F384740
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 282 | 214 | 281 | 179 |
Family's Representative Sequence
| Representative Sequence | 3300005353|Ga0070669_100217920|Ga0070669_1002179202 |
| Length | 206 |
| Sequence | MNRLAAQRTRWTTTVNLLTAMRPLRFSINVTLDGCYDHRAGIADEELHRHAAENLAQADAMLFGRVTYEMMEAAWRAPASTGAMPDWMEPWMLPFARTIDAAKKYVVSSTLDHVDWNAELVRGNLETAVQQLKREPGKGIVVAGVQLAQALTELGLIDEYEFLVHPRLAGHGPTLFAGLSKYVDLKPVSRQEFGSGVVVLRYERSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 3 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 4 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 137 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 138 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 139 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 142 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 143 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 144 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 145 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 146 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 147 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 148 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 149 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 150 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 151 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 152 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 153 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 154 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 155 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 156 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 157 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 158 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 159 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 160 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 162 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 163 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 164 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 165 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 166 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 167 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 168 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 169 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 170 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 171 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 172 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 173 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 196 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 197 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 198 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 199 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 201 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 202 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 203 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 204 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 210 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 214 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.65 |
| Metatranscriptomes | 0 |
| Isolates | 0.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.48 |
| Nodule | 0.35 |
| Rhizoplane | 3.55 |
| Rhizosphere | 92.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1005266 | 3300001976 | Bacteria | 1691 |
| 2 | JGI25159J45721_1004130 | 3300002987 | Bacteria | 4920 |
| 3 | Ga0055543_1004086 | 3300004625 | Bacteria | 4082 |
| 4 | Ga0065165_1000094 | 3300005262 | Bacteria | 146099 |
| 5 | Ga0065707_10095862 | 3300005295 | Bacteria | 3329 |
| 6 | Ga0070676_10013333 | 3300005328 | Bacteria | 4504 |
| 7 | Ga0070683_100004500 | 3300005329 | Bacteria | 11502 |
| 8 | Ga0070683_100238225 | 3300005329 | Bacteria | 1730 |
| 9 | Ga0070690_100002550 | 3300005330 | Bacteria | 9800 |
| 10 | Ga0070670_100285647 | 3300005331 | Bacteria | 1441 |
| 11 | Ga0068869_100030887 | 3300005334 | Bacteria | 3765 |
| 12 | Ga0068869_100123552 | 3300005334 | Bacteria | 1982 |
| 13 | Ga0070666_10109677 | 3300005335 | Bacteria | 1908 |
| 14 | Ga0070680_100125169 | 3300005336 | Bacteria | 2147 |
| 15 | Ga0070680_100128726 | 3300005336 | Bacteria | 2117 |
| 16 | Ga0070680_100622791 | 3300005336 | Bacteria | 927 |
| 17 | Ga0070682_100034914 | 3300005337 | Bacteria | 3065 |
| 18 | Ga0068868_100471737 | 3300005338 | Bacteria | 1095 |
| 19 | Ga0070660_100101450 | 3300005339 | Bacteria | 2280 |
| 20 | Ga0070660_100401046 | 3300005339 | Bacteria | 1134 |
| 21 | Ga0070689_100305176 | 3300005340 | Bacteria | 1326 |
| 22 | Ga0070661_100015704 | 3300005344 | Bacteria | 5345 |
| 23 | Ga0070661_100177536 | 3300005344 | Bacteria | 1619 |
| 24 | Ga0070692_10010623 | 3300005345 | Bacteria | 4200 |
| 25 | Ga0070692_10027027 | 3300005345 | Bacteria | 2841 |
| 26 | Ga0070669_100026688 | 3300005353 | Bacteria | 4156 |
| 27 | Ga0070669_100217920 | 3300005353 | Bacteria | 1508 |
| 28 | Ga0070675_100004066 | 3300005354 | Bacteria | 11103 |
| 29 | Ga0070675_100539840 | 3300005354 | Bacteria | 1054 |
| 30 | Ga0070671_100125175 | 3300005355 | Bacteria | 2164 |
| 31 | Ga0070673_100170222 | 3300005364 | Bacteria | 1859 |
| 32 | Ga0070673_100265901 | 3300005364 | Bacteria | 1500 |
| 33 | Ga0070659_100069879 | 3300005366 | Bacteria | 2788 |
| 34 | Ga0070659_100116451 | 3300005366 | Bacteria | 2160 |
| 35 | Ga0070667_100223489 | 3300005367 | Bacteria | 1677 |
| 36 | Ga0070714_100822096 | 3300005435 | Bacteria | 900 |
| 37 | Ga0070710_10022696 | 3300005437 | Bacteria | 3287 |
| 38 | Ga0070711_100629658 | 3300005439 | Bacteria | 897 |
| 39 | Ga0070700_100708509 | 3300005441 | Bacteria | 801 |
| 40 | Ga0070708_100765934 | 3300005445 | Bacteria | 908 |
| 41 | Ga0070663_100127717 | 3300005455 | Bacteria | 1927 |
| 42 | Ga0070663_100250469 | 3300005455 | Bacteria | 1401 |
| 43 | Ga0070681_10097231 | 3300005458 | Bacteria | 2892 |
| 44 | Ga0070681_10236057 | 3300005458 | Bacteria | 1742 |
| 45 | Ga0070685_10084129 | 3300005466 | Bacteria | 1913 |
| 46 | Ga0070707_100331592 | 3300005468 | Bacteria | 1478 |
| 47 | Ga0070698_100913795 | 3300005471 | Bacteria | 823 |
| 48 | Ga0070699_100805751 | 3300005518 | Bacteria | 859 |
| 49 | Ga0070679_100014289 | 3300005530 | Bacteria | 7625 |
| 50 | Ga0070679_100136223 | 3300005530 | Bacteria | 2436 |
| 51 | Ga0070684_100003532 | 3300005535 | Bacteria | 11754 |
| 52 | Ga0068853_100055989 | 3300005539 | Bacteria | 3399 |
| 53 | Ga0070672_100037093 | 3300005543 | Bacteria | 3718 |
| 54 | Ga0070672_100180026 | 3300005543 | Bacteria | 1761 |
| 55 | Ga0070686_100345622 | 3300005544 | Bacteria | 1116 |
| 56 | Ga0070695_100109571 | 3300005545 | Bacteria | 1872 |
| 57 | Ga0070693_100007641 | 3300005547 | Bacteria | 5293 |
| 58 | Ga0070665_100781329 | 3300005548 | Bacteria | 968 |
| 59 | Ga0068855_100028703 | 3300005563 | Bacteria | 6657 |
| 60 | Ga0068855_100403029 | 3300005563 | Bacteria | 1499 |
| 61 | Ga0070664_100025589 | 3300005564 | Bacteria | 4894 |
| 62 | Ga0068857_100010126 | 3300005577 | Bacteria | 8192 |
| 63 | Ga0068857_100414908 | 3300005577 | Bacteria | 1254 |
| 64 | Ga0068857_100586336 | 3300005577 | Bacteria | 1053 |
| 65 | Ga0068854_100928177 | 3300005578 | Bacteria | 766 |
| 66 | Ga0068856_100035974 | 3300005614 | Bacteria | 4855 |
| 67 | Ga0070702_100021697 | 3300005615 | Bacteria | 3384 |
| 68 | Ga0068852_100025425 | 3300005616 | Bacteria | 4798 |
| 69 | Ga0068852_100091331 | 3300005616 | Bacteria | 2725 |
| 70 | Ga0068859_100009429 | 3300005617 | Bacteria | 9862 |
| 71 | Ga0068864_100077658 | 3300005618 | Bacteria | 2904 |
| 72 | Ga0068861_100312777 | 3300005719 | Bacteria | 1365 |
| 73 | Ga0068870_10162127 | 3300005840 | Bacteria | 1327 |
| 74 | Ga0068863_100003570 | 3300005841 | Bacteria | 15345 |
| 75 | Ga0068863_100068255 | 3300005841 | Bacteria | 3363 |
| 76 | Ga0068858_100043286 | 3300005842 | Bacteria | 4175 |
| 77 | Ga0068860_100065144 | 3300005843 | Bacteria | 3461 |
| 78 | Ga0068862_100294929 | 3300005844 | Bacteria | 1490 |
| 79 | Ga0081455_10061847 | 3300005937 | Bacteria | 3149 |
| 80 | Ga0070717_10085926 | 3300006028 | Bacteria | 2648 |
| 81 | Ga0070717_10169024 | 3300006028 | Bacteria | 1901 |
| 82 | Ga0070715_10006670 | 3300006163 | Bacteria | 3940 |
| 83 | Ga0070716_100003962 | 3300006173 | Bacteria | 7028 |
| 84 | Ga0070712_100082835 | 3300006175 | Bacteria | 2327 |
| 85 | Ga0068871_100004045 | 3300006358 | Bacteria | 10135 |
| 86 | Ga0075428_100326780 | 3300006844 | Bacteria | 1648 |
| 87 | Ga0075428_100626100 | 3300006844 | Bacteria | 1148 |
| 88 | Ga0075430_100058515 | 3300006846 | Bacteria | 3240 |
| 89 | Ga0075436_100137758 | 3300006914 | Bacteria | 1714 |
| 90 | Ga0097620_100009429 | 3300006931 | Bacteria | 9862 |
| 91 | Ga0105251_10156228 | 3300009011 | Bacteria | 1029 |
| 92 | Ga0105240_10000042 | 3300009093 | Bacteria | 263795 |
| 93 | Ga0105240_10097469 | 3300009093 | Bacteria | 3583 |
| 94 | Ga0105240_10455548 | 3300009093 | Bacteria | 1430 |
| 95 | Ga0105240_11563475 | 3300009093 | Bacteria | 691 |
| 96 | Ga0111539_10845730 | 3300009094 | Bacteria | 1065 |
| 97 | Ga0105245_10019846 | 3300009098 | Bacteria | 5891 |
| 98 | Ga0105245_10097632 | 3300009098 | Bacteria | 2713 |
| 99 | Ga0105245_10724043 | 3300009098 | Bacteria | 1029 |
| 100 | Ga0114129_10834590 | 3300009147 | Bacteria | 1173 |
| 101 | Ga0105243_10753018 | 3300009148 | Bacteria | 955 |
| 102 | Ga0105241_10218575 | 3300009174 | Bacteria | 1600 |
| 103 | Ga0105242_10006112 | 3300009176 | Bacteria | 9281 |
| 104 | Ga0105242_10259698 | 3300009176 | Bacteria | 1569 |
| 105 | Ga0105248_10048646 | 3300009177 | Bacteria | 4757 |
| 106 | Ga0105248_10078853 | 3300009177 | Bacteria | 3702 |
| 107 | Ga0105238_11465773 | 3300009551 | Bacteria | 711 |
| 108 | Ga0105246_10003404 | 3300011119 | Bacteria | 9638 |
| 109 | Ga0105246_10050829 | 3300011119 | Bacteria | 2844 |
| 110 | Ga0157318_1015551 | 3300012482 | Bacteria | 623 |
| 111 | Ga0157373_10265238 | 3300013100 | Bacteria | 1215 |
| 112 | Ga0157371_10022320 | 3300013102 | Bacteria | 4640 |
| 113 | Ga0157371_10595246 | 3300013102 | Bacteria | 822 |
| 114 | Ga0157370_10051252 | 3300013104 | Bacteria | 3942 |
| 115 | Ga0157370_10242341 | 3300013104 | Bacteria | 1668 |
| 116 | Ga0157369_10015457 | 3300013105 | Bacteria | 8600 |
| 117 | Ga0157369_10644267 | 3300013105 | Bacteria | 1093 |
| 118 | Ga0157369_10962496 | 3300013105 | Bacteria | 875 |
| 119 | Ga0157374_10001170 | 3300013296 | Bacteria | 22374 |
| 120 | Ga0157374_10108923 | 3300013296 | Bacteria | 2663 |
| 121 | Ga0157374_10236515 | 3300013296 | Bacteria | 1795 |
| 122 | Ga0157378_10010537 | 3300013297 | Bacteria | 8078 |
| 123 | Ga0163162_10493779 | 3300013306 | Bacteria | 1355 |
| 124 | Ga0163162_10761069 | 3300013306 | Bacteria | 1087 |
| 125 | Ga0157372_10004750 | 3300013307 | Bacteria | 14423 |
| 126 | Ga0157372_10006767 | 3300013307 | Bacteria | 12188 |
| 127 | Ga0157372_10033768 | 3300013307 | Bacteria | 5621 |
| 128 | Ga0157372_10166092 | 3300013307 | Bacteria | 2552 |
| 129 | Ga0157372_10177369 | 3300013307 | Bacteria | 2466 |
| 130 | Ga0157375_10816069 | 3300013308 | Bacteria | 1081 |
| 131 | Ga0163163_10348781 | 3300014325 | Bacteria | 1536 |
| 132 | Ga0163163_10466124 | 3300014325 | Bacteria | 1324 |
| 133 | Ga0163163_11576046 | 3300014325 | Bacteria | 718 |
| 134 | Ga0157380_10367018 | 3300014326 | Bacteria | 1353 |
| 135 | Ga0182008_10042316 | 3300014497 | Bacteria | 2270 |
| 136 | Ga0157377_10053548 | 3300014745 | Bacteria | 2282 |
| 137 | Ga0157377_10067024 | 3300014745 | Bacteria | 2066 |
| 138 | Ga0157379_10014920 | 3300014968 | Bacteria | 6815 |
| 139 | Ga0157376_10012141 | 3300014969 | Bacteria | 6382 |
| 140 | Ga0209130_1000324 | 3300025284 | Bacteria | 55802 |
| 141 | Ga0209025_1004711 | 3300025294 | Bacteria | 11641 |
| 142 | Ga0207426_1021503 | 3300025302 | Bacteria | 2231 |
| 143 | Ga0207680_10168453 | 3300025903 | Bacteria | 1474 |
| 144 | Ga0207699_10105148 | 3300025906 | Bacteria | 1799 |
| 145 | Ga0207645_10152140 | 3300025907 | Bacteria | 1511 |
| 146 | Ga0207654_10126573 | 3300025911 | Bacteria | 1612 |
| 147 | Ga0207707_10369491 | 3300025912 | Bacteria | 1234 |
| 148 | Ga0207695_10000002 | 3300025913 | Bacteria | 2188391 |
| 149 | Ga0207693_10040915 | 3300025915 | Bacteria | 3650 |
| 150 | Ga0207663_10220529 | 3300025916 | Bacteria | 1379 |
| 151 | Ga0207657_10364270 | 3300025919 | Bacteria | 1139 |
| 152 | Ga0207649_10083697 | 3300025920 | Bacteria | 2071 |
| 153 | Ga0207652_10136173 | 3300025921 | Bacteria | 2193 |
| 154 | Ga0207646_10125978 | 3300025922 | Bacteria | 2303 |
| 155 | Ga0207650_10160209 | 3300025925 | Bacteria | 1782 |
| 156 | Ga0207659_10009661 | 3300025926 | Bacteria | 6035 |
| 157 | Ga0207659_10401694 | 3300025926 | Bacteria | 1146 |
| 158 | Ga0207687_10044024 | 3300025927 | Bacteria | 3078 |
| 159 | Ga0207664_10138014 | 3300025929 | Bacteria | 2059 |
| 160 | Ga0207644_10217708 | 3300025931 | Bacteria | 1512 |
| 161 | Ga0207690_10291409 | 3300025932 | Bacteria | 1274 |
| 162 | Ga0207686_10210881 | 3300025934 | Bacteria | 1396 |
| 163 | Ga0207686_10304241 | 3300025934 | Bacteria | 1185 |
| 164 | Ga0207665_10003614 | 3300025939 | Bacteria | 10330 |
| 165 | Ga0207665_10971485 | 3300025939 | Bacteria | 675 |
| 166 | Ga0207691_10063415 | 3300025940 | Bacteria | 3351 |
| 167 | Ga0207711_10032471 | 3300025941 | Bacteria | 4414 |
| 168 | Ga0207689_10001224 | 3300025942 | Bacteria | 24670 |
| 169 | Ga0207661_10351677 | 3300025944 | Bacteria | 1329 |
| 170 | Ga0207667_10150225 | 3300025949 | Bacteria | 2398 |
| 171 | Ga0207667_10212028 | 3300025949 | Bacteria | 1985 |
| 172 | Ga0207651_10010655 | 3300025960 | Bacteria | 5106 |
| 173 | Ga0207651_10315020 | 3300025960 | Bacteria | 1306 |
| 174 | Ga0207658_10058885 | 3300025986 | Bacteria | 2861 |
| 175 | Ga0207639_10561826 | 3300026041 | Bacteria | 1049 |
| 176 | Ga0207678_10377009 | 3300026067 | Bacteria | 1226 |
| 177 | Ga0207702_10314237 | 3300026078 | Bacteria | 1490 |
| 178 | Ga0207641_10088125 | 3300026088 | Bacteria | 2709 |
| 179 | Ga0207676_10002976 | 3300026095 | Bacteria | 12075 |
| 180 | Ga0207674_10197747 | 3300026116 | Bacteria | 1960 |
| 181 | Ga0207675_100289987 | 3300026118 | Bacteria | 1592 |
| 182 | Ga0207698_10135167 | 3300026142 | Bacteria | 2114 |
| 183 | Ga0268265_10037904 | 3300028380 | Bacteria | 3541 |
| 184 | Ga0268264_10316998 | 3300028381 | Bacteria | 1473 |
| 185 | Ga0268264_11349779 | 3300028381 | Bacteria | 723 |
| 186 | Ga0265318_10026029 | 3300028577 | Bacteria | 2306 |
| 187 | Ga0265323_10013913 | 3300028653 | Bacteria | 3198 |
| 188 | Ga0265338_10106844 | 3300028800 | Bacteria | 2265 |
| 189 | Ga0265338_10344735 | 3300028800 | Bacteria | 1073 |
| 190 | Ga0265324_10077200 | 3300029957 | Bacteria | 1133 |
| 191 | Ga0265330_10022008 | 3300031235 | Bacteria | 2904 |
| 192 | Ga0265330_10022602 | 3300031235 | Bacteria | 2861 |
| 193 | Ga0265320_10082341 | 3300031240 | Bacteria | 1501 |
| 194 | Ga0265320_10235852 | 3300031240 | Bacteria | 813 |
| 195 | Ga0265325_10027060 | 3300031241 | Bacteria | 3103 |
| 196 | Ga0265340_10000480 | 3300031247 | Bacteria | 21751 |
| 197 | Ga0265339_10026962 | 3300031249 | Bacteria | 3286 |
| 198 | Ga0265331_10009495 | 3300031250 | Bacteria | 5458 |
| 199 | Ga0265316_10052871 | 3300031344 | Bacteria | 3185 |
| 200 | Ga0265316_10069690 | 3300031344 | Bacteria | 2714 |
| 201 | Ga0265316_10089192 | 3300031344 | Bacteria | 2354 |
| 202 | Ga0307509_10000005 | 3300031507 | Bacteria | 435959 |
| 203 | Ga0307408_100011353 | 3300031548 | Bacteria | 5885 |
| 204 | Ga0265313_10012838 | 3300031595 | Bacteria | 5083 |
| 205 | Ga0265313_10047481 | 3300031595 | Bacteria | 2077 |
| 206 | Ga0265342_10001503 | 3300031712 | Bacteria | 21610 |
| 207 | Ga0307406_10000437 | 3300031901 | Bacteria | 24294 |
| 208 | Ga0307406_10053531 | 3300031901 | Bacteria | 2571 |
| 209 | Ga0307409_100072959 | 3300031995 | Bacteria | 2735 |
| 210 | Ga0307409_100144758 | 3300031995 | Bacteria | 2053 |
| 211 | Ga0307416_100120597 | 3300032002 | Bacteria | 2335 |
| 212 | Ga0307416_100310937 | 3300032002 | Bacteria | 1572 |
| 213 | Ga0307415_100557441 | 3300032126 | Bacteria | 1012 |
| 214 | Ga0373956_0019243 | 3300035119 | Bacteria | 2895 |
| 215 | Ga0373957_0020016 | 3300035120 | Bacteria | 2360 |
| 216 | Ga0373960_0163263 | 3300035121 | Bacteria | 768 |
| 217 | Ga0373955_0003795 | 3300035172 | Bacteria | 6655 |
| 218 | Ga0373933_0195710 | 3300035724 | Bacteria | 1292 |
| 219 | Ga0373937_0003048 | 3300036401 | Bacteria | 14027 |
| 220 | Ga0436362_0966708 | 3300039453 | Unclassified | 626 |
| 221 | Ga0439439_0008900 | 3300041406 | Bacteria | 2377 |
| 222 | Ga0451795_1089898 | 3300041456 | Bacteria | 621 |
| 223 | Ga0439464_0196734 | 3300042439 | Bacteria | 642 |
| 224 | Ga0439460_0006572 | 3300042461 | Bacteria | 2891 |
| 225 | Ga0451577_0061658 | 3300042876 | Bacteria | 3345 |
| 226 | Ga0451577_0240536 | 3300042876 | Bacteria | 1638 |
| 227 | Ga0453683_0179193 | 3300044673 | Bacteria | 1344 |
| 228 | Ga0466966_0052309 | 3300044684 | Bacteria | 2595 |
| 229 | Ga0466961_0058691 | 3300044693 | Bacteria | 2448 |
| 230 | Ga0453684_0384291 | 3300044712 | Bacteria | 1576 |
| 231 | Ga0466971_0628850 | 3300044719 | Bacteria | 536 |
| 232 | Ga0451576_0183260 | 3300045051 | Bacteria | 2186 |
| 233 | Ga0451576_1404952 | 3300045051 | Bacteria | 726 |
| 234 | Ga0495651_0076726 | 3300046462 | Bacteria | 2531 |
| 235 | Ga0495582_0016028 | 3300046473 | Bacteria | 4109 |
| 236 | Ga0495639_0019857 | 3300046475 | Bacteria | 2933 |
| 237 | Ga0495664_0248235 | 3300046477 | Bacteria | 1076 |
| 238 | Ga0495594_0054678 | 3300046499 | Bacteria | 2200 |
| 239 | Ga0495618_0124799 | 3300046514 | Bacteria | 1648 |
| 240 | Ga0495628_0036046 | 3300046516 | Bacteria | 3973 |
| 241 | Ga0495630_0012448 | 3300046517 | Bacteria | 6177 |
| 242 | Ga0495666_0004187 | 3300046526 | Bacteria | 7275 |
| 243 | Ga0495640_0043210 | 3300046533 | Bacteria | 3140 |
| 244 | Ga0495587_0003696 | 3300046536 | Bacteria | 10179 |
| 245 | Ga0495645_0000833 | 3300046543 | Bacteria | 20988 |
| 246 | Ga0495645_0463239 | 3300046543 | Bacteria | 798 |
| 247 | Ga0495667_0222323 | 3300046559 | Bacteria | 1205 |
| 248 | Ga0495599_0020610 | 3300046678 | Bacteria | 4106 |
| 249 | Ga0495623_0004466 | 3300046679 | Bacteria | 9187 |
| 250 | Ga0495647_0349193 | 3300046681 | Bacteria | 673 |
| 251 | Ga0495658_0013604 | 3300046683 | Bacteria | 4144 |
| 252 | Ga0495600_0678705 | 3300046809 | Bacteria | 621 |
| 253 | Ga0495674_0055590 | 3300047319 | Bacteria | 3470 |
| 254 | Ga0495680_0024441 | 3300047322 | Bacteria | 5012 |
| 255 | Ga0495675_0005482 | 3300047444 | Bacteria | 7743 |
| 256 | Ga0495686_0004173 | 3300047472 | Bacteria | 12007 |
| 257 | Ga0496102_0005571 | 3300048905 | Bacteria | 10694 |
| 258 | Ga0496102_0629792 | 3300048905 | Bacteria | 996 |
| 259 | Ga0496102_0646692 | 3300048905 | Bacteria | 981 |
| 260 | Ga0496103_0007600 | 3300048906 | Bacteria | 6450 |
| 261 | Ga0496104_0908047 | 3300048907 | Bacteria | 786 |
| 262 | Ga0496106_0199237 | 3300048909 | Bacteria | 1593 |
| 263 | Ga0496109_0024477 | 3300048912 | Bacteria | 5368 |
| 264 | Ga0496112_0145390 | 3300048915 | Bacteria | 2339 |
| 265 | Ga0496113_0081717 | 3300048916 | Bacteria | 2477 |
| 266 | Ga0496117_0099244 | 3300048920 | Bacteria | 1848 |
| 267 | Ga0496118_0004571 | 3300048921 | Bacteria | 16291 |
| 268 | Ga0501034_0001068 | 3300049571 | Bacteria | 38811 |
| 269 | Ga0501034_0048853 | 3300049571 | Bacteria | 4270 |
| 270 | Ga0501070_0752541 | 3300049586 | Bacteria | 768 |
| 271 | Ga0501072_0298117 | 3300049588 | Bacteria | 1282 |
| 272 | Ga0501073_0127355 | 3300049589 | Bacteria | 1765 |
| 273 | Ga0501083_0947853 | 3300049744 | Bacteria | 560 |
| 274 | nmdc:mga03n38_84126_c1 | 3300050490 | Bacteria | 1501 |
| 275 | nmdc:mga0qj67_126108_c1 | 3300050509 | Bacteria | 2072 |
| 276 | nmdc:mga0qj67_712831_c1 | 3300050509 | Bacteria | 798 |
| 277 | nmdc:mga06r32_58490_c1 | 3300050510 | Bacteria | 3704 |
| 278 | nmdc:mga08y16_164484_c1 | 3300050511 | Bacteria | 2305 |
| 279 | nmdc:mga08y16_288363_c1 | 3300050511 | Bacteria | 1692 |
| 280 | nmdc:mga08x19_1026729_c1 | 3300050514 | Bacteria | 586 |
| 281 | nmdc:mga08x19_7196_c2 | 3300050514 | Bacteria | 2493 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8055157932 | 8055161970 | 149 |
| 2 | 3300041456 | Ga0451795_1089898 | Ga0451795_1089898_52_546 | 152 |
| 3 | 3300049744 | Ga0501083_0947853 | Ga0501083_0947853_50_538 | 156 |
| 4 | 3300042439 | Ga0439464_0196734 | Ga0439464_0196734_45_542 | 159 |
| 5 | 3300050511 | nmdc:mga08y16_164484_c1 | nmdc:mga08y16_164484_c1_1044_1541 | 159 |
| 6 | 3300005518 | Ga0070699_100805751 | Ga0070699_1008057511 | 160 |
| 7 | 3300005543 | Ga0070672_100037093 | Ga0070672_1000370933 | 160 |
| 8 | 3300006844 | Ga0075428_100626100 | Ga0075428_1006261001 | 160 |
| 9 | 3300009011 | Ga0105251_10156228 | Ga0105251_101562282 | 160 |
| 10 | 3300009147 | Ga0114129_10834590 | Ga0114129_108345902 | 160 |
| 11 | 3300009176 | Ga0105242_10006112 | Ga0105242_100061124 | 160 |
| 12 | 3300009177 | Ga0105248_10078853 | Ga0105248_100788535 | 160 |
| 13 | 3300011119 | Ga0105246_10003404 | Ga0105246_1000340410 | 160 |
| 14 | 3300013100 | Ga0157373_10265238 | Ga0157373_102652382 | 160 |
| 15 | 3300013308 | Ga0157375_10816069 | Ga0157375_108160691 | 160 |
| 16 | 3300014325 | Ga0163163_10348781 | Ga0163163_103487813 | 160 |
| 17 | 3300014968 | Ga0157379_10014920 | Ga0157379_100149201 | 160 |
| 18 | 3300025940 | Ga0207691_10063415 | Ga0207691_100634156 | 160 |
| 19 | 3300031241 | Ga0265325_10027060 | Ga0265325_100270601 | 160 |
| 20 | 3300042876 | Ga0451577_0061658 | Ga0451577_0061658_1255_1743 | 160 |
| 21 | 3300044673 | Ga0453683_0179193 | Ga0453683_0179193_50_538 | 160 |
| 22 | 3300044719 | Ga0466971_0628850 | Ga0466971_0628850_25_525 | 160 |
| 23 | 3300045051 | Ga0451576_0183260 | Ga0451576_0183260_104_592 | 160 |
| 24 | 3300045051 | Ga0451576_1404952 | Ga0451576_1404952_54_542 | 160 |
| 25 | 3300046473 | Ga0495582_0016028 | Ga0495582_0016028_135_623 | 160 |
| 26 | 3300046475 | Ga0495639_0019857 | Ga0495639_0019857_350_838 | 160 |
| 27 | 3300046477 | Ga0495664_0248235 | Ga0495664_0248235_240_728 | 160 |
| 28 | 3300046499 | Ga0495594_0054678 | Ga0495594_0054678_1372_1860 | 160 |
| 29 | 3300046514 | Ga0495618_0124799 | Ga0495618_0124799_795_1283 | 160 |
| 30 | 3300046516 | Ga0495628_0036046 | Ga0495628_0036046_934_1422 | 160 |
| 31 | 3300046517 | Ga0495630_0012448 | Ga0495630_0012448_2357_2845 | 160 |
| 32 | 3300046526 | Ga0495666_0004187 | Ga0495666_0004187_6397_6885 | 160 |
| 33 | 3300046533 | Ga0495640_0043210 | Ga0495640_0043210_2332_2820 | 160 |
| 34 | 3300046543 | Ga0495645_0463239 | Ga0495645_0463239_49_537 | 160 |
| 35 | 3300046559 | Ga0495667_0222323 | Ga0495667_0222323_159_647 | 160 |
| 36 | 3300046681 | Ga0495647_0349193 | Ga0495647_0349193_73_561 | 160 |
| 37 | 3300046683 | Ga0495658_0013604 | Ga0495658_0013604_3001_3489 | 160 |
| 38 | 3300046809 | Ga0495600_0678705 | Ga0495600_0678705_30_518 | 160 |
| 39 | 3300047319 | Ga0495674_0055590 | Ga0495674_0055590_2667_3155 | 160 |
| 40 | 3300047322 | Ga0495680_0024441 | Ga0495680_0024441_4171_4659 | 160 |
| 41 | 3300048905 | Ga0496102_0005571 | Ga0496102_0005571_453_941 | 160 |
| 42 | 3300048906 | Ga0496103_0007600 | Ga0496103_0007600_4818_5306 | 160 |
| 43 | 3300048912 | Ga0496109_0024477 | Ga0496109_0024477_3954_4442 | 160 |
| 44 | 3300048915 | Ga0496112_0145390 | Ga0496112_0145390_109_597 | 160 |
| 45 | 3300048916 | Ga0496113_0081717 | Ga0496113_0081717_1780_2268 | 160 |
| 46 | 3300050514 | nmdc:mga08x19_7196_c2 | nmdc:mga08x19_7196_c2_57_545 | 160 |
| 47 | 3300025939 | Ga0207665_10971485 | Ga0207665_109714851 | 168 |
| 48 | 3300039453 | Ga0436362_0966708 | Ga0436362_0966708_71_595 | 168 |
| 49 | 3300009093 | Ga0105240_10097469 | Ga0105240_100974696 | 169 |
| 50 | 3300009098 | Ga0105245_10724043 | Ga0105245_107240432 | 169 |
| 51 | 3300012482 | Ga0157318_1015551 | Ga0157318_10155511 | 169 |
| 52 | 3300013105 | Ga0157369_10644267 | Ga0157369_106442672 | 169 |
| 53 | 3300013296 | Ga0157374_10001170 | Ga0157374_1000117022 | 169 |
| 54 | 3300013297 | Ga0157378_10010537 | Ga0157378_100105376 | 169 |
| 55 | 3300013307 | Ga0157372_10004750 | Ga0157372_1000475012 | 169 |
| 56 | 3300047472 | Ga0495686_0004173 | Ga0495686_0004173_1145_1660 | 169 |
| 57 | 3300048909 | Ga0496106_0199237 | Ga0496106_0199237_55_582 | 169 |
| 58 | 3300050509 | nmdc:mga0qj67_712831_c1 | nmdc:mga0qj67_712831_c1_246_773 | 169 |
| 59 | 3300005340 | Ga0070689_100305176 | Ga0070689_1003051762 | 170 |
| 60 | 3300005364 | Ga0070673_100170222 | Ga0070673_1001702223 | 170 |
| 61 | 3300009094 | Ga0111539_10845730 | Ga0111539_108457301 | 170 |
| 62 | 3300025926 | Ga0207659_10401694 | Ga0207659_104016942 | 170 |
| 63 | 3300025960 | Ga0207651_10315020 | Ga0207651_103150201 | 170 |
| 64 | 3300005336 | Ga0070680_100125169 | Ga0070680_1001251693 | 175 |
| 65 | 3300005539 | Ga0068853_100055989 | Ga0068853_1000559891 | 175 |
| 66 | 3300006846 | Ga0075430_100058515 | Ga0075430_1000585153 | 175 |
| 67 | 3300009093 | Ga0105240_10000042 | Ga0105240_100000428 | 175 |
| 68 | 3300025913 | Ga0207695_10000002 | Ga0207695_100000021720 | 175 |
| 69 | 3300050509 | nmdc:mga0qj67_126108_c1 | nmdc:mga0qj67_126108_c1_820_1371 | 175 |
| 70 | 3300050510 | nmdc:mga06r32_58490_c1 | nmdc:mga06r32_58490_c1_2062_2613 | 175 |
| 71 | 3300005295 | Ga0065707_10095862 | Ga0065707_100958622 | 178 |
| 72 | 3300005328 | Ga0070676_10013333 | Ga0070676_100133336 | 178 |
| 73 | 3300005329 | Ga0070683_100004500 | Ga0070683_1000045005 | 178 |
| 74 | 3300005331 | Ga0070670_100285647 | Ga0070670_1002856472 | 178 |
| 75 | 3300005334 | Ga0068869_100030887 | Ga0068869_1000308872 | 178 |
| 76 | 3300005335 | Ga0070666_10109677 | Ga0070666_101096772 | 178 |
| 77 | 3300005339 | Ga0070660_100101450 | Ga0070660_1001014502 | 178 |
| 78 | 3300005344 | Ga0070661_100015704 | Ga0070661_1000157044 | 178 |
| 79 | 3300005345 | Ga0070692_10010623 | Ga0070692_100106234 | 178 |
| 80 | 3300005353 | Ga0070669_100026688 | Ga0070669_1000266884 | 178 |
| 81 | 3300005366 | Ga0070659_100069879 | Ga0070659_1000698793 | 178 |
| 82 | 3300005435 | Ga0070714_100822096 | Ga0070714_1008220961 | 178 |
| 83 | 3300005437 | Ga0070710_10022696 | Ga0070710_100226962 | 178 |
| 84 | 3300005455 | Ga0070663_100127717 | Ga0070663_1001277172 | 178 |
| 85 | 3300005466 | Ga0070685_10084129 | Ga0070685_100841292 | 178 |
| 86 | 3300005535 | Ga0070684_100003532 | Ga0070684_1000035327 | 178 |
| 87 | 3300005543 | Ga0070672_100180026 | Ga0070672_1001800261 | 178 |
| 88 | 3300005563 | Ga0068855_100028703 | Ga0068855_1000287036 | 178 |
| 89 | 3300005564 | Ga0070664_100025589 | Ga0070664_1000255895 | 178 |
| 90 | 3300005577 | Ga0068857_100010126 | Ga0068857_1000101266 | 178 |
| 91 | 3300005578 | Ga0068854_100928177 | Ga0068854_1009281771 | 178 |
| 92 | 3300005616 | Ga0068852_100025425 | Ga0068852_1000254254 | 178 |
| 93 | 3300005841 | Ga0068863_100068255 | Ga0068863_1000682554 | 178 |
| 94 | 3300005842 | Ga0068858_100043286 | Ga0068858_1000432862 | 178 |
| 95 | 3300005844 | Ga0068862_100294929 | Ga0068862_1002949291 | 178 |
| 96 | 3300006173 | Ga0070716_100003962 | Ga0070716_1000039624 | 178 |
| 97 | 3300006914 | Ga0075436_100137758 | Ga0075436_1001377582 | 178 |
| 98 | 3300009098 | Ga0105245_10097632 | Ga0105245_100976322 | 178 |
| 99 | 3300013102 | Ga0157371_10022320 | Ga0157371_100223203 | 178 |
| 100 | 3300013296 | Ga0157374_10108923 | Ga0157374_101089234 | 178 |
| 101 | 3300013307 | Ga0157372_10166092 | Ga0157372_101660923 | 178 |
| 102 | 3300014745 | Ga0157377_10053548 | Ga0157377_100535482 | 178 |
| 103 | 3300025906 | Ga0207699_10105148 | Ga0207699_101051482 | 178 |
| 104 | 3300025916 | Ga0207663_10220529 | Ga0207663_102205292 | 178 |
| 105 | 3300025939 | Ga0207665_10003614 | Ga0207665_100036145 | 178 |
| 106 | 3300035121 | Ga0373960_0163263 | Ga0373960_0163263_159_704 | 178 |
| 107 | 3300050514 | nmdc:mga08x19_1026729_c1 | nmdc:mga08x19_1026729_c1_28_573 | 178 |
| 108 | 3300005471 | Ga0070698_100913795 | Ga0070698_1009137951 | 179 |
| 109 | 3300025927 | Ga0207687_10044024 | Ga0207687_100440243 | 179 |
| 110 | 3300025934 | Ga0207686_10210881 | Ga0207686_102108811 | 179 |
| 111 | 3300032002 | Ga0307416_100120597 | Ga0307416_1001205973 | 179 |
| 112 | 3300041406 | Ga0439439_0008900 | Ga0439439_0008900_37_603 | 179 |
| 113 | 3300048907 | Ga0496104_0908047 | Ga0496104_0908047_159_725 | 179 |
| 114 | 3300048920 | Ga0496117_0099244 | Ga0496117_0099244_448_1011 | 179 |
| 115 | 3300048921 | Ga0496118_0004571 | Ga0496118_0004571_11782_12345 | 179 |
| 116 | 3300049571 | Ga0501034_0048853 | Ga0501034_0048853_774_1340 | 179 |
| 117 | 3300050490 | nmdc:mga03n38_84126_c1 | nmdc:mga03n38_84126_c1_520_1065 | 179 |
| 118 | 3300050511 | nmdc:mga08y16_288363_c1 | nmdc:mga08y16_288363_c1_369_926 | 179 |
| 119 | 3300001976 | JGI24752J21851_1005266 | JGI24752J21851_10052662 | 180 |
| 120 | 3300002987 | JGI25159J45721_1004130 | JGI25159J45721_10041304 | 180 |
| 121 | 3300004625 | Ga0055543_1004086 | Ga0055543_10040863 | 180 |
| 122 | 3300005262 | Ga0065165_1000094 | Ga0065165_100009494 | 180 |
| 123 | 3300005329 | Ga0070683_100238225 | Ga0070683_1002382252 | 180 |
| 124 | 3300005330 | Ga0070690_100002550 | Ga0070690_10000255014 | 180 |
| 125 | 3300005334 | Ga0068869_100123552 | Ga0068869_1001235522 | 180 |
| 126 | 3300005336 | Ga0070680_100128726 | Ga0070680_1001287262 | 180 |
| 127 | 3300005336 | Ga0070680_100622791 | Ga0070680_1006227911 | 180 |
| 128 | 3300005337 | Ga0070682_100034914 | Ga0070682_1000349144 | 180 |
| 129 | 3300005338 | Ga0068868_100471737 | Ga0068868_1004717371 | 180 |
| 130 | 3300005339 | Ga0070660_100401046 | Ga0070660_1004010462 | 180 |
| 131 | 3300005344 | Ga0070661_100177536 | Ga0070661_1001775362 | 180 |
| 132 | 3300005345 | Ga0070692_10027027 | Ga0070692_100270275 | 180 |
| 133 | 3300005353 | Ga0070669_100217920 | Ga0070669_1002179202 | 180 |
| 134 | 3300005354 | Ga0070675_100004066 | Ga0070675_1000040662 | 180 |
| 135 | 3300005354 | Ga0070675_100539840 | Ga0070675_1005398402 | 180 |
| 136 | 3300005355 | Ga0070671_100125175 | Ga0070671_1001251752 | 180 |
| 137 | 3300005364 | Ga0070673_100265901 | Ga0070673_1002659011 | 180 |
| 138 | 3300005366 | Ga0070659_100116451 | Ga0070659_1001164512 | 180 |
| 139 | 3300005367 | Ga0070667_100223489 | Ga0070667_1002234892 | 180 |
| 140 | 3300005439 | Ga0070711_100629658 | Ga0070711_1006296581 | 180 |
| 141 | 3300005441 | Ga0070700_100708509 | Ga0070700_1007085091 | 180 |
| 142 | 3300005445 | Ga0070708_100765934 | Ga0070708_1007659341 | 180 |
| 143 | 3300005455 | Ga0070663_100250469 | Ga0070663_1002504692 | 180 |
| 144 | 3300005458 | Ga0070681_10097231 | Ga0070681_100972313 | 180 |
| 145 | 3300005458 | Ga0070681_10236057 | Ga0070681_102360572 | 180 |
| 146 | 3300005468 | Ga0070707_100331592 | Ga0070707_1003315922 | 180 |
| 147 | 3300005530 | Ga0070679_100014289 | Ga0070679_1000142893 | 180 |
| 148 | 3300005530 | Ga0070679_100136223 | Ga0070679_1001362232 | 180 |
| 149 | 3300005544 | Ga0070686_100345622 | Ga0070686_1003456222 | 180 |
| 150 | 3300005545 | Ga0070695_100109571 | Ga0070695_1001095711 | 180 |
| 151 | 3300005547 | Ga0070693_100007641 | Ga0070693_1000076417 | 180 |
| 152 | 3300005548 | Ga0070665_100781329 | Ga0070665_1007813291 | 180 |
| 153 | 3300005563 | Ga0068855_100403029 | Ga0068855_1004030292 | 180 |
| 154 | 3300005577 | Ga0068857_100414908 | Ga0068857_1004149082 | 180 |
| 155 | 3300005577 | Ga0068857_100586336 | Ga0068857_1005863361 | 180 |
| 156 | 3300005614 | Ga0068856_100035974 | Ga0068856_1000359747 | 180 |
| 157 | 3300005615 | Ga0070702_100021697 | Ga0070702_1000216973 | 180 |
| 158 | 3300005616 | Ga0068852_100091331 | Ga0068852_1000913312 | 180 |
| 159 | 3300005617 | Ga0068859_100009429 | Ga0068859_10000942915 | 180 |
| 160 | 3300005618 | Ga0068864_100077658 | Ga0068864_1000776584 | 180 |
| 161 | 3300005719 | Ga0068861_100312777 | Ga0068861_1003127772 | 180 |
| 162 | 3300005840 | Ga0068870_10162127 | Ga0068870_101621272 | 180 |
| 163 | 3300005841 | Ga0068863_100003570 | Ga0068863_1000035706 | 180 |
| 164 | 3300005843 | Ga0068860_100065144 | Ga0068860_1000651445 | 180 |
| 165 | 3300005937 | Ga0081455_10061847 | Ga0081455_100618473 | 180 |
| 166 | 3300006028 | Ga0070717_10085926 | Ga0070717_100859263 | 180 |
| 167 | 3300006028 | Ga0070717_10169024 | Ga0070717_101690242 | 180 |
| 168 | 3300006163 | Ga0070715_10006670 | Ga0070715_100066706 | 180 |
| 169 | 3300006175 | Ga0070712_100082835 | Ga0070712_1000828353 | 180 |
| 170 | 3300006358 | Ga0068871_100004045 | Ga0068871_1000040452 | 180 |
| 171 | 3300006844 | Ga0075428_100326780 | Ga0075428_1003267802 | 180 |
| 172 | 3300006931 | Ga0097620_100009429 | Ga0097620_1000094292 | 180 |
| 173 | 3300009093 | Ga0105240_10455548 | Ga0105240_104555482 | 180 |
| 174 | 3300009093 | Ga0105240_11563475 | Ga0105240_115634752 | 180 |
| 175 | 3300009098 | Ga0105245_10019846 | Ga0105245_100198467 | 180 |
| 176 | 3300009148 | Ga0105243_10753018 | Ga0105243_107530182 | 180 |
| 177 | 3300009174 | Ga0105241_10218575 | Ga0105241_102185752 | 180 |
| 178 | 3300009176 | Ga0105242_10259698 | Ga0105242_102596983 | 180 |
| 179 | 3300009177 | Ga0105248_10048646 | Ga0105248_100486462 | 180 |
| 180 | 3300009551 | Ga0105238_11465773 | Ga0105238_114657732 | 180 |
| 181 | 3300011119 | Ga0105246_10050829 | Ga0105246_100508292 | 180 |
| 182 | 3300013102 | Ga0157371_10595246 | Ga0157371_105952462 | 180 |
| 183 | 3300013104 | Ga0157370_10051252 | Ga0157370_100512524 | 180 |
| 184 | 3300013104 | Ga0157370_10242341 | Ga0157370_102423413 | 180 |
| 185 | 3300013105 | Ga0157369_10015457 | Ga0157369_100154571 | 180 |
| 186 | 3300013105 | Ga0157369_10962496 | Ga0157369_109624961 | 180 |
| 187 | 3300013296 | Ga0157374_10236515 | Ga0157374_102365152 | 180 |
| 188 | 3300013306 | Ga0163162_10493779 | Ga0163162_104937792 | 180 |
| 189 | 3300013306 | Ga0163162_10761069 | Ga0163162_107610691 | 180 |
| 190 | 3300013307 | Ga0157372_10006767 | Ga0157372_1000676717 | 180 |
| 191 | 3300013307 | Ga0157372_10033768 | Ga0157372_100337686 | 180 |
| 192 | 3300013307 | Ga0157372_10177369 | Ga0157372_101773693 | 180 |
| 193 | 3300014325 | Ga0163163_10466124 | Ga0163163_104661242 | 180 |
| 194 | 3300014325 | Ga0163163_11576046 | Ga0163163_115760462 | 180 |
| 195 | 3300014326 | Ga0157380_10367018 | Ga0157380_103670182 | 180 |
| 196 | 3300014497 | Ga0182008_10042316 | Ga0182008_100423162 | 180 |
| 197 | 3300014745 | Ga0157377_10067024 | Ga0157377_100670242 | 180 |
| 198 | 3300014969 | Ga0157376_10012141 | Ga0157376_100121412 | 180 |
| 199 | 3300025284 | Ga0209130_1000324 | Ga0209130_100032419 | 180 |
| 200 | 3300025294 | Ga0209025_1004711 | Ga0209025_100471111 | 180 |
| 201 | 3300025302 | Ga0207426_1021503 | Ga0207426_10215032 | 180 |
| 202 | 3300025903 | Ga0207680_10168453 | Ga0207680_101684532 | 180 |
| 203 | 3300025907 | Ga0207645_10152140 | Ga0207645_101521403 | 180 |
| 204 | 3300025911 | Ga0207654_10126573 | Ga0207654_101265732 | 180 |
| 205 | 3300025912 | Ga0207707_10369491 | Ga0207707_103694912 | 180 |
| 206 | 3300025915 | Ga0207693_10040915 | Ga0207693_100409154 | 180 |
| 207 | 3300025919 | Ga0207657_10364270 | Ga0207657_103642701 | 180 |
| 208 | 3300025920 | Ga0207649_10083697 | Ga0207649_100836972 | 180 |
| 209 | 3300025921 | Ga0207652_10136173 | Ga0207652_101361733 | 180 |
| 210 | 3300025922 | Ga0207646_10125978 | Ga0207646_101259782 | 180 |
| 211 | 3300025925 | Ga0207650_10160209 | Ga0207650_101602092 | 180 |
| 212 | 3300025926 | Ga0207659_10009661 | Ga0207659_100096617 | 180 |
| 213 | 3300025929 | Ga0207664_10138014 | Ga0207664_101380143 | 180 |
| 214 | 3300025931 | Ga0207644_10217708 | Ga0207644_102177082 | 180 |
| 215 | 3300025932 | Ga0207690_10291409 | Ga0207690_102914092 | 180 |
| 216 | 3300025934 | Ga0207686_10304241 | Ga0207686_103042411 | 180 |
| 217 | 3300025941 | Ga0207711_10032471 | Ga0207711_100324712 | 180 |
| 218 | 3300025942 | Ga0207689_10001224 | Ga0207689_100012242 | 180 |
| 219 | 3300025944 | Ga0207661_10351677 | Ga0207661_103516772 | 180 |
| 220 | 3300025949 | Ga0207667_10150225 | Ga0207667_101502252 | 180 |
| 221 | 3300025949 | Ga0207667_10212028 | Ga0207667_102120282 | 180 |
| 222 | 3300025960 | Ga0207651_10010655 | Ga0207651_100106554 | 180 |
| 223 | 3300025986 | Ga0207658_10058885 | Ga0207658_100588855 | 180 |
| 224 | 3300026041 | Ga0207639_10561826 | Ga0207639_105618262 | 180 |
| 225 | 3300026067 | Ga0207678_10377009 | Ga0207678_103770092 | 180 |
| 226 | 3300026078 | Ga0207702_10314237 | Ga0207702_103142372 | 180 |
| 227 | 3300026088 | Ga0207641_10088125 | Ga0207641_100881253 | 180 |
| 228 | 3300026095 | Ga0207676_10002976 | Ga0207676_100029767 | 180 |
| 229 | 3300026116 | Ga0207674_10197747 | Ga0207674_101977472 | 180 |
| 230 | 3300026118 | Ga0207675_100289987 | Ga0207675_1002899872 | 180 |
| 231 | 3300026142 | Ga0207698_10135167 | Ga0207698_101351673 | 180 |
| 232 | 3300028380 | Ga0268265_10037904 | Ga0268265_100379043 | 180 |
| 233 | 3300028381 | Ga0268264_10316998 | Ga0268264_103169982 | 180 |
| 234 | 3300028381 | Ga0268264_11349779 | Ga0268264_113497791 | 180 |
| 235 | 3300028577 | Ga0265318_10026029 | Ga0265318_100260292 | 180 |
| 236 | 3300028653 | Ga0265323_10013913 | Ga0265323_100139135 | 180 |
| 237 | 3300028800 | Ga0265338_10106844 | Ga0265338_101068444 | 180 |
| 238 | 3300028800 | Ga0265338_10344735 | Ga0265338_103447351 | 180 |
| 239 | 3300029957 | Ga0265324_10077200 | Ga0265324_100772002 | 180 |
| 240 | 3300031235 | Ga0265330_10022008 | Ga0265330_100220084 | 180 |
| 241 | 3300031235 | Ga0265330_10022602 | Ga0265330_100226023 | 180 |
| 242 | 3300031240 | Ga0265320_10082341 | Ga0265320_100823412 | 180 |
| 243 | 3300031240 | Ga0265320_10235852 | Ga0265320_102358522 | 180 |
| 244 | 3300031247 | Ga0265340_10000480 | Ga0265340_1000048015 | 180 |
| 245 | 3300031249 | Ga0265339_10026962 | Ga0265339_100269622 | 180 |
| 246 | 3300031250 | Ga0265331_10009495 | Ga0265331_100094954 | 180 |
| 247 | 3300031344 | Ga0265316_10052871 | Ga0265316_100528713 | 180 |
| 248 | 3300031344 | Ga0265316_10069690 | Ga0265316_100696901 | 180 |
| 249 | 3300031344 | Ga0265316_10089192 | Ga0265316_100891924 | 180 |
| 250 | 3300031507 | Ga0307509_10000005 | Ga0307509_10000005123 | 180 |
| 251 | 3300031548 | Ga0307408_100011353 | Ga0307408_1000113533 | 180 |
| 252 | 3300031595 | Ga0265313_10012838 | Ga0265313_100128389 | 180 |
| 253 | 3300031595 | Ga0265313_10047481 | Ga0265313_100474813 | 180 |
| 254 | 3300031712 | Ga0265342_10001503 | Ga0265342_1000150319 | 180 |
| 255 | 3300031901 | Ga0307406_10000437 | Ga0307406_1000043711 | 180 |
| 256 | 3300031901 | Ga0307406_10053531 | Ga0307406_100535314 | 180 |
| 257 | 3300031995 | Ga0307409_100072959 | Ga0307409_1000729592 | 180 |
| 258 | 3300031995 | Ga0307409_100144758 | Ga0307409_1001447581 | 180 |
| 259 | 3300032002 | Ga0307416_100310937 | Ga0307416_1003109373 | 180 |
| 260 | 3300032126 | Ga0307415_100557441 | Ga0307415_1005574412 | 180 |
| 261 | 3300035119 | Ga0373956_0019243 | Ga0373956_0019243_1084_1632 | 180 |
| 262 | 3300035120 | Ga0373957_0020016 | Ga0373957_0020016_215_763 | 180 |
| 263 | 3300035172 | Ga0373955_0003795 | Ga0373955_0003795_711_1259 | 180 |
| 264 | 3300035724 | Ga0373933_0195710 | Ga0373933_0195710_620_1168 | 180 |
| 265 | 3300036401 | Ga0373937_0003048 | Ga0373937_0003048_705_1253 | 180 |
| 266 | 3300042461 | Ga0439460_0006572 | Ga0439460_0006572_1582_2130 | 180 |
| 267 | 3300042876 | Ga0451577_0240536 | Ga0451577_0240536_374_934 | 180 |
| 268 | 3300044684 | Ga0466966_0052309 | Ga0466966_0052309_58_618 | 180 |
| 269 | 3300044693 | Ga0466961_0058691 | Ga0466961_0058691_693_1253 | 180 |
| 270 | 3300044712 | Ga0453684_0384291 | Ga0453684_0384291_1004_1564 | 180 |
| 271 | 3300046462 | Ga0495651_0076726 | Ga0495651_0076726_1493_2041 | 180 |
| 272 | 3300046536 | Ga0495587_0003696 | Ga0495587_0003696_1031_1579 | 180 |
| 273 | 3300046543 | Ga0495645_0000833 | Ga0495645_0000833_16336_16884 | 180 |
| 274 | 3300046678 | Ga0495599_0020610 | Ga0495599_0020610_1473_2021 | 180 |
| 275 | 3300046679 | Ga0495623_0004466 | Ga0495623_0004466_4570_5118 | 180 |
| 276 | 3300047444 | Ga0495675_0005482 | Ga0495675_0005482_5758_6306 | 180 |
| 277 | 3300048905 | Ga0496102_0629792 | Ga0496102_0629792_392_943 | 180 |
| 278 | 3300048905 | Ga0496102_0646692 | Ga0496102_0646692_169_717 | 180 |
| 279 | 3300049571 | Ga0501034_0001068 | Ga0501034_0001068_29946_30518 | 180 |
| 280 | 3300049586 | Ga0501070_0752541 | Ga0501070_0752541_167_739 | 180 |
| 281 | 3300049588 | Ga0501072_0298117 | Ga0501072_0298117_693_1241 | 180 |
| 282 | 3300049589 | Ga0501073_0127355 | Ga0501073_0127355_969_1541 | 180 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1d1g-assembly1.cif.gz_B | dihydrofolate reductase from thermotoga maritima | 0.8339 | 3 | 179 |
| 1d1g-assembly1.cif.gz_B | dihydrofolate reductase from thermotoga maritima | 0.8246 | 3 | 179 |
| 2gd9-assembly1.cif.gz_B | crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution | 0.8159 | 2 | 179 |
| 3ky8-assembly1.cif.gz_B | crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution | 0.7835 | 3 | 180 |
| 2gd9-assembly1.cif.gz_B | crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution | 0.7763 | 2 | 179 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3fgeA01 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8366 | 159 | 180 | 2.30.110.10 |
| 2wbmB03 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8057 | 159 | 179 | 3.30.70.240 |
| af_Q54JK7_720_839_3.30.70.240 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.805 | 159 | 178 | 3.30.70.240 |
| 2gd9B01 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8025 | 2 | 176 | 3.40.430.10 |
| 2gd9B01 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7979 | 2 | 176 | 3.40.430.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5Y4C4-F1-model_v4 | deleted | 0.9665 | 88 | 180 |
|
| AF-A0A2V5KEX0-F1-model_v4 | Deaminase | 0.9648 | 97 | 180 |
GO:0008703
GO:0009231 |
| AF-A0A4Q5Y4C4-F1-model_v4 | deleted | 0.9565 | 88 | 180 |
|
| AF-A0A1G8DFK4-F1-model_v4 | Dihydrofolate reductase | 0.954 | 1 | 179 |
GO:0008703
GO:0009231 |
| AF-A0A2V5KEX0-F1-model_v4 | Deaminase | 0.9537 | 97 | 180 |
GO:0008703
GO:0009231 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar