F384699

General Info

Members Datasets Scaffolds Average Seq Length
282 185 564 236

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10176576|Ga0065715_101765762
Length 258
Sequence VRSRSHVLNGVTRETSPGSASSDWIRVEGLTKRYGAVPALADVAFSIRPREILGLIGPNGSGKTTLFECLAGVLPPTSGVIFINGQPLSVRTRTRTLFYLPDAIAPWPSQTVRWTLDFTVGFFGGRRDLLDHVIDGLALSSLLMNPIGTLSKGQRKRVLLAIGLLTSQPMLLADEPFEGLDLRQTREVAAILRDHARSGRTLFLSIHQISDAARICDRFVLLSSGKVCGTGTLDELSALARAKGAAASTLEEVFLALT

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
114 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
115 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
116 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
117 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
118 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
119 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
120 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
121 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
124 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
125 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
126 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
130 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
153 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.9
Nodule 0
Rhizoplane 4.61
Rhizosphere 91.49
Stem 0
Stem Tuber 0
Unclassified 6.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10176576 3300005293 Bacteria 1507
2 Ga0065712_10014914 3300005290 Unclassified 2496
3 Ga0065712_10142825 3300005290 Bacteria 1430
4 Ga0065715_10035409 3300005293 Bacteria 1291
5 Ga0065715_10121329 3300005293 Bacteria 2233
6 Ga0070683_100003650 3300005329 Bacteria 12541
7 Ga0070670_100006265 3300005331 Bacteria 10071
8 Ga0070670_100040613 3300005331 Bacteria 3999
9 Ga0070689_100074952 3300005340 Bacteria 2648
10 Ga0070691_10128725 3300005341 Bacteria 1281
11 Ga0070687_100068836 3300005343 Bacteria 1894
12 Ga0070661_100014519 3300005344 Bacteria 5550
13 Ga0070692_10305054 3300005345 Unclassified 973
14 Ga0070668_100419916 3300005347 Bacteria 1145
15 Ga0070669_100001923 3300005353 Bacteria 14987
16 Ga0070669_100399919 3300005353 Bacteria 1123
17 Ga0070675_100494203 3300005354 Bacteria 1102
18 Ga0070675_100790651 3300005354 Bacteria 867
19 Ga0070671_100045823 3300005355 Bacteria 3636
20 Ga0070671_100184356 3300005355 Bacteria 1768
21 Ga0070674_100004095 3300005356 Bacteria 8283
22 Ga0070674_100184211 3300005356 Bacteria 1602
23 Ga0070667_100054774 3300005367 Bacteria 3368
24 Ga0070709_10199208 3300005434 Bacteria 1417
25 Ga0070713_100237722 3300005436 Bacteria 1658
26 Ga0070701_10086791 3300005438 Bacteria 1706
27 Ga0070700_100223060 3300005441 Bacteria 1337
28 Ga0070662_100044334 3300005457 Bacteria 3185
29 Ga0070662_100155780 3300005457 Bacteria 1783
30 Ga0070662_100331528 3300005457 Bacteria 1243
31 Ga0068867_100018751 3300005459 Unclassified 4921
32 Ga0068867_100092223 3300005459 Bacteria 2300
33 Ga0070707_100112404 3300005468 Bacteria 2642
34 Ga0068853_100455794 3300005539 Bacteria 1203
35 Ga0070672_100051198 3300005543 Bacteria 3219
36 Ga0070672_100167518 3300005543 Bacteria 1825
37 Ga0070686_100083197 3300005544 Bacteria 2124
38 Ga0070696_100096675 3300005546 Bacteria 2111
39 Ga0070696_100639585 3300005546 Bacteria 861
40 Ga0070693_100094260 3300005547 Bacteria 1811
41 Ga0068855_100187439 3300005563 Bacteria 2336
42 Ga0070664_100002291 3300005564 Bacteria 15388
43 Ga0070664_100315268 3300005564 Bacteria 1416
44 Ga0068857_100013772 3300005577 Bacteria 7046
45 Ga0068857_100040867 3300005577 Bacteria 4112
46 Ga0068854_100147195 3300005578 Bacteria 1813
47 Ga0068854_100307811 3300005578 Unclassified 1284
48 Ga0068854_100763416 3300005578 Bacteria 840
49 Ga0070702_100015251 3300005615 Bacteria 3919
50 Ga0068859_100186825 3300005617 Bacteria 2156
51 Ga0068859_100485978 3300005617 Bacteria 1330
52 Ga0068866_10006194 3300005718 Bacteria 4980
53 Ga0068861_100050163 3300005719 Bacteria 3163
54 Ga0068863_100309883 3300005841 Bacteria 1532
55 Ga0068858_100048115 3300005842 Bacteria 3952
56 Ga0068862_100045358 3300005844 Bacteria 3751
57 Ga0068862_100144592 3300005844 Bacteria 2113
58 Ga0075368_10011091 3300006042 Bacteria 3274
59 Ga0075364_10008656 3300006051 Bacteria 6084
60 Ga0075362_10013316 3300006177 Bacteria 3290
61 Ga0075367_10004369 3300006178 Bacteria 6893
62 Ga0075367_10012086 3300006178 Bacteria 4591
63 Ga0075366_10037129 3300006195 Bacteria 2874
64 Ga0075366_10067981 3300006195 Bacteria 2121
65 Ga0075428_100001509 3300006844 Bacteria 24916
66 Ga0075431_100004517 3300006847 Bacteria 13663
67 Ga0075431_100127716 3300006847 Bacteria 2623
68 Ga0075433_10048225 3300006852 Bacteria 3704
69 Ga0075433_10259962 3300006852 Bacteria 1539
70 Ga0075434_100000422 3300006871 Bacteria 31341
71 Ga0075434_100030314 3300006871 Bacteria 5325
72 Ga0075434_100057010 3300006871 Bacteria 3882
73 Ga0075434_100071945 3300006871 Bacteria 3450
74 Ga0075434_100136399 3300006871 Unclassified 2473
75 Ga0075434_100262660 3300006871 Bacteria 1746
76 Ga0075429_100031102 3300006880 Bacteria 4640
77 Ga0075429_100153411 3300006880 Unclassified 2017
78 Ga0075436_100005606 3300006914 Bacteria 8614
79 Ga0075436_100028917 3300006914 Bacteria 3813
80 Ga0075436_100242147 3300006914 Bacteria 1283
81 Ga0097620_100186835 3300006931 Bacteria 2156
82 Ga0097620_100485962 3300006931 Bacteria 1330
83 Ga0075435_100000012 3300007076 Bacteria 108852
84 Ga0075435_100013066 3300007076 Bacteria 6167
85 Ga0075435_100014611 3300007076 Bacteria 5876
86 Ga0075435_100301106 3300007076 Bacteria 1371
87 Ga0075435_100395033 3300007076 Bacteria 1189
88 Ga0075435_100409138 3300007076 Bacteria 1167
89 Ga0075435_100410220 3300007076 Bacteria 1166
90 Ga0105240_10098817 3300009093 Bacteria 3553
91 Ga0105240_10405516 3300009093 Bacteria 1535
92 Ga0111539_10001852 3300009094 Bacteria 28133
93 Ga0111539_10013569 3300009094 Bacteria 10186
94 Ga0111539_10116446 3300009094 Bacteria 3134
95 Ga0111539_10126431 3300009094 Bacteria 2995
96 Ga0111539_10361163 3300009094 Bacteria 1690
97 Ga0111539_10846071 3300009094 Unclassified 1064
98 Ga0105245_10279868 3300009098 Bacteria 1630
99 Ga0114129_10059335 3300009147 Bacteria 5349
100 Ga0114129_10096070 3300009147 Bacteria 4103
101 Ga0114129_10437876 3300009147 Bacteria 1716
102 Ga0105243_10011187 3300009148 Bacteria 6787
103 Ga0105242_10012650 3300009176 Bacteria 6498
104 Ga0105242_10031081 3300009176 Bacteria 4263
105 Ga0105248_10107240 3300009177 Bacteria 3150
106 Ga0105248_10219612 3300009177 Bacteria 2140
107 Ga0105248_10511915 3300009177 Bacteria 1353
108 Ga0105237_10034357 3300009545 Bacteria 5135
109 Ga0105238_10537818 3300009551 Bacteria 1172
110 Ga0105249_10015713 3300009553 Bacteria 6704
111 Ga0105249_10028416 3300009553 Bacteria 5047
112 Ga0105239_11170865 3300010375 Bacteria 886
113 Ga0157374_10060657 3300013296 Bacteria 3540
114 Ga0157378_10012837 3300013297 Bacteria 7332
115 Ga0157375_10544108 3300013308 Bacteria 1323
116 Ga0157380_10120648 3300014326 Unclassified 2220
117 Ga0157380_10332782 3300014326 Bacteria 1413
118 Ga0157380_10369444 3300014326 Bacteria 1349
119 Ga0157377_10410300 3300014745 Bacteria 925
120 Ga0157379_10094809 3300014968 Bacteria 2678
121 Ga0157376_10039464 3300014969 Bacteria 3851
122 Ga0207697_10090330 3300025315 Bacteria 1298
123 Ga0207653_10022760 3300025885 Bacteria 1992
124 Ga0207682_10053947 3300025893 Bacteria 1669
125 Ga0207699_10439871 3300025906 Bacteria 934
126 Ga0207684_10273369 3300025910 Unclassified 1458
127 Ga0207707_10190957 3300025912 Bacteria 1787
128 Ga0207695_10094264 3300025913 Bacteria 3001
129 Ga0207671_10020188 3300025914 Bacteria 5076
130 Ga0207662_10017921 3300025918 Bacteria 4010
131 Ga0207649_10026005 3300025920 Bacteria 3419
132 Ga0207681_10030248 3300025923 Bacteria 3528
133 Ga0207650_10076077 3300025925 Bacteria 2535
134 Ga0207650_10205267 3300025925 Bacteria 1580
135 Ga0207659_10419878 3300025926 Unclassified 1121
136 Ga0207659_10609776 3300025926 Bacteria 931
137 Ga0207664_10023642 3300025929 Bacteria 4607
138 Ga0207644_10062967 3300025931 Bacteria 2692
139 Ga0207644_10215573 3300025931 Bacteria 1519
140 Ga0207706_10097250 3300025933 Bacteria 2589
141 Ga0207706_10342403 3300025933 Bacteria 1301
142 Ga0207686_10058981 3300025934 Bacteria 2423
143 Ga0207709_10007059 3300025935 Bacteria 6280
144 Ga0207709_10021695 3300025935 Unclassified 3637
145 Ga0207670_10099897 3300025936 Bacteria 2071
146 Ga0207669_10028438 3300025937 Unclassified 3076
147 Ga0207669_10159392 3300025937 Bacteria 1592
148 Ga0207669_10703272 3300025937 Bacteria 831
149 Ga0207691_10101371 3300025940 Bacteria 2569
150 Ga0207691_10136364 3300025940 Bacteria 2164
151 Ga0207711_10152834 3300025941 Bacteria 2084
152 Ga0207711_10361240 3300025941 Bacteria 1345
153 Ga0207689_10005910 3300025942 Bacteria 10838
154 Ga0207689_10277089 3300025942 Unclassified 1389
155 Ga0207661_10006787 3300025944 Bacteria 8109
156 Ga0207679_10007076 3300025945 Bacteria 7113
157 Ga0207679_10313997 3300025945 Bacteria 1355
158 Ga0207712_10007942 3300025961 Bacteria 6705
159 Ga0207668_10088702 3300025972 Unclassified 2266
160 Ga0207640_10136224 3300025981 Bacteria 1783
161 Ga0207640_10334045 3300025981 Bacteria 1211
162 Ga0207703_10258047 3300026035 Bacteria 1574
163 Ga0207678_10027243 3300026067 Bacteria 4983
164 Ga0207708_10006874 3300026075 Bacteria 8417
165 Ga0207708_10046966 3300026075 Bacteria 3289
166 Ga0207641_10269548 3300026088 Bacteria 1597
167 Ga0207641_10678248 3300026088 Bacteria 1014
168 Ga0207648_10017686 3300026089 Bacteria 6476
169 Ga0207648_10059570 3300026089 Unclassified 3330
170 Ga0207674_10018883 3300026116 Bacteria 7478
171 Ga0207674_10113171 3300026116 Bacteria 2687
172 Ga0207675_100148432 3300026118 Bacteria 2231
173 Ga0207683_10026921 3300026121 Bacteria 4968
174 Ga0207428_10018644 3300027907 Bacteria 5924
175 Ga0265331_10141251 3300031250 Bacteria 1095
176 Ga0265316_10141459 3300031344 Bacteria 1807
177 Ga0307410_10013093 3300031852 Bacteria 4826
178 Ga0307409_100021193 3300031995 Bacteria 4450
179 Ga0307409_100152577 3300031995 Bacteria 2008
180 Ga0307414_10068169 3300032004 Bacteria 2552
181 Ga0307411_10013855 3300032005 Bacteria 4466
182 Ga0373930_0007220 3300034816 Bacteria 1905
183 Ga0373948_0015914 3300034817 Bacteria 1385
184 Ga0373950_0008429 3300034818 Bacteria 1622
185 Ga0373928_0004260 3300035084 Bacteria 2730
186 Ga0373929_0009785 3300035085 Bacteria 1782
187 Ga0373940_0001508 3300035088 Bacteria 4237
188 Ga0373949_0002765 3300035090 Bacteria 4379
189 Ga0373951_0050233 3300035091 Bacteria 1024
190 Ga0373952_0003455 3300035092 Bacteria 2850
191 Ga0373923_0175068 3300035111 Bacteria 984
192 Ga0373932_0001838 3300035112 Bacteria 5678
193 Ga0373939_0001094 3300035114 Bacteria 6653
194 Ga0373941_0000733 3300035115 Bacteria 6732
195 Ga0373960_0000149 3300035121 Bacteria 11782
196 Ga0373943_0099103 3300035170 Bacteria 1521
197 Ga0373955_0412377 3300035172 Bacteria 821
198 Ga0373942_0001584 3300035207 Bacteria 5834
199 Ga0373961_0006876 3300035241 Bacteria 2736
200 Ga0373931_0058303 3300035691 Bacteria 2073
201 Ga0373935_0313141 3300035692 Bacteria 1112
202 Ga0373927_0474847 3300035695 Bacteria 826
203 Ga0373937_0002916 3300036401 Bacteria 14295
204 Ga0373925_0019038 3300037068 Bacteria 4991
205 Ga0451802_0377453 3300041460 Unclassified 1061
206 Ga0451576_0008981 3300045051 Bacteria 11649
207 Ga0451576_0143101 3300045051 Bacteria 2494
208 Ga0451576_0233956 3300045051 Bacteria 1919
209 Ga0495603_0376699 3300046455 Bacteria 814
210 Ga0495629_0243166 3300046459 Bacteria 1239
211 Ga0495641_0302753 3300046461 Bacteria 721
212 Ga0495651_0096962 3300046462 Bacteria 2202
213 Ga0495662_0045162 3300046476 Bacteria 2126
214 Ga0495664_0000466 3300046477 Bacteria 19988
215 Ga0495608_0042573 3300046511 Bacteria 3037
216 Ga0495618_0161695 3300046514 Bacteria 1427
217 Ga0495628_0002337 3300046516 Bacteria 17123
218 Ga0495630_0055999 3300046517 Bacteria 2954
219 Ga0495645_0001439 3300046543 Bacteria 16061
220 Ga0495634_0066975 3300046642 Bacteria 2376
221 Ga0495635_0407863 3300046663 Bacteria 902
222 Ga0495635_0451924 3300046663 Bacteria 849
223 Ga0495599_0000577 3300046678 Bacteria 20939
224 Ga0495623_0032331 3300046679 Bacteria 3363
225 Ga0495646_0037023 3300046680 Bacteria 3020
226 Ga0495669_0124092 3300046684 Bacteria 1212
227 Ga0495600_0120915 3300046809 Bacteria 1703
228 Ga0495604_0056821 3300047317 Bacteria 3010
229 Ga0495604_0770615 3300047317 Bacteria 607
230 Ga0495674_0079694 3300047319 Bacteria 2812
231 Ga0495674_0171466 3300047319 Bacteria 1810
232 Ga0495680_0095167 3300047322 Bacteria 2227
233 Ga0495675_0033240 3300047444 Bacteria 3292
234 Ga0495684_0045065 3300047471 Bacteria 3375
235 Ga0495684_0482999 3300047471 Bacteria 855
236 Ga0496100_0076558 3300048903 Bacteria 2247
237 Ga0496101_0692754 3300048904 Bacteria 805
238 Ga0496104_0000830 3300048907 Bacteria 26651
239 Ga0496108_0001041 3300048911 Bacteria 21629
240 Ga0496108_0303986 3300048911 Bacteria 1390
241 Ga0496109_0024111 3300048912 Bacteria 5405
242 Ga0496110_0002605 3300048913 Bacteria 13566
243 Ga0496111_0063151 3300048914 Bacteria 2686
244 Ga0496112_0000626 3300048915 Bacteria 24545
245 Ga0496112_0116448 3300048915 Unclassified 2643
246 Ga0496113_0172529 3300048916 Bacteria 1713
247 Ga0496113_0288706 3300048916 Bacteria 1312
248 Ga0501034_0012748 3300049571 Bacteria 8670
249 Ga0501034_0105754 3300049571 Bacteria 2807
250 Ga0501067_0076320 3300049583 Bacteria 1857
251 Ga0501070_0035201 3300049586 Bacteria 4185
252 Ga0501073_0007019 3300049589 Bacteria 8391
253 nmdc:mga00v17_16645_c1 3300050491 Bacteria 4147
254 nmdc:mga00v17_424379_c1 3300050491 Bacteria 864
255 nmdc:mga0k408_10676_c1 3300050493 Bacteria 4975
256 nmdc:mga0k408_6914_c1 3300050493 Bacteria 6050
257 nmdc:mga05p37_16702_c1 3300050507 Bacteria 8845
258 nmdc:mga05p37_202494_c1 3300050507 Bacteria 2403
259 nmdc:mga05p37_44280_c1 3300050507 Bacteria 5476
260 nmdc:mga09592_140644_c1 3300050508 Unclassified 2080
261 nmdc:mga09592_165838_c1 3300050508 Bacteria 1909
262 nmdc:mga06r32_188757_c1 3300050510 Bacteria 2048
263 nmdc:mga08y16_106414_c1 3300050511 Bacteria 2920
264 nmdc:mga08y16_276447_c1 3300050511 Bacteria 1733
265 nmdc:mga08y16_29425_c1 3300050511 Bacteria 5787
266 nmdc:mga08y16_38310_c1 3300050511 Bacteria 5035
267 nmdc:mga0n895_275692_c1 3300050512 Bacteria 1706
268 nmdc:mga0n895_46972_c1 3300050512 Bacteria 4220
269 nmdc:mga0n895_643_c1 3300050512 Bacteria 24319
270 nmdc:mga0n895_72802_c1 3300050512 Bacteria 3410
271 nmdc:mga0rr50_1155_c1 3300050513 Bacteria 14374
272 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
273 nmdc:mga0rr50_277632_c1 3300050513 Bacteria 1398
274 nmdc:mga0rr50_288743_c1 3300050513 Bacteria 1370
275 nmdc:mga0rr50_51258_c1 3300050513 Bacteria 3061
276 nmdc:mga08x19_108830_c1 3300050514 Bacteria 1847
277 nmdc:mga08x19_207387_c1 3300050514 Bacteria 1345
278 nmdc:mga08x19_246_c2 3300050514 Bacteria 31844
279 nmdc:mga0a205_358887_c1 3300050515 Bacteria 1324
280 nmdc:mga0a205_704541_c1 3300050515 Bacteria 859
281 Ga0495595_0195982 3300053084 Bacteria 1005
282 Ga0495619_0370661 3300053085 Bacteria 990
283 Ga0065715_10176576
284 Ga0065712_10014914
285 Ga0065712_10142825
286 Ga0065715_10035409
287 Ga0065715_10121329
288 Ga0070683_100003650
289 Ga0070670_100006265
290 Ga0070670_100040613
291 Ga0070689_100074952
292 Ga0070691_10128725
293 Ga0070687_100068836
294 Ga0070661_100014519
295 Ga0070692_10305054
296 Ga0070668_100419916
297 Ga0070669_100001923
298 Ga0070669_100399919
299 Ga0070675_100494203
300 Ga0070675_100790651
301 Ga0070671_100045823
302 Ga0070671_100184356
303 Ga0070674_100004095
304 Ga0070674_100184211
305 Ga0070667_100054774
306 Ga0070709_10199208
307 Ga0070713_100237722
308 Ga0070701_10086791
309 Ga0070700_100223060
310 Ga0070662_100044334
311 Ga0070662_100155780
312 Ga0070662_100331528
313 Ga0068867_100018751
314 Ga0068867_100092223
315 Ga0070707_100112404
316 Ga0068853_100455794
317 Ga0070672_100051198
318 Ga0070672_100167518
319 Ga0070686_100083197
320 Ga0070696_100096675
321 Ga0070696_100639585
322 Ga0070693_100094260
323 Ga0068855_100187439
324 Ga0070664_100002291
325 Ga0070664_100315268
326 Ga0068857_100013772
327 Ga0068857_100040867
328 Ga0068854_100147195
329 Ga0068854_100307811
330 Ga0068854_100763416
331 Ga0070702_100015251
332 Ga0068859_100186825
333 Ga0068859_100485978
334 Ga0068866_10006194
335 Ga0068861_100050163
336 Ga0068863_100309883
337 Ga0068858_100048115
338 Ga0068862_100045358
339 Ga0068862_100144592
340 Ga0075368_10011091
341 Ga0075364_10008656
342 Ga0075362_10013316
343 Ga0075367_10004369
344 Ga0075367_10012086
345 Ga0075366_10037129
346 Ga0075366_10067981
347 Ga0075428_100001509
348 Ga0075431_100004517
349 Ga0075431_100127716
350 Ga0075433_10048225
351 Ga0075433_10259962
352 Ga0075434_100000422
353 Ga0075434_100030314
354 Ga0075434_100057010
355 Ga0075434_100071945
356 Ga0075434_100136399
357 Ga0075434_100262660
358 Ga0075429_100031102
359 Ga0075429_100153411
360 Ga0075436_100005606
361 Ga0075436_100028917
362 Ga0075436_100242147
363 Ga0097620_100186835
364 Ga0097620_100485962
365 Ga0075435_100000012
366 Ga0075435_100013066
367 Ga0075435_100014611
368 Ga0075435_100301106
369 Ga0075435_100395033
370 Ga0075435_100409138
371 Ga0075435_100410220
372 Ga0105240_10098817
373 Ga0105240_10405516
374 Ga0111539_10001852
375 Ga0111539_10013569
376 Ga0111539_10116446
377 Ga0111539_10126431
378 Ga0111539_10361163
379 Ga0111539_10846071
380 Ga0105245_10279868
381 Ga0114129_10059335
382 Ga0114129_10096070
383 Ga0114129_10437876
384 Ga0105243_10011187
385 Ga0105242_10012650
386 Ga0105242_10031081
387 Ga0105248_10107240
388 Ga0105248_10219612
389 Ga0105248_10511915
390 Ga0105237_10034357
391 Ga0105238_10537818
392 Ga0105249_10015713
393 Ga0105249_10028416
394 Ga0105239_11170865
395 Ga0157374_10060657
396 Ga0157378_10012837
397 Ga0157375_10544108
398 Ga0157380_10120648
399 Ga0157380_10332782
400 Ga0157380_10369444
401 Ga0157377_10410300
402 Ga0157379_10094809
403 Ga0157376_10039464
404 Ga0207697_10090330
405 Ga0207653_10022760
406 Ga0207682_10053947
407 Ga0207699_10439871
408 Ga0207684_10273369
409 Ga0207707_10190957
410 Ga0207695_10094264
411 Ga0207671_10020188
412 Ga0207662_10017921
413 Ga0207649_10026005
414 Ga0207681_10030248
415 Ga0207650_10076077
416 Ga0207650_10205267
417 Ga0207659_10419878
418 Ga0207659_10609776
419 Ga0207664_10023642
420 Ga0207644_10062967
421 Ga0207644_10215573
422 Ga0207706_10097250
423 Ga0207706_10342403
424 Ga0207686_10058981
425 Ga0207709_10007059
426 Ga0207709_10021695
427 Ga0207670_10099897
428 Ga0207669_10028438
429 Ga0207669_10159392
430 Ga0207669_10703272
431 Ga0207691_10101371
432 Ga0207691_10136364
433 Ga0207711_10152834
434 Ga0207711_10361240
435 Ga0207689_10005910
436 Ga0207689_10277089
437 Ga0207661_10006787
438 Ga0207679_10007076
439 Ga0207679_10313997
440 Ga0207712_10007942
441 Ga0207668_10088702
442 Ga0207640_10136224
443 Ga0207640_10334045
444 Ga0207703_10258047
445 Ga0207678_10027243
446 Ga0207708_10006874
447 Ga0207708_10046966
448 Ga0207641_10269548
449 Ga0207641_10678248
450 Ga0207648_10017686
451 Ga0207648_10059570
452 Ga0207674_10018883
453 Ga0207674_10113171
454 Ga0207675_100148432
455 Ga0207683_10026921
456 Ga0207428_10018644
457 Ga0265331_10141251
458 Ga0265316_10141459
459 Ga0307410_10013093
460 Ga0307409_100021193
461 Ga0307409_100152577
462 Ga0307414_10068169
463 Ga0307411_10013855
464 Ga0373930_0007220
465 Ga0373948_0015914
466 Ga0373950_0008429
467 Ga0373928_0004260
468 Ga0373929_0009785
469 Ga0373940_0001508
470 Ga0373949_0002765
471 Ga0373951_0050233
472 Ga0373952_0003455
473 Ga0373923_0175068
474 Ga0373932_0001838
475 Ga0373939_0001094
476 Ga0373941_0000733
477 Ga0373960_0000149
478 Ga0373943_0099103
479 Ga0373955_0412377
480 Ga0373942_0001584
481 Ga0373961_0006876
482 Ga0373931_0058303
483 Ga0373935_0313141
484 Ga0373927_0474847
485 Ga0373937_0002916
486 Ga0373925_0019038
487 Ga0451802_0377453
488 Ga0451576_0008981
489 Ga0451576_0143101
490 Ga0451576_0233956
491 Ga0495603_0376699
492 Ga0495629_0243166
493 Ga0495641_0302753
494 Ga0495651_0096962
495 Ga0495662_0045162
496 Ga0495664_0000466
497 Ga0495608_0042573
498 Ga0495618_0161695
499 Ga0495628_0002337
500 Ga0495630_0055999
501 Ga0495645_0001439
502 Ga0495634_0066975
503 Ga0495635_0407863
504 Ga0495635_0451924
505 Ga0495599_0000577
506 Ga0495623_0032331
507 Ga0495646_0037023
508 Ga0495669_0124092
509 Ga0495600_0120915
510 Ga0495604_0056821
511 Ga0495604_0770615
512 Ga0495674_0079694
513 Ga0495674_0171466
514 Ga0495680_0095167
515 Ga0495675_0033240
516 Ga0495684_0045065
517 Ga0495684_0482999
518 Ga0496100_0076558
519 Ga0496101_0692754
520 Ga0496104_0000830
521 Ga0496108_0001041
522 Ga0496108_0303986
523 Ga0496109_0024111
524 Ga0496110_0002605
525 Ga0496111_0063151
526 Ga0496112_0000626
527 Ga0496112_0116448
528 Ga0496113_0172529
529 Ga0496113_0288706
530 Ga0501034_0012748
531 Ga0501034_0105754
532 Ga0501067_0076320
533 Ga0501070_0035201
534 Ga0501073_0007019
535 nmdc:mga00v17_16645_c1
536 nmdc:mga00v17_424379_c1
537 nmdc:mga0k408_10676_c1
538 nmdc:mga0k408_6914_c1
539 nmdc:mga05p37_16702_c1
540 nmdc:mga05p37_202494_c1
541 nmdc:mga05p37_44280_c1
542 nmdc:mga09592_140644_c1
543 nmdc:mga09592_165838_c1
544 nmdc:mga06r32_188757_c1
545 nmdc:mga08y16_106414_c1
546 nmdc:mga08y16_276447_c1
547 nmdc:mga08y16_29425_c1
548 nmdc:mga08y16_38310_c1
549 nmdc:mga0n895_275692_c1
550 nmdc:mga0n895_46972_c1
551 nmdc:mga0n895_643_c1
552 nmdc:mga0n895_72802_c1
553 nmdc:mga0rr50_1155_c1
554 nmdc:mga0rr50_1_c1
555 nmdc:mga0rr50_277632_c1
556 nmdc:mga0rr50_288743_c1
557 nmdc:mga0rr50_51258_c1
558 nmdc:mga08x19_108830_c1
559 nmdc:mga08x19_207387_c1
560 nmdc:mga08x19_246_c2
561 nmdc:mga0a205_358887_c1
562 nmdc:mga0a205_704541_c1
563 Ga0495595_0195982
564 Ga0495619_0370661

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

40

178

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9278 6 224
8hps-assembly1.cif.gz_D lpqy-sugabc in state 5 0.9267 6 223
8hpr-assembly1.cif.gz_D lpqy-sugabc in state 4 0.9242 6 223
7lkz-assembly1.cif.gz_A structure of atp-bound human abca4 0.9219 4 225
6xgz-assembly4.cif.gz_G crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.9208 4 231
ID Description Score Start End Superfamily
af_Q9VVJ9_503_747_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9311 4 212 3.40.50.300
af_E9PWJ7_506_745_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9284 4 225 3.40.50.300
af_A0A1D6H744_679_834_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9272 120 226 3.40.50.300
af_O53149_2_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9264 1 224 3.40.50.300
af_Q9VRG3_531_774_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9263 4 225 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7M1SW73-F1-model_v4 ABC transporter ATP-binding protein 0.9267 2 223 GO:0005524
GO:0016887
GO:0046677
AF-A0A7X6Z633-F1-model_v4 Sulfate ABC transporter ATP-binding protein 0.9212 6 235 GO:0005524
GO:0015419
GO:0016887
GO:0043190
AF-A0A316AWU3-F1-model_v4 deleted 0.9174 4 210
AF-A0A1Y3N5W7-F1-model_v4 ABC transporter domain-containing protein 0.9174 20 225 GO:0005319
GO:0005524
GO:0016020
GO:0016887
GO:0043231
GO:0140359
AF-A0A1I4Q7A9-F1-model_v4 Iron complex transport system ATP-binding protein 0.916 1 223 GO:0005524
GO:0016887

Map