_pu_bacteria 8005645114 8005645388 252
160 iso_pu_bacteria 8005682033 8005687768 252
161 iso_pu_bacteria 8046767195 8046774126 252
162 iso_pu_bacteria 8057575449 8057577947 252
163 3300005339 Ga0070660_100065209 Ga0070660_1000652092 253
164 3300005344 Ga0070661_100173301 Ga0070661_1001733012 253
165 3300005366 Ga0070659_100035379 Ga0070659_1000353792 253
166 3300005539 Ga0068853_100058639 Ga0068853_1000586392 253
167 3300005563 Ga0068855_100024797 Ga0068855_1000247975 253
168 3300005614 Ga0068856_100032293 Ga0068856_1000322932 253
169 3300005614 Ga0068856_100148223 Ga0068856_1001482232 253
170 3300005616 Ga0068852_100015257 Ga0068852_1000152572 253
171 3300005616 Ga0068852_100016216 Ga0068852_1000162165 253
172 3300009093 Ga0105240_10284425 Ga0105240_102844252 253
173 3300009174 Ga0105241_10021721 Ga0105241_100217212 253
174 3300009545 Ga0105237_10413872 Ga0105237_104138722 253
175 3300009551 Ga0105238_10003959 Ga0105238_100039598 253
176 3300013102 Ga0157371_10001278 Ga0157371_100012783 253
177 3300013104 Ga0157370_10040447 Ga0157370_100404472 253
178 3300013104 Ga0157370_10273868 Ga0157370_102738682 253
179 3300013307 Ga0157372_10179452 Ga0157372_101794523 253
180 3300025913 Ga0207695_10124392 Ga0207695_101243923 253
181 3300025920 Ga0207649_10239982 Ga0207649_102399822 253
182 3300025924 Ga0207694_10174004 Ga0207694_101740041 253
183 3300026041 Ga0207639_10298217 Ga0207639_102982171 253
184 3300026078 Ga0207702_10027085 Ga0207702_100270852 253
185 3300026078 Ga0207702_10079285 Ga0207702_100792853 253
186 3300026142 Ga0207698_10077793 Ga0207698_100777932 253
187 3300026142 Ga0207698_10187352 Ga0207698_101873522 253
188 3300037312 Ga0395899_0126859 Ga0395899_0126859_642_1457 253
189 3300037418 Ga0395900_0412037 Ga0395900_0412037_487_1302 253
190 3300037466 Ga0395898_0415902 Ga0395898_0415902_74_889 253
191 3300038443 Ga0395901_0253848 Ga0395901_0253848_288_1103 253
192 3300049571 Ga0501034_0022756 Ga0501034_0022756_2753_3514 253
193 3300005445 Ga0070708_100003107 Ga0070708_1000031072 254
194 3300031995 Ga0307409_100400327 Ga0307409_1004003272 255
195 3300032002 Ga0307416_100974816 Ga0307416_1009748161 255
196 3300001979 JGI24740J21852_10002036 JGI24740J21852_100020362 256
197 3300002704 JGI25155J39150_1000180 JGI25155J39150_100018022 256
198 3300002705 JGI25156J39149_1000397 JGI25156J39149_10003979 256
199 3300002737 JGI25162J39368_1001053 JGI25162J39368_100105311 256
200 3300002738 JGI25154J39366_1000332 JGI25154J39366_10003329 256
201 3300002741 JGI25157J39369_1000430 JGI25157J39369_10004309 256
202 3300002987 JGI25159J45721_1007063 JGI25159J45721_10070631 256
203 3300003214 JGI25165J46597_1001704 JGI25165J46597_10017043 256
204 3300003214 JGI25165J46597_1001774 JGI25165J46597_10017745 256
205 3300003214 JGI25165J46597_1003629 JGI25165J46597_10036292 256
206 3300003320 rootH2_10146080 rootH2_101460803 256
207 3300003322 rootL2_10026763 rootL2_100267633 256
208 3300003323 rootH1_10214508 rootH1_102145085 256
209 3300003354 JGI25160J50197_1000685 JGI25160J50197_100068510 256
210 3300003374 JGI25161J50226_1000461 JGI25161J50226_100046110 256
211 3300003752 Ga0055539_1005204 Ga0055539_10052042 256
212 3300004625 Ga0055543_1000648 Ga0055543_10006487 256
213 3300005262 Ga0065165_1003041 Ga0065165_100304110 256
214 3300005367 Ga0070667_100274943 Ga0070667_1002749432 256
215 3300005548 Ga0070665_100011152 Ga0070665_10001115210 256
216 3300005548 Ga0070665_100067620 Ga0070665_1000676202 256
217 3300005563 Ga0068855_100073628 Ga0068855_1000736282 256
218 3300005578 Ga0068854_100079923 Ga0068854_1000799233 256
219 3300005614 Ga0068856_100060824 Ga0068856_1000608242 256
220 3300005616 Ga0068852_100006552 Ga0068852_1000065525 256
221 3300006353 Ga0075370_10001784 Ga0075370_100017849 256
222 3300009093 Ga0105240_10000310 Ga0105240_1000031021 256
223 3300009148 Ga0105243_10203500 Ga0105243_102035002 256
224 3300009177 Ga0105248_10395386 Ga0105248_103953862 256
225 3300009545 Ga0105237_10002603 Ga0105237_100026038 256
226 3300010375 Ga0105239_10005097 Ga0105239_100050978 256
227 3300013104 Ga0157370_10005855 Ga0157370_100058557 256
228 3300014497 Ga0182008_10009148 Ga0182008_100091482 256
229 3300015262 Ga0182007_10001527 Ga0182007_100015272 256
230 3300015265 Ga0182005_1006812 Ga0182005_10068123 256
231 3300025206 Ga0209435_100049 Ga0209435_10004974 256
232 3300025228 Ga0209672_104017 Ga0209672_1040173 256
233 3300025233 Ga0209437_100318 Ga0209437_10031835 256
234 3300025233 Ga0209437_111601 Ga0209437_1116012 256
235 3300025246 Ga0209646_1000159 Ga0209646_100015974 256
236 3300025250 Ga0209026_1000183 Ga0209026_100018374 256
237 3300025253 Ga0209677_100312 Ga0209677_10031212 256
238 3300025256 Ga0209759_1000206 Ga0209759_100020674 256
239 3300025256 Ga0209759_1020847 Ga0209759_10208472 256
240 3300025261 Ga0209233_1000363 Ga0209233_10003639 256
241 3300025261 Ga0209233_1000439 Ga0209233_100043920 256
242 3300025284 Ga0209130_1000642 Ga0209130_100064231 256
243 3300025302 Ga0207426_1000330 Ga0207426_100033011 256
244 3300025913 Ga0207695_10000403 Ga0207695_1000040379 256
245 3300025914 Ga0207671_10000277 Ga0207671_1000027722 256
246 3300025935 Ga0207709_10156105 Ga0207709_101561052 256
247 3300025941 Ga0207711_10283826 Ga0207711_102838262 256
248 3300025981 Ga0207640_10066128 Ga0207640_100661283 256
249 3300025986 Ga0207658_10356343 Ga0207658_103563432 256
250 3300026078 Ga0207702_10044519 Ga0207702_100445193 256
251 3300026142 Ga0207698_10058731 Ga0207698_100587312 256
252 3300027312 Ga0209371_1002659 Ga0209371_10026594 256
253 3300028379 Ga0268266_10035632 Ga0268266_100356323 256
254 3300030500 Ga0268256_1002842 Ga0268256_10028423 256
255 3300044694 Ga0466963_0014756 Ga0466963_0014756_2638_3450 256
256 3300044765 Ga0466970_0009780 Ga0466970_0009780_1314_2126 256
257 3300045836 Ga0466958_0034087 Ga0466958_0034087_1397_2209 256
258 3300045976 Ga0466967_0112521 Ga0466967_0112521_108_920 256
259 3300046522 Ga0495643_0074991 Ga0495643_0074991_665_1435 256
260 3300046694 Ga0495649_0076639 Ga0495649_0076639_183_953 256
261 3300047472 Ga0495686_0001962 Ga0495686_0001962_9787_10557 256
262 3300048903 Ga0496100_0023931 Ga0496100_0023931_2638_3408 256
263 3300048905 Ga0496102_0004052 Ga0496102_0004052_1262_2032 256
264 3300048906 Ga0496103_0013697 Ga0496103_0013697_2723_3493 256
265 3300048916 Ga0496113_0037807 Ga0496113_0037807_437_1207 256
266 3300048919 Ga0496116_0008011 Ga0496116_0008011_1233_2003 256
267 3300048920 Ga0496117_0002901 Ga0496117_0002901_10170_10940 256
268 3300048921 Ga0496118_0008609 Ga0496118_0008609_7271_8041 256
269 3300048922 Ga0496119_0021261 Ga0496119_0021261_1215_1985 256
270 3300048922 Ga0496119_0046301 Ga0496119_0046301_1515_2285 256
271 3300048923 Ga0496120_0005137 Ga0496120_0005137_1460_2230 256
272 3300048923 Ga0496120_0019313 Ga0496120_0019313_1127_1897 256
273 3300048924 Ga0496121_0002391 Ga0496121_0002391_19838_20608 256
274 3300048924 Ga0496121_0058646 Ga0496121_0058646_806_1576 256
275 3300048925 Ga0496122_0012134 Ga0496122_0012134_1194_1964 256
276 3300048926 Ga0496123_0008118 Ga0496123_0008118_7749_8519 256
277 3300048926 Ga0496123_0043647 Ga0496123_0043647_611_1414 256
278 3300048928 Ga0496125_0021079 Ga0496125_0021079_1938_2708 256
279 3300048928 Ga0496125_0023023 Ga0496125_0023023_3860_4630 256
280 3300048928 Ga0496125_0055424 Ga0496125_0055424_720_1490 256
281 3300048929 Ga0496126_0092066 Ga0496126_0092066_1556_2326 256
282 3300053125 Ga0500618_005112 Ga0500618_005112_2511_3281 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

41

271

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.9081 1 252
1k77-assembly1.cif.gz_A crystal structure of ec1530, a putative oxygenase from escherichia coli 0.9022 1 256
1k77-assembly1.cif.gz_A crystal structure of ec1530, a putative oxygenase from escherichia coli 0.8989 1 256
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.8913 1 252
2zvr-assembly1.cif.gz_B crystal structure of a d-tagatose 3-epimerase-related protein from thermotoga maritima 0.8518 3 254
ID Description Score Start End Superfamily
af_Q7T3H9_4_269_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9149 3 256 3.20.20.150
af_Q7T3H9_4_269_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9047 3 256 3.20.20.150
af_P36951_1_261_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8999 1 255 3.20.20.150
af_P36951_1_261_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8933 1 255 3.20.20.150
af_P30147_1_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8878 1 253 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A1L5NN60-F1-model_v4 Hydroxypyruvate isomerase protein (EC 5.3.1.22) 0.986 1 255 GO:0008903
AF-A0A060I4R1-F1-model_v4 Hydroxypyruvate isomerase domain-containing protein 0.9818 41 256 GO:0016853
AF-A0A1B9S2D1-F1-model_v4 Hydroxypyruvate isomerase 0.9802 3 255 GO:0016853
AF-A0A7R7YCS3-F1-model_v4 Hydroxypyruvate isomerase 0.9801 1 252 GO:0016853
AF-A0A1L5NN60-F1-model_v4 Hydroxypyruvate isomerase protein (EC 5.3.1.22) 0.9784 1 255 GO:0008903

Feature Viewer

pLDDT pTM Quality
95.8 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map