F384740

General Info

Members Datasets Scaffolds Average Seq Length
282 214 281 179

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100217920|Ga0070669_1002179202
Length 206
Sequence MNRLAAQRTRWTTTVNLLTAMRPLRFSINVTLDGCYDHRAGIADEELHRHAAENLAQADAMLFGRVTYEMMEAAWRAPASTGAMPDWMEPWMLPFARTIDAAKKYVVSSTLDHVDWNAELVRGNLETAVQQLKREPGKGIVVAGVQLAQALTELGLIDEYEFLVHPRLAGHGPTLFAGLSKYVDLKPVSRQEFGSGVVVLRYERSR

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
137 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
140 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
141 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
156 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
157 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
163 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
164 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
165 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.48
Nodule 0.35
Rhizoplane 3.55
Rhizosphere 92.55
Stem 0
Stem Tuber 0
Unclassified 1.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1005266 3300001976 Bacteria 1691
2 JGI25159J45721_1004130 3300002987 Bacteria 4920
3 Ga0055543_1004086 3300004625 Bacteria 4082
4 Ga0065165_1000094 3300005262 Bacteria 146099
5 Ga0065707_10095862 3300005295 Bacteria 3329
6 Ga0070676_10013333 3300005328 Bacteria 4504
7 Ga0070683_100004500 3300005329 Bacteria 11502
8 Ga0070683_100238225 3300005329 Bacteria 1730
9 Ga0070690_100002550 3300005330 Bacteria 9800
10 Ga0070670_100285647 3300005331 Bacteria 1441
11 Ga0068869_100030887 3300005334 Bacteria 3765
12 Ga0068869_100123552 3300005334 Bacteria 1982
13 Ga0070666_10109677 3300005335 Bacteria 1908
14 Ga0070680_100125169 3300005336 Bacteria 2147
15 Ga0070680_100128726 3300005336 Bacteria 2117
16 Ga0070680_100622791 3300005336 Bacteria 927
17 Ga0070682_100034914 3300005337 Bacteria 3065
18 Ga0068868_100471737 3300005338 Bacteria 1095
19 Ga0070660_100101450 3300005339 Bacteria 2280
20 Ga0070660_100401046 3300005339 Bacteria 1134
21 Ga0070689_100305176 3300005340 Bacteria 1326
22 Ga0070661_100015704 3300005344 Bacteria 5345
23 Ga0070661_100177536 3300005344 Bacteria 1619
24 Ga0070692_10010623 3300005345 Bacteria 4200
25 Ga0070692_10027027 3300005345 Bacteria 2841
26 Ga0070669_100026688 3300005353 Bacteria 4156
27 Ga0070669_100217920 3300005353 Bacteria 1508
28 Ga0070675_100004066 3300005354 Bacteria 11103
29 Ga0070675_100539840 3300005354 Bacteria 1054
30 Ga0070671_100125175 3300005355 Bacteria 2164
31 Ga0070673_100170222 3300005364 Bacteria 1859
32 Ga0070673_100265901 3300005364 Bacteria 1500
33 Ga0070659_100069879 3300005366 Bacteria 2788
34 Ga0070659_100116451 3300005366 Bacteria 2160
35 Ga0070667_100223489 3300005367 Bacteria 1677
36 Ga0070714_100822096 3300005435 Bacteria 900
37 Ga0070710_10022696 3300005437 Bacteria 3287
38 Ga0070711_100629658 3300005439 Bacteria 897
39 Ga0070700_100708509 3300005441 Bacteria 801
40 Ga0070708_100765934 3300005445 Bacteria 908
41 Ga0070663_100127717 3300005455 Bacteria 1927
42 Ga0070663_100250469 3300005455 Bacteria 1401
43 Ga0070681_10097231 3300005458 Bacteria 2892
44 Ga0070681_10236057 3300005458 Bacteria 1742
45 Ga0070685_10084129 3300005466 Bacteria 1913
46 Ga0070707_100331592 3300005468 Bacteria 1478
47 Ga0070698_100913795 3300005471 Bacteria 823
48 Ga0070699_100805751 3300005518 Bacteria 859
49 Ga0070679_100014289 3300005530 Bacteria 7625
50 Ga0070679_100136223 3300005530 Bacteria 2436
51 Ga0070684_100003532 3300005535 Bacteria 11754
52 Ga0068853_100055989 3300005539 Bacteria 3399
53 Ga0070672_100037093 3300005543 Bacteria 3718
54 Ga0070672_100180026 3300005543 Bacteria 1761
55 Ga0070686_100345622 3300005544 Bacteria 1116
56 Ga0070695_100109571 3300005545 Bacteria 1872
57 Ga0070693_100007641 3300005547 Bacteria 5293
58 Ga0070665_100781329 3300005548 Bacteria 968
59 Ga0068855_100028703 3300005563 Bacteria 6657
60 Ga0068855_100403029 3300005563 Bacteria 1499
61 Ga0070664_100025589 3300005564 Bacteria 4894
62 Ga0068857_100010126 3300005577 Bacteria 8192
63 Ga0068857_100414908 3300005577 Bacteria 1254
64 Ga0068857_100586336 3300005577 Bacteria 1053
65 Ga0068854_100928177 3300005578 Bacteria 766
66 Ga0068856_100035974 3300005614 Bacteria 4855
67 Ga0070702_100021697 3300005615 Bacteria 3384
68 Ga0068852_100025425 3300005616 Bacteria 4798
69 Ga0068852_100091331 3300005616 Bacteria 2725
70 Ga0068859_100009429 3300005617 Bacteria 9862
71 Ga0068864_100077658 3300005618 Bacteria 2904
72 Ga0068861_100312777 3300005719 Bacteria 1365
73 Ga0068870_10162127 3300005840 Bacteria 1327
74 Ga0068863_100003570 3300005841 Bacteria 15345
75 Ga0068863_100068255 3300005841 Bacteria 3363
76 Ga0068858_100043286 3300005842 Bacteria 4175
77 Ga0068860_100065144 3300005843 Bacteria 3461
78 Ga0068862_100294929 3300005844 Bacteria 1490
79 Ga0081455_10061847 3300005937 Bacteria 3149
80 Ga0070717_10085926 3300006028 Bacteria 2648
81 Ga0070717_10169024 3300006028 Bacteria 1901
82 Ga0070715_10006670 3300006163 Bacteria 3940
83 Ga0070716_100003962 3300006173 Bacteria 7028
84 Ga0070712_100082835 3300006175 Bacteria 2327
85 Ga0068871_100004045 3300006358 Bacteria 10135
86 Ga0075428_100326780 3300006844 Bacteria 1648
87 Ga0075428_100626100 3300006844 Bacteria 1148
88 Ga0075430_100058515 3300006846 Bacteria 3240
89 Ga0075436_100137758 3300006914 Bacteria 1714
90 Ga0097620_100009429 3300006931 Bacteria 9862
91 Ga0105251_10156228 3300009011 Bacteria 1029
92 Ga0105240_10000042 3300009093 Bacteria 263795
93 Ga0105240_10097469 3300009093 Bacteria 3583
94 Ga0105240_10455548 3300009093 Bacteria 1430
95 Ga0105240_11563475 3300009093 Bacteria 691
96 Ga0111539_10845730 3300009094 Bacteria 1065
97 Ga0105245_10019846 3300009098 Bacteria 5891
98 Ga0105245_10097632 3300009098 Bacteria 2713
99 Ga0105245_10724043 3300009098 Bacteria 1029
100 Ga0114129_10834590 3300009147 Bacteria 1173
101 Ga0105243_10753018 3300009148 Bacteria 955
102 Ga0105241_10218575 3300009174 Bacteria 1600
103 Ga0105242_10006112 3300009176 Bacteria 9281
104 Ga0105242_10259698 3300009176 Bacteria 1569
105 Ga0105248_10048646 3300009177 Bacteria 4757
106 Ga0105248_10078853 3300009177 Bacteria 3702
107 Ga0105238_11465773 3300009551 Bacteria 711
108 Ga0105246_10003404 3300011119 Bacteria 9638
109 Ga0105246_10050829 3300011119 Bacteria 2844
110 Ga0157318_1015551 3300012482 Bacteria 623
111 Ga0157373_10265238 3300013100 Bacteria 1215
112 Ga0157371_10022320 3300013102 Bacteria 4640
113 Ga0157371_10595246 3300013102 Bacteria 822
114 Ga0157370_10051252 3300013104 Bacteria 3942
115 Ga0157370_10242341 3300013104 Bacteria 1668
116 Ga0157369_10015457 3300013105 Bacteria 8600
117 Ga0157369_10644267 3300013105 Bacteria 1093
118 Ga0157369_10962496 3300013105 Bacteria 875
119 Ga0157374_10001170 3300013296 Bacteria 22374
120 Ga0157374_10108923 3300013296 Bacteria 2663
121 Ga0157374_10236515 3300013296 Bacteria 1795
122 Ga0157378_10010537 3300013297 Bacteria 8078
123 Ga0163162_10493779 3300013306 Bacteria 1355
124 Ga0163162_10761069 3300013306 Bacteria 1087
125 Ga0157372_10004750 3300013307 Bacteria 14423
126 Ga0157372_10006767 3300013307 Bacteria 12188
127 Ga0157372_10033768 3300013307 Bacteria 5621
128 Ga0157372_10166092 3300013307 Bacteria 2552
129 Ga0157372_10177369 3300013307 Bacteria 2466
130 Ga0157375_10816069 3300013308 Bacteria 1081
131 Ga0163163_10348781 3300014325 Bacteria 1536
132 Ga0163163_10466124 3300014325 Bacteria 1324
133 Ga0163163_11576046 3300014325 Bacteria 718
134 Ga0157380_10367018 3300014326 Bacteria 1353
135 Ga0182008_10042316 3300014497 Bacteria 2270
136 Ga0157377_10053548 3300014745 Bacteria 2282
137 Ga0157377_10067024 3300014745 Bacteria 2066
138 Ga0157379_10014920 3300014968 Bacteria 6815
139 Ga0157376_10012141 3300014969 Bacteria 6382
140 Ga0209130_1000324 3300025284 Bacteria 55802
141 Ga0209025_1004711 3300025294 Bacteria 11641
142 Ga0207426_1021503 3300025302 Bacteria 2231
143 Ga0207680_10168453 3300025903 Bacteria 1474
144 Ga0207699_10105148 3300025906 Bacteria 1799
145 Ga0207645_10152140 3300025907 Bacteria 1511
146 Ga0207654_10126573 3300025911 Bacteria 1612
147 Ga0207707_10369491 3300025912 Bacteria 1234
148 Ga0207695_10000002 3300025913 Bacteria 2188391
149 Ga0207693_10040915 3300025915 Bacteria 3650
150 Ga0207663_10220529 3300025916 Bacteria 1379
151 Ga0207657_10364270 3300025919 Bacteria 1139
152 Ga0207649_10083697 3300025920 Bacteria 2071
153 Ga0207652_10136173 3300025921 Bacteria 2193
154 Ga0207646_10125978 3300025922 Bacteria 2303
155 Ga0207650_10160209 3300025925 Bacteria 1782
156 Ga0207659_10009661 3300025926 Bacteria 6035
157 Ga0207659_10401694 3300025926 Bacteria 1146
158 Ga0207687_10044024 3300025927 Bacteria 3078
159 Ga0207664_10138014 3300025929 Bacteria 2059
160 Ga0207644_10217708 3300025931 Bacteria 1512
161 Ga0207690_10291409 3300025932 Bacteria 1274
162 Ga0207686_10210881 3300025934 Bacteria 1396
163 Ga0207686_10304241 3300025934 Bacteria 1185
164 Ga0207665_10003614 3300025939 Bacteria 10330
165 Ga0207665_10971485 3300025939 Bacteria 675
166 Ga0207691_10063415 3300025940 Bacteria 3351
167 Ga0207711_10032471 3300025941 Bacteria 4414
168 Ga0207689_10001224 3300025942 Bacteria 24670
169 Ga0207661_10351677 3300025944 Bacteria 1329
170 Ga0207667_10150225 3300025949 Bacteria 2398
171 Ga0207667_10212028 3300025949 Bacteria 1985
172 Ga0207651_10010655 3300025960 Bacteria 5106
173 Ga0207651_10315020 3300025960 Bacteria 1306
174 Ga0207658_10058885 3300025986 Bacteria 2861
175 Ga0207639_10561826 3300026041 Bacteria 1049
176 Ga0207678_10377009 3300026067 Bacteria 1226
177 Ga0207702_10314237 3300026078 Bacteria 1490
178 Ga0207641_10088125 3300026088 Bacteria 2709
179 Ga0207676_10002976 3300026095 Bacteria 12075
180 Ga0207674_10197747 3300026116 Bacteria 1960
181 Ga0207675_100289987 3300026118 Bacteria 1592
182 Ga0207698_10135167 3300026142 Bacteria 2114
183 Ga0268265_10037904 3300028380 Bacteria 3541
184 Ga0268264_10316998 3300028381 Bacteria 1473
185 Ga0268264_11349779 3300028381 Bacteria 723
186 Ga0265318_10026029 3300028577 Bacteria 2306
187 Ga0265323_10013913 3300028653 Bacteria 3198
188 Ga0265338_10106844 3300028800 Bacteria 2265
189 Ga0265338_10344735 3300028800 Bacteria 1073
190 Ga0265324_10077200 3300029957 Bacteria 1133
191 Ga0265330_10022008 3300031235 Bacteria 2904
192 Ga0265330_10022602 3300031235 Bacteria 2861
193 Ga0265320_10082341 3300031240 Bacteria 1501
194 Ga0265320_10235852 3300031240 Bacteria 813
195 Ga0265325_10027060 3300031241 Bacteria 3103
196 Ga0265340_10000480 3300031247 Bacteria 21751
197 Ga0265339_10026962 3300031249 Bacteria 3286
198 Ga0265331_10009495 3300031250 Bacteria 5458
199 Ga0265316_10052871 3300031344 Bacteria 3185
200 Ga0265316_10069690 3300031344 Bacteria 2714
201 Ga0265316_10089192 3300031344 Bacteria 2354
202 Ga0307509_10000005 3300031507 Bacteria 435959
203 Ga0307408_100011353 3300031548 Bacteria 5885
204 Ga0265313_10012838 3300031595 Bacteria 5083
205 Ga0265313_10047481 3300031595 Bacteria 2077
206 Ga0265342_10001503 3300031712 Bacteria 21610
207 Ga0307406_10000437 3300031901 Bacteria 24294
208 Ga0307406_10053531 3300031901 Bacteria 2571
209 Ga0307409_100072959 3300031995 Bacteria 2735
210 Ga0307409_100144758 3300031995 Bacteria 2053
211 Ga0307416_100120597 3300032002 Bacteria 2335
212 Ga0307416_100310937 3300032002 Bacteria 1572
213 Ga0307415_100557441 3300032126 Bacteria 1012
214 Ga0373956_0019243 3300035119 Bacteria 2895
215 Ga0373957_0020016 3300035120 Bacteria 2360
216 Ga0373960_0163263 3300035121 Bacteria 768
217 Ga0373955_0003795 3300035172 Bacteria 6655
218 Ga0373933_0195710 3300035724 Bacteria 1292
219 Ga0373937_0003048 3300036401 Bacteria 14027
220 Ga0436362_0966708 3300039453 Unclassified 626
221 Ga0439439_0008900 3300041406 Bacteria 2377
222 Ga0451795_1089898 3300041456 Bacteria 621
223 Ga0439464_0196734 3300042439 Bacteria 642
224 Ga0439460_0006572 3300042461 Bacteria 2891
225 Ga0451577_0061658 3300042876 Bacteria 3345
226 Ga0451577_0240536 3300042876 Bacteria 1638
227 Ga0453683_0179193 3300044673 Bacteria 1344
228 Ga0466966_0052309 3300044684 Bacteria 2595
229 Ga0466961_0058691 3300044693 Bacteria 2448
230 Ga0453684_0384291 3300044712 Bacteria 1576
231 Ga0466971_0628850 3300044719 Bacteria 536
232 Ga0451576_0183260 3300045051 Bacteria 2186
233 Ga0451576_1404952 3300045051 Bacteria 726
234 Ga0495651_0076726 3300046462 Bacteria 2531
235 Ga0495582_0016028 3300046473 Bacteria 4109
236 Ga0495639_0019857 3300046475 Bacteria 2933
237 Ga0495664_0248235 3300046477 Bacteria 1076
238 Ga0495594_0054678 3300046499 Bacteria 2200
239 Ga0495618_0124799 3300046514 Bacteria 1648
240 Ga0495628_0036046 3300046516 Bacteria 3973
241 Ga0495630_0012448 3300046517 Bacteria 6177
242 Ga0495666_0004187 3300046526 Bacteria 7275
243 Ga0495640_0043210 3300046533 Bacteria 3140
244 Ga0495587_0003696 3300046536 Bacteria 10179
245 Ga0495645_0000833 3300046543 Bacteria 20988
246 Ga0495645_0463239 3300046543 Bacteria 798
247 Ga0495667_0222323 3300046559 Bacteria 1205
248 Ga0495599_0020610 3300046678 Bacteria 4106
249 Ga0495623_0004466 3300046679 Bacteria 9187
250 Ga0495647_0349193 3300046681 Bacteria 673
251 Ga0495658_0013604 3300046683 Bacteria 4144
252 Ga0495600_0678705 3300046809 Bacteria 621
253 Ga0495674_0055590 3300047319 Bacteria 3470
254 Ga0495680_0024441 3300047322 Bacteria 5012
255 Ga0495675_0005482 3300047444 Bacteria 7743
256 Ga0495686_0004173 3300047472 Bacteria 12007
257 Ga0496102_0005571 3300048905 Bacteria 10694
258 Ga0496102_0629792 3300048905 Bacteria 996
259 Ga0496102_0646692 3300048905 Bacteria 981
260 Ga0496103_0007600 3300048906 Bacteria 6450
261 Ga0496104_0908047 3300048907 Bacteria 786
262 Ga0496106_0199237 3300048909 Bacteria 1593
263 Ga0496109_0024477 3300048912 Bacteria 5368
264 Ga0496112_0145390 3300048915 Bacteria 2339
265 Ga0496113_0081717 3300048916 Bacteria 2477
266 Ga0496117_0099244 3300048920 Bacteria 1848
267 Ga0496118_0004571 3300048921 Bacteria 16291
268 Ga0501034_0001068 3300049571 Bacteria 38811
269 Ga0501034_0048853 3300049571 Bacteria 4270
270 Ga0501070_0752541 3300049586 Bacteria 768
271 Ga0501072_0298117 3300049588 Bacteria 1282
272 Ga0501073_0127355 3300049589 Bacteria 1765
273 Ga0501083_0947853 3300049744 Bacteria 560
274 nmdc:mga03n38_84126_c1 3300050490 Bacteria 1501
275 nmdc:mga0qj67_126108_c1 3300050509 Bacteria 2072
276 nmdc:mga0qj67_712831_c1 3300050509 Bacteria 798
277 nmdc:mga06r32_58490_c1 3300050510 Bacteria 3704
278 nmdc:mga08y16_164484_c1 3300050511 Bacteria 2305
279 nmdc:mga08y16_288363_c1 3300050511 Bacteria 1692
280 nmdc:mga08x19_1026729_c1 3300050514 Bacteria 586
281 nmdc:mga08x19_7196_c2 3300050514 Bacteria 2493

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8055157932 8055161970 149
2 3300041456 Ga0451795_1089898 Ga0451795_1089898_52_546 152
3 3300049744 Ga0501083_0947853 Ga0501083_0947853_50_538 156
4 3300042439 Ga0439464_0196734 Ga0439464_0196734_45_542 159
5 3300050511 nmdc:mga08y16_164484_c1 nmdc:mga08y16_164484_c1_1044_1541 159
6 3300005518 Ga0070699_100805751 Ga0070699_1008057511 160
7 3300005543 Ga0070672_100037093 Ga0070672_1000370933 160
8 3300006844 Ga0075428_100626100 Ga0075428_1006261001 160
9 3300009011 Ga0105251_10156228 Ga0105251_101562282 160
10 3300009147 Ga0114129_10834590 Ga0114129_108345902 160
11 3300009176 Ga0105242_10006112 Ga0105242_100061124 160
12 3300009177 Ga0105248_10078853 Ga0105248_100788535 160
13 3300011119 Ga0105246_10003404 Ga0105246_1000340410 160
14 3300013100 Ga0157373_10265238 Ga0157373_102652382 160
15 3300013308 Ga0157375_10816069 Ga0157375_108160691 160
16 3300014325 Ga0163163_10348781 Ga0163163_103487813 160
17 3300014968 Ga0157379_10014920 Ga0157379_100149201 160
18 3300025940 Ga0207691_10063415 Ga0207691_100634156 160
19 3300031241 Ga0265325_10027060 Ga0265325_100270601 160
20 3300042876 Ga0451577_0061658 Ga0451577_0061658_1255_1743 160
21 3300044673 Ga0453683_0179193 Ga0453683_0179193_50_538 160
22 3300044719 Ga0466971_0628850 Ga0466971_0628850_25_525 160
23 3300045051 Ga0451576_0183260 Ga0451576_0183260_104_592 160
24 3300045051 Ga0451576_1404952 Ga0451576_1404952_54_542 160
25 3300046473 Ga0495582_0016028 Ga0495582_0016028_135_623 160
26 3300046475 Ga0495639_0019857 Ga0495639_0019857_350_838 160
27 3300046477 Ga0495664_0248235 Ga0495664_0248235_240_728 160
28 3300046499 Ga0495594_0054678 Ga0495594_0054678_1372_1860 160
29 3300046514 Ga0495618_0124799 Ga0495618_0124799_795_1283 160
30 3300046516 Ga0495628_0036046 Ga0495628_0036046_934_1422 160
31 3300046517 Ga0495630_0012448 Ga0495630_0012448_2357_2845 160
32 3300046526 Ga0495666_0004187 Ga0495666_0004187_6397_6885 160
33 3300046533 Ga0495640_0043210 Ga0495640_0043210_2332_2820 160
34 3300046543 Ga0495645_0463239 Ga0495645_0463239_49_537 160
35 3300046559 Ga0495667_0222323 Ga0495667_0222323_159_647 160
36 3300046681 Ga0495647_0349193 Ga0495647_0349193_73_561 160
37 3300046683 Ga0495658_0013604 Ga0495658_0013604_3001_3489 160
38 3300046809 Ga0495600_0678705 Ga0495600_0678705_30_518 160
39 3300047319 Ga0495674_0055590 Ga0495674_0055590_2667_3155 160
40 3300047322 Ga0495680_0024441 Ga0495680_0024441_4171_4659 160
41 3300048905 Ga0496102_0005571 Ga0496102_0005571_453_941 160
42 3300048906 Ga0496103_0007600 Ga0496103_0007600_4818_5306 160
43 3300048912 Ga0496109_0024477 Ga0496109_0024477_3954_4442 160
44 3300048915 Ga0496112_0145390 Ga0496112_0145390_109_597 160
45 3300048916 Ga0496113_0081717 Ga0496113_0081717_1780_2268 160
46 3300050514 nmdc:mga08x19_7196_c2 nmdc:mga08x19_7196_c2_57_545 160
47 3300025939 Ga0207665_10971485 Ga0207665_109714851 168
48 3300039453 Ga0436362_0966708 Ga0436362_0966708_71_595 168
49 3300009093 Ga0105240_10097469 Ga0105240_100974696 169
50 3300009098 Ga0105245_10724043 Ga0105245_107240432 169
51 3300012482 Ga0157318_1015551 Ga0157318_10155511 169
52 3300013105 Ga0157369_10644267 Ga0157369_106442672 169
53 3300013296 Ga0157374_10001170 Ga0157374_1000117022 169
54 3300013297 Ga0157378_10010537 Ga0157378_100105376 169
55 3300013307 Ga0157372_10004750 Ga0157372_1000475012 169
56 3300047472 Ga0495686_0004173 Ga0495686_0004173_1145_1660 169
57 3300048909 Ga0496106_0199237 Ga0496106_0199237_55_582 169
58 3300050509 nmdc:mga0qj67_712831_c1 nmdc:mga0qj67_712831_c1_246_773 169
59 3300005340 Ga0070689_100305176 Ga0070689_1003051762 170
60 3300005364 Ga0070673_100170222 Ga0070673_1001702223 170
61 3300009094 Ga0111539_10845730 Ga0111539_108457301 170
62 3300025926 Ga0207659_10401694 Ga0207659_104016942 170
63 3300025960 Ga0207651_10315020 Ga0207651_103150201 170
64 3300005336 Ga0070680_100125169 Ga0070680_1001251693 175
65 3300005539 Ga0068853_100055989 Ga0068853_1000559891 175
66 3300006846 Ga0075430_100058515 Ga0075430_1000585153 175
67 3300009093 Ga0105240_10000042 Ga0105240_100000428 175
68 3300025913 Ga0207695_10000002 Ga0207695_100000021720 175
69 3300050509 nmdc:mga0qj67_126108_c1 nmdc:mga0qj67_126108_c1_820_1371 175
70 3300050510 nmdc:mga06r32_58490_c1 nmdc:mga06r32_58490_c1_2062_2613 175
71 3300005295 Ga0065707_10095862 Ga0065707_100958622 178
72 3300005328 Ga0070676_10013333 Ga0070676_100133336 178
73 3300005329 Ga0070683_100004500 Ga0070683_1000045005 178
74 3300005331 Ga0070670_100285647 Ga0070670_1002856472 178
75 3300005334 Ga0068869_100030887 Ga0068869_1000308872 178
76 3300005335 Ga0070666_10109677 Ga0070666_101096772 178
77 3300005339 Ga0070660_100101450 Ga0070660_1001014502 178
78 3300005344 Ga0070661_100015704 Ga0070661_1000157044 178
79 3300005345 Ga0070692_10010623 Ga0070692_100106234 178
80 3300005353 Ga0070669_100026688 Ga0070669_1000266884 178
81 3300005366 Ga0070659_100069879 Ga0070659_1000698793 178
82 3300005435 Ga0070714_100822096 Ga0070714_1008220961 178
83 3300005437 Ga0070710_10022696 Ga0070710_100226962 178
84 3300005455 Ga0070663_100127717 Ga0070663_1001277172 178
85 3300005466 Ga0070685_10084129 Ga0070685_100841292 178
86 3300005535 Ga0070684_100003532 Ga0070684_1000035327 178
87 3300005543 Ga0070672_100180026 Ga0070672_1001800261 178
88 3300005563 Ga0068855_100028703 Ga0068855_1000287036 178
89 3300005564 Ga0070664_100025589 Ga0070664_1000255895 178
90 3300005577 Ga0068857_100010126 Ga0068857_1000101266 178
91 3300005578 Ga0068854_100928177 Ga0068854_1009281771 178
92 3300005616 Ga0068852_100025425 Ga0068852_1000254254 178
93 3300005841 Ga0068863_100068255 Ga0068863_1000682554 178
94 3300005842 Ga0068858_100043286 Ga0068858_1000432862 178
95 3300005844 Ga0068862_100294929 Ga0068862_1002949291 178
96 3300006173 Ga0070716_100003962 Ga0070716_1000039624 178
97 3300006914 Ga0075436_100137758 Ga0075436_1001377582 178
98 3300009098 Ga0105245_10097632 Ga0105245_100976322 178
99 3300013102 Ga0157371_10022320 Ga0157371_100223203 178
100 3300013296 Ga0157374_10108923 Ga0157374_101089234 178
101 3300013307 Ga0157372_10166092 Ga0157372_101660923 178
102 3300014745 Ga0157377_10053548 Ga0157377_100535482 178
103 3300025906 Ga0207699_10105148 Ga0207699_101051482 178
104 3300025916 Ga0207663_10220529 Ga0207663_102205292 178
105 3300025939 Ga0207665_10003614 Ga0207665_100036145 178
106 3300035121 Ga0373960_0163263 Ga0373960_0163263_159_704 178
107 3300050514 nmdc:mga08x19_1026729_c1 nmdc:mga08x19_1026729_c1_28_573 178
108 3300005471 Ga0070698_100913795 Ga0070698_1009137951 179
109 3300025927 Ga0207687_10044024 Ga0207687_100440243 179
110 3300025934 Ga0207686_10210881 Ga0207686_102108811 179
111 3300032002 Ga0307416_100120597 Ga0307416_1001205973 179
112 3300041406 Ga0439439_0008900 Ga0439439_0008900_37_603 179
113 3300048907 Ga0496104_0908047 Ga0496104_0908047_159_725 179
114 3300048920 Ga0496117_0099244 Ga0496117_0099244_448_1011 179
115 3300048921 Ga0496118_0004571 Ga0496118_0004571_11782_12345 179
116 3300049571 Ga0501034_0048853 Ga0501034_0048853_774_1340 179
117 3300050490 nmdc:mga03n38_84126_c1 nmdc:mga03n38_84126_c1_520_1065 179
118 3300050511 nmdc:mga08y16_288363_c1 nmdc:mga08y16_288363_c1_369_926 179
119 3300001976 JGI24752J21851_1005266 JGI24752J21851_10052662 180
120 3300002987 JGI25159J45721_1004130 JGI25159J45721_10041304 180
121 3300004625 Ga0055543_1004086 Ga0055543_10040863 180
122 3300005262 Ga0065165_1000094 Ga0065165_100009494 180
123 3300005329 Ga0070683_100238225 Ga0070683_1002382252 180
124 3300005330 Ga0070690_100002550 Ga0070690_10000255014 180
125 3300005334 Ga0068869_100123552 Ga0068869_1001235522 180
126 3300005336 Ga0070680_100128726 Ga0070680_1001287262 180
127 3300005336 Ga0070680_100622791 Ga0070680_1006227911 180
128 3300005337 Ga0070682_100034914 Ga0070682_1000349144 180
129 3300005338 Ga0068868_100471737 Ga0068868_1004717371 180
130 3300005339 Ga0070660_100401046 Ga0070660_1004010462 180
131 3300005344 Ga0070661_100177536 Ga0070661_1001775362 180
132 3300005345 Ga0070692_10027027 Ga0070692_100270275 180
133 3300005353 Ga0070669_100217920 Ga0070669_1002179202 180
134 3300005354 Ga0070675_100004066 Ga0070675_1000040662 180
135 3300005354 Ga0070675_100539840 Ga0070675_1005398402 180
136 3300005355 Ga0070671_100125175 Ga0070671_1001251752 180
137 3300005364 Ga0070673_100265901 Ga0070673_1002659011 180
138 3300005366 Ga0070659_100116451 Ga0070659_1001164512 180
139 3300005367 Ga0070667_100223489 Ga0070667_1002234892 180
140 3300005439 Ga0070711_100629658 Ga0070711_1006296581 180
141 3300005441 Ga0070700_100708509 Ga0070700_1007085091 180
142 3300005445 Ga0070708_100765934 Ga0070708_1007659341 180
143 3300005455 Ga0070663_100250469 Ga0070663_1002504692 180
144 3300005458 Ga0070681_10097231 Ga0070681_100972313 180
145 3300005458 Ga0070681_10236057 Ga0070681_102360572 180
146 3300005468 Ga0070707_100331592 Ga0070707_1003315922 180
147 3300005530 Ga0070679_100014289 Ga0070679_1000142893 180
148 3300005530 Ga0070679_100136223 Ga0070679_1001362232 180
149 3300005544 Ga0070686_100345622 Ga0070686_1003456222 180
150 3300005545 Ga0070695_100109571 Ga0070695_1001095711 180
151 3300005547 Ga0070693_100007641 Ga0070693_1000076417 180
152 3300005548 Ga0070665_100781329 Ga0070665_1007813291 180
153 3300005563 Ga0068855_100403029 Ga0068855_1004030292 180
154 3300005577 Ga0068857_100414908 Ga0068857_1004149082 180
155 3300005577 Ga0068857_100586336 Ga0068857_1005863361 180
156 3300005614 Ga0068856_100035974 Ga0068856_1000359747 180
157 3300005615 Ga0070702_100021697 Ga0070702_1000216973 180
158 3300005616 Ga0068852_100091331 Ga0068852_1000913312 180
159 3300005617 Ga0068859_100009429 Ga0068859_10000942915 180
160 3300005618 Ga0068864_100077658 Ga0068864_1000776584 180
161 3300005719 Ga0068861_100312777 Ga0068861_1003127772 180
162 3300005840 Ga0068870_10162127 Ga0068870_101621272 180
163 3300005841 Ga0068863_100003570 Ga0068863_1000035706 180
164 3300005843 Ga0068860_100065144 Ga0068860_1000651445 180
165 3300005937 Ga0081455_10061847 Ga0081455_100618473 180
166 3300006028 Ga0070717_10085926 Ga0070717_100859263 180
167 3300006028 Ga0070717_10169024 Ga0070717_101690242 180
168 3300006163 Ga0070715_10006670 Ga0070715_100066706 180
169 3300006175 Ga0070712_100082835 Ga0070712_1000828353 180
170 3300006358 Ga0068871_100004045 Ga0068871_1000040452 180
171 3300006844 Ga0075428_100326780 Ga0075428_1003267802 180
172 3300006931 Ga0097620_100009429 Ga0097620_1000094292 180
173 3300009093 Ga0105240_10455548 Ga0105240_104555482 180
174 3300009093 Ga0105240_11563475 Ga0105240_115634752 180
175 3300009098 Ga0105245_10019846 Ga0105245_100198467 180
176 3300009148 Ga0105243_10753018 Ga0105243_107530182 180
177 3300009174 Ga0105241_10218575 Ga0105241_102185752 180
178 3300009176 Ga0105242_10259698 Ga0105242_102596983 180
179 3300009177 Ga0105248_10048646 Ga0105248_100486462 180
180 3300009551 Ga0105238_11465773 Ga0105238_114657732 180
181 3300011119 Ga0105246_10050829 Ga0105246_100508292 180
182 3300013102 Ga0157371_10595246 Ga0157371_105952462 180
183 3300013104 Ga0157370_10051252 Ga0157370_100512524 180
184 3300013104 Ga0157370_10242341 Ga0157370_102423413 180
185 3300013105 Ga0157369_10015457 Ga0157369_100154571 180
186 3300013105 Ga0157369_10962496 Ga0157369_109624961 180
187 3300013296 Ga0157374_10236515 Ga0157374_102365152 180
188 3300013306 Ga0163162_10493779 Ga0163162_104937792 180
189 3300013306 Ga0163162_10761069 Ga0163162_107610691 180
190 3300013307 Ga0157372_10006767 Ga0157372_1000676717 180
191 3300013307 Ga0157372_10033768 Ga0157372_100337686 180
192 3300013307 Ga0157372_10177369 Ga0157372_101773693 180
193 3300014325 Ga0163163_10466124 Ga0163163_104661242 180
194 3300014325 Ga0163163_11576046 Ga0163163_115760462 180
195 3300014326 Ga0157380_10367018 Ga0157380_103670182 180
196 3300014497 Ga0182008_10042316 Ga0182008_100423162 180
197 3300014745 Ga0157377_10067024 Ga0157377_100670242 180
198 3300014969 Ga0157376_10012141 Ga0157376_100121412 180
199 3300025284 Ga0209130_1000324 Ga0209130_100032419 180
200 3300025294 Ga0209025_1004711 Ga0209025_100471111 180
201 3300025302 Ga0207426_1021503 Ga0207426_10215032 180
202 3300025903 Ga0207680_10168453 Ga0207680_101684532 180
203 3300025907 Ga0207645_10152140 Ga0207645_101521403 180
204 3300025911 Ga0207654_10126573 Ga0207654_101265732 180
205 3300025912 Ga0207707_10369491 Ga0207707_103694912 180
206 3300025915 Ga0207693_10040915 Ga0207693_100409154 180
207 3300025919 Ga0207657_10364270 Ga0207657_103642701 180
208 3300025920 Ga0207649_10083697 Ga0207649_100836972 180
209 3300025921 Ga0207652_10136173 Ga0207652_101361733 180
210 3300025922 Ga0207646_10125978 Ga0207646_101259782 180
211 3300025925 Ga0207650_10160209 Ga0207650_101602092 180
212 3300025926 Ga0207659_10009661 Ga0207659_100096617 180
213 3300025929 Ga0207664_10138014 Ga0207664_101380143 180
214 3300025931 Ga0207644_10217708 Ga0207644_102177082 180
215 3300025932 Ga0207690_10291409 Ga0207690_102914092 180
216 3300025934 Ga0207686_10304241 Ga0207686_103042411 180
217 3300025941 Ga0207711_10032471 Ga0207711_100324712 180
218 3300025942 Ga0207689_10001224 Ga0207689_100012242 180
219 3300025944 Ga0207661_10351677 Ga0207661_103516772 180
220 3300025949 Ga0207667_10150225 Ga0207667_101502252 180
221 3300025949 Ga0207667_10212028 Ga0207667_102120282 180
222 3300025960 Ga0207651_10010655 Ga0207651_100106554 180
223 3300025986 Ga0207658_10058885 Ga0207658_100588855 180
224 3300026041 Ga0207639_10561826 Ga0207639_105618262 180
225 3300026067 Ga0207678_10377009 Ga0207678_103770092 180
226 3300026078 Ga0207702_10314237 Ga0207702_103142372 180
227 3300026088 Ga0207641_10088125 Ga0207641_100881253 180
228 3300026095 Ga0207676_10002976 Ga0207676_100029767 180
229 3300026116 Ga0207674_10197747 Ga0207674_101977472 180
230 3300026118 Ga0207675_100289987 Ga0207675_1002899872 180
231 3300026142 Ga0207698_10135167 Ga0207698_101351673 180
232 3300028380 Ga0268265_10037904 Ga0268265_100379043 180
233 3300028381 Ga0268264_10316998 Ga0268264_103169982 180
234 3300028381 Ga0268264_11349779 Ga0268264_113497791 180
235 3300028577 Ga0265318_10026029 Ga0265318_100260292 180
236 3300028653 Ga0265323_10013913 Ga0265323_100139135 180
237 3300028800 Ga0265338_10106844 Ga0265338_101068444 180
238 3300028800 Ga0265338_10344735 Ga0265338_103447351 180
239 3300029957 Ga0265324_10077200 Ga0265324_100772002 180
240 3300031235 Ga0265330_10022008 Ga0265330_100220084 180
241 3300031235 Ga0265330_10022602 Ga0265330_100226023 180
242 3300031240 Ga0265320_10082341 Ga0265320_100823412 180
243 3300031240 Ga0265320_10235852 Ga0265320_102358522 180
244 3300031247 Ga0265340_10000480 Ga0265340_1000048015 180
245 3300031249 Ga0265339_10026962 Ga0265339_100269622 180
246 3300031250 Ga0265331_10009495 Ga0265331_100094954 180
247 3300031344 Ga0265316_10052871 Ga0265316_100528713 180
248 3300031344 Ga0265316_10069690 Ga0265316_100696901 180
249 3300031344 Ga0265316_10089192 Ga0265316_100891924 180
250 3300031507 Ga0307509_10000005 Ga0307509_10000005123 180
251 3300031548 Ga0307408_100011353 Ga0307408_1000113533 180
252 3300031595 Ga0265313_10012838 Ga0265313_100128389 180
253 3300031595 Ga0265313_10047481 Ga0265313_100474813 180
254 3300031712 Ga0265342_10001503 Ga0265342_1000150319 180
255 3300031901 Ga0307406_10000437 Ga0307406_1000043711 180
256 3300031901 Ga0307406_10053531 Ga0307406_100535314 180
257 3300031995 Ga0307409_100072959 Ga0307409_1000729592 180
258 3300031995 Ga0307409_100144758 Ga0307409_1001447581 180
259 3300032002 Ga0307416_100310937 Ga0307416_1003109373 180
260 3300032126 Ga0307415_100557441 Ga0307415_1005574412 180
261 3300035119 Ga0373956_0019243 Ga0373956_0019243_1084_1632 180
262 3300035120 Ga0373957_0020016 Ga0373957_0020016_215_763 180
263 3300035172 Ga0373955_0003795 Ga0373955_0003795_711_1259 180
264 3300035724 Ga0373933_0195710 Ga0373933_0195710_620_1168 180
265 3300036401 Ga0373937_0003048 Ga0373937_0003048_705_1253 180
266 3300042461 Ga0439460_0006572 Ga0439460_0006572_1582_2130 180
267 3300042876 Ga0451577_0240536 Ga0451577_0240536_374_934 180
268 3300044684 Ga0466966_0052309 Ga0466966_0052309_58_618 180
269 3300044693 Ga0466961_0058691 Ga0466961_0058691_693_1253 180
270 3300044712 Ga0453684_0384291 Ga0453684_0384291_1004_1564 180
271 3300046462 Ga0495651_0076726 Ga0495651_0076726_1493_2041 180
272 3300046536 Ga0495587_0003696 Ga0495587_0003696_1031_1579 180
273 3300046543 Ga0495645_0000833 Ga0495645_0000833_16336_16884 180
274 3300046678 Ga0495599_0020610 Ga0495599_0020610_1473_2021 180
275 3300046679 Ga0495623_0004466 Ga0495623_0004466_4570_5118 180
276 3300047444 Ga0495675_0005482 Ga0495675_0005482_5758_6306 180
277 3300048905 Ga0496102_0629792 Ga0496102_0629792_392_943 180
278 3300048905 Ga0496102_0646692 Ga0496102_0646692_169_717 180
279 3300049571 Ga0501034_0001068 Ga0501034_0001068_29946_30518 180
280 3300049586 Ga0501070_0752541 Ga0501070_0752541_167_739 180
281 3300049588 Ga0501072_0298117 Ga0501072_0298117_693_1241 180
282 3300049589 Ga0501073_0127355 Ga0501073_0127355_969_1541 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

22

199

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8339 3 179
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8246 3 179
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8159 2 179
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.7835 3 180
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.7763 2 179
ID Description Score Start End Superfamily
3fgeA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8366 159 180 2.30.110.10
2wbmB03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8057 159 179 3.30.70.240
af_Q54JK7_720_839_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.805 159 178 3.30.70.240
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8025 2 176 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7979 2 176 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A4Q5Y4C4-F1-model_v4 deleted 0.9665 88 180
AF-A0A2V5KEX0-F1-model_v4 Deaminase 0.9648 97 180 GO:0008703
GO:0009231
AF-A0A4Q5Y4C4-F1-model_v4 deleted 0.9565 88 180
AF-A0A1G8DFK4-F1-model_v4 Dihydrofolate reductase 0.954 1 179 GO:0008703
GO:0009231
AF-A0A2V5KEX0-F1-model_v4 Deaminase 0.9537 97 180 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
89.04 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map