F384572

General Info

Members Datasets Scaffolds Average Seq Length
281 169 562 144

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0028786|Ga0501039_0028786_212_667
Length 151
Sequence LPSAHLSTIHMPASSRWEHFPHGADIGVRGFGASPAEAFEQAALAMTAVITDLELVQPQQAVQISRVCPDREILLTEWLNALVYEMATRHMLFGRFRVSIDGPHLAGVAEGERVDAARHHPAVEVKGATLTQLQVARRPDGTWVAQCVVDV

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
3 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
59 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
60 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
61 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
65 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
68 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
69 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
70 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
71 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
75 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
76 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
77 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
78 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
79 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
80 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
81 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
82 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
83 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
89 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
98 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
110 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
111 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
112 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
120 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
163 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
164 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
165 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
169 2896384573 Ensifer sp. MPMI2T Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 0.71
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.54
Rhizosphere 91.1
Stem 0
Stem Tuber 0
Unclassified 18.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0028786 3300049575 Bacteria 4278
2 Ga0070671_100089620 3300005355 Bacteria 2575
3 Ga0070688_100229235 3300005365 Bacteria 1313
4 Ga0070709_10007063 3300005434 Bacteria 6140
5 Ga0070709_10431747 3300005434 Bacteria 989
6 Ga0070714_100026637 3300005435 Bacteria 4780
7 Ga0070713_100011980 3300005436 Bacteria 6343
8 Ga0070713_100712981 3300005436 Bacteria 958
9 Ga0070710_10010896 3300005437 Bacteria 4478
10 Ga0070711_101072008 3300005439 Bacteria 693
11 Ga0070681_10089715 3300005458 Bacteria 3026
12 Ga0070685_10791852 3300005466 Bacteria 698
13 Ga0070679_100010641 3300005530 Bacteria 8729
14 Ga0070686_101234311 3300005544 Unclassified 622
15 Ga0070696_100762909 3300005546 Bacteria 793
16 Ga0070664_100038275 3300005564 Bacteria 4037
17 Ga0070702_100093209 3300005615 Bacteria 1831
18 Ga0068863_100079235 3300005841 Bacteria 3111
19 Ga0068858_100879674 3300005842 Unclassified 876
20 Ga0081455_10056452 3300005937 Bacteria 3333
21 Ga0070717_10152147 3300006028 Bacteria 2002
22 Ga0070717_10998119 3300006028 Bacteria 762
23 Ga0070716_100004168 3300006173 Bacteria 6873
24 Ga0097621_100379010 3300006237 Bacteria 1263
25 Ga0068871_100187455 3300006358 Bacteria 1780
26 Ga0075428_100016024 3300006844 Bacteria 8289
27 Ga0075434_100005391 3300006871 Bacteria 11635
28 Ga0111539_10012127 3300009094 Bacteria 10814
29 Ga0105247_10051676 3300009101 Bacteria 2532
30 Ga0114129_10004470 3300009147 Bacteria 19720
31 Ga0105239_10278800 3300010375 Bacteria 1882
32 Ga0105239_10512743 3300010375 Bacteria 1364
33 Ga0105246_10165272 3300011119 Bacteria 1689
34 Ga0105246_10207596 3300011119 Bacteria 1527
35 Ga0157370_10364733 3300013104 Bacteria 1331
36 Ga0157374_10655735 3300013296 Bacteria 1061
37 Ga0157375_10125487 3300013308 Bacteria 2681
38 Ga0163163_10022037 3300014325 Bacteria 6024
39 Ga0157379_10225903 3300014968 Bacteria 1697
40 Ga0157376_10520770 3300014969 Bacteria 1172
41 Ga0207692_10012823 3300025898 Bacteria 3614
42 Ga0207710_10129516 3300025900 Bacteria 1211
43 Ga0207699_10018339 3300025906 Bacteria 3706
44 Ga0207699_10497020 3300025906 Bacteria 880
45 Ga0207707_10034292 3300025912 Bacteria 4440
46 Ga0207671_10534657 3300025914 Bacteria 934
47 Ga0207652_10026253 3300025921 Bacteria 4848
48 Ga0207650_10010089 3300025925 Bacteria 6470
49 Ga0207700_10574710 3300025928 Bacteria 1002
50 Ga0207664_10196795 3300025929 Bacteria 1738
51 Ga0207690_10583773 3300025932 Bacteria 911
52 Ga0207665_10012174 3300025939 Bacteria 5649
53 Ga0207661_10257629 3300025944 Bacteria 1553
54 Ga0207679_10219489 3300025945 Bacteria 1599
55 Ga0207712_10784470 3300025961 Bacteria 837
56 Ga0207703_11458015 3300026035 Unclassified 658
57 Ga0207678_10827902 3300026067 Bacteria 818
58 Ga0207641_10623601 3300026088 Bacteria 1057
59 Ga0207676_10705075 3300026095 Bacteria 978
60 Ga0207674_10835139 3300026116 Unclassified 889
61 Ga0207683_10845492 3300026121 Unclassified 850
62 Ga0265334_10048090 3300028573 Bacteria 1644
63 Ga0265334_10091861 3300028573 Bacteria 1106
64 Ga0265338_10029329 3300028800 Bacteria 5455
65 Ga0265330_10032660 3300031235 Bacteria 2331
66 Ga0265325_10039059 3300031241 Bacteria 2501
67 Ga0265340_10033307 3300031247 Bacteria 2565
68 Ga0265339_10585485 3300031249 Bacteria 512
69 Ga0265331_10154081 3300031250 Bacteria 1043
70 Ga0265316_10681676 3300031344 Bacteria 725
71 Ga0316575_10021962 3300031665 Bacteria 2460
72 Ga0316575_10067596 3300031665 Unclassified 1432
73 Ga0316579_10010873 3300031691 Bacteria 3857
74 Ga0265342_10015956 3300031712 Bacteria 4924
75 Ga0316576_10334552 3300031727 Unclassified 1128
76 Ga0316576_11316020 3300031727 Bacteria 508
77 Ga0316578_10077532 3300031728 Bacteria 1973
78 Ga0316578_10139271 3300031728 Bacteria 1461
79 Ga0316577_10094967 3300031733 Bacteria 1670
80 Ga0316583_10005010 3300032133 Bacteria 4738
81 Ga0316593_10131199 3300032168 Bacteria 904
82 Ga0316587_1030600 3300033529 Bacteria 950
83 Ga0373923_0133745 3300035111 Bacteria 1117
84 Ga0373939_0000443 3300035114 Bacteria 10461
85 Ga0373939_0050166 3300035114 Bacteria 1293
86 Ga0373941_0220368 3300035115 Bacteria 729
87 Ga0373954_0089439 3300035118 Bacteria 1478
88 Ga0373956_0251770 3300035119 Unclassified 840
89 Ga0373956_0553534 3300035119 Unclassified 549
90 Ga0373960_0187820 3300035121 Unclassified 725
91 Ga0373946_0190887 3300035171 Bacteria 977
92 Ga0373955_0307813 3300035172 Bacteria 956
93 Ga0373942_0015960 3300035207 Bacteria 1837
94 Ga0373961_0083081 3300035241 Bacteria 1011
95 Ga0316574_0031387 3300035398 Bacteria 3222
96 Ga0316574_0043997 3300035398 Bacteria 2761
97 Ga0373931_0054456 3300035691 Bacteria 2138
98 Ga0373931_0781051 3300035691 Bacteria 636
99 Ga0373933_0005323 3300035724 Bacteria 7014
100 Ga0373933_0242226 3300035724 Bacteria 1160
101 Ga0373947_0053832 3300035725 Bacteria 2428
102 Ga0373937_0424200 3300036401 Unclassified 1263
103 Ga0373937_0959136 3300036401 Unclassified 804
104 Ga0373937_1289741 3300036401 Unclassified 678
105 Ga0373937_1328297 3300036401 Unclassified 667
106 Ga0316582_0059072 3300036647 Bacteria 2454
107 Ga0316582_0265651 3300036647 Bacteria 1177
108 Ga0316584_0059457 3300036712 Bacteria 2862
109 Ga0373925_0216375 3300037068 Bacteria 1528
110 Ga0373925_0420540 3300037068 Bacteria 1092
111 Ga0316581_0098269 3300037588 Bacteria 901
112 Ga0495592_0083903 3300046454 Bacteria 2300
113 Ga0495592_0367923 3300046454 Unclassified 918
114 Ga0495603_0075077 3300046455 Bacteria 1985
115 Ga0495603_0304200 3300046455 Unclassified 916
116 Ga0495629_0145964 3300046459 Bacteria 1645
117 Ga0495651_0002742 3300046462 Bacteria 13660
118 Ga0495651_0088016 3300046462 Bacteria 2334
119 Ga0495651_0153916 3300046462 Bacteria 1654
120 Ga0495653_0379412 3300046463 Bacteria 903
121 Ga0495582_0113762 3300046473 Bacteria 1521
122 Ga0495639_0549813 3300046475 Unclassified 592
123 Ga0495594_0422573 3300046499 Unclassified 758
124 Ga0495608_0434160 3300046511 Unclassified 800
125 Ga0495618_0095914 3300046514 Bacteria 1897
126 Ga0495618_0306560 3300046514 Bacteria 986
127 Ga0495630_0120499 3300046517 Bacteria 1990
128 Ga0495652_0090173 3300046529 Bacteria 2509
129 Ga0495652_0134118 3300046529 Bacteria 1956
130 Ga0495652_0330347 3300046529 Bacteria 1099
131 Ga0495587_0013171 3300046536 Bacteria 5200
132 Ga0495634_0546048 3300046642 Bacteria 676
133 Ga0495635_0664711 3300046663 Unclassified 677
134 Ga0495657_0191765 3300046675 Unclassified 1249
135 Ga0495599_0202730 3300046678 Bacteria 1218
136 Ga0495623_0048826 3300046679 Bacteria 2683
137 Ga0495623_0108275 3300046679 Bacteria 1687
138 Ga0495623_0214181 3300046679 Bacteria 1101
139 Ga0495623_0347671 3300046679 Unclassified 808
140 Ga0495658_0074246 3300046683 Bacteria 1981
141 Ga0495613_0495418 3300046689 Bacteria 823
142 Ga0495581_0172759 3300047315 Bacteria 1264
143 Ga0495581_0190352 3300047315 Bacteria 1200
144 Ga0495604_0039014 3300047317 Bacteria 3734
145 Ga0495604_0129224 3300047317 Bacteria 1818
146 Ga0495604_0186143 3300047317 Bacteria 1450
147 Ga0495674_0353915 3300047319 Bacteria 1192
148 Ga0495676_0730655 3300047321 Unclassified 640
149 Ga0495680_0070338 3300047322 Bacteria 2669
150 Ga0495680_0166382 3300047322 Bacteria 1599
151 Ga0495680_0551225 3300047322 Bacteria 777
152 Ga0495675_0141722 3300047444 Bacteria 1490
153 Ga0495684_0065988 3300047471 Bacteria 2752
154 Ga0495684_0247781 3300047471 Bacteria 1297
155 Ga0495593_0103450 3300047673 Bacteria 1459
156 Ga0495593_0275569 3300047673 Bacteria 842
157 Ga0495602_0050763 3300048088 Bacteria 3703
158 Ga0495602_0064063 3300048088 Bacteria 3181
159 Ga0495602_0108117 3300048088 Bacteria 2265
160 Ga0495602_0715548 3300048088 Bacteria 678
161 Ga0496100_0226060 3300048903 Unclassified 1375
162 Ga0496101_0139255 3300048904 Bacteria 1848
163 Ga0496101_0637479 3300048904 Bacteria 842
164 Ga0496101_0649996 3300048904 Bacteria 833
165 Ga0496102_0102197 3300048905 Bacteria 2664
166 Ga0496103_0021696 3300048906 Bacteria 3864
167 Ga0496104_0000358 3300048907 Bacteria 40736
168 Ga0496104_0006789 3300048907 Bacteria 10080
169 Ga0496104_0545003 3300048907 Bacteria 1071
170 Ga0496105_0017835 3300048908 Bacteria 5695
171 Ga0496105_0035202 3300048908 Bacteria 4120
172 Ga0496105_0617770 3300048908 Unclassified 840
173 Ga0496106_0038857 3300048909 Bacteria 3563
174 Ga0496106_0892928 3300048909 Bacteria 702
175 Ga0496106_1034831 3300048909 Bacteria 645
176 Ga0496107_0170177 3300048910 Unclassified 1616
177 Ga0496108_0021010 3300048911 Bacteria 5366
178 Ga0496109_0001209 3300048912 Bacteria 21496
179 Ga0496110_0013085 3300048913 Bacteria 6848
180 Ga0496112_0094237 3300048915 Bacteria 2964
181 Ga0496112_0915593 3300048915 Bacteria 798
182 Ga0496113_0005079 3300048916 Bacteria 8171
183 Ga0496114_0064730 3300048917 Bacteria 3062
184 Ga0496115_0619571 3300048918 Unclassified 858
185 Ga0501031_0679159 3300049568 Unclassified 661
186 Ga0501032_0407035 3300049569 Bacteria 874
187 Ga0501039_0015321 3300049575 Bacteria 5868
188 Ga0501039_0597813 3300049575 Bacteria 865
189 Ga0501040_0707060 3300049576 Bacteria 729
190 Ga0501041_0020914 3300049577 Bacteria 3918
191 Ga0501041_0154648 3300049577 Bacteria 1433
192 Ga0501041_0302450 3300049577 Bacteria 1008
193 Ga0501041_0316576 3300049577 Unclassified 984
194 Ga0501041_0607348 3300049577 Unclassified 698
195 Ga0501041_0769156 3300049577 Bacteria 617
196 Ga0501042_0364065 3300049578 Unclassified 1046
197 Ga0501042_0512007 3300049578 Unclassified 872
198 Ga0501042_0798418 3300049578 Unclassified 687
199 Ga0501043_0565523 3300049579 Unclassified 843
200 Ga0501047_0108185 3300049581 Bacteria 2662
201 Ga0501048_0114376 3300049582 Bacteria 1906
202 Ga0501068_0380168 3300049584 Unclassified 909
203 Ga0501069_0286142 3300049585 Bacteria 965
204 Ga0501071_0083695 3300049587 Bacteria 2337
205 Ga0501071_0517753 3300049587 Unclassified 915
206 Ga0501072_0292715 3300049588 Unclassified 1294
207 Ga0501072_0324006 3300049588 Bacteria 1224
208 Ga0501072_1538465 3300049588 Bacteria 513
209 Ga0501073_0063214 3300049589 Bacteria 2582
210 Ga0501074_0103432 3300049590 Bacteria 2039
211 Ga0501074_0187024 3300049590 Unclassified 1477
212 Ga0501074_1341062 3300049590 Bacteria 501
213 Ga0501075_0014545 3300049591 Bacteria 5640
214 Ga0501075_0135965 3300049591 Bacteria 1873
215 Ga0501075_0400476 3300049591 Bacteria 1046
216 Ga0501076_0048975 3300049592 Bacteria 3340
217 Ga0501076_0258449 3300049592 Bacteria 1426
218 Ga0501076_0364133 3300049592 Unclassified 1188
219 Ga0501076_0516791 3300049592 Unclassified 984
220 Ga0501076_0719604 3300049592 Bacteria 824
221 Ga0501076_0760868 3300049592 Bacteria 799
222 Ga0501077_0166041 3300049593 Unclassified 1402
223 Ga0501077_0195834 3300049593 Bacteria 1284
224 Ga0501077_0268300 3300049593 Bacteria 1086
225 Ga0501079_0023697 3300049741 Bacteria 4709
226 Ga0501079_0202401 3300049741 Bacteria 1551
227 Ga0501079_0424225 3300049741 Bacteria 1044
228 Ga0501079_0553480 3300049741 Unclassified 905
229 Ga0501080_0131451 3300049742 Bacteria 2318
230 Ga0501080_1314101 3300049742 Bacteria 619
231 Ga0501080_1430831 3300049742 Bacteria 589
232 Ga0501081_0063415 3300049743 Bacteria 2565
233 Ga0501081_0083485 3300049743 Bacteria 2239
234 Ga0501081_0253788 3300049743 Bacteria 1284
235 Ga0501083_0075078 3300049744 Bacteria 2246
236 Ga0501083_0355159 3300049744 Unclassified 953
237 Ga0501083_0537582 3300049744 Bacteria 761
238 Ga0501044_0041392 3300049823 Bacteria 4796
239 Ga0501044_0726506 3300049823 Bacteria 877
240 Ga0501045_0309398 3300049824 Bacteria 1176
241 Ga0501045_0380117 3300049824 Bacteria 1051
242 Ga0501045_0957704 3300049824 Bacteria 628
243 Ga0501045_1260688 3300049824 Unclassified 539
244 Ga0501045_1275161 3300049824 Unclassified 535
245 nmdc:mga05p37_157362_c1 3300050507 Bacteria 2776
246 nmdc:mga08y16_58106_c1 3300050511 Bacteria 4041
247 nmdc:mga0n895_22261_c1 3300050512 Bacteria 5942
248 Ga0495601_0023906 3300053077 Bacteria 3759
249 Ga0495601_0031365 3300053077 Bacteria 3303
250 Ga0495601_0074020 3300053077 Bacteria 2179
251 Ga0495601_0478110 3300053077 Unclassified 805
252 Ga0495612_0027414 3300053078 Bacteria 2290
253 Ga0495612_0107343 3300053078 Unclassified 1193
254 Ga0495612_0164816 3300053078 Unclassified 969
255 Ga0495595_0002108 3300053084 Bacteria 7734
256 Ga0495595_0056114 3300053084 Bacteria 1835
257 Ga0495595_0125635 3300053084 Unclassified 1251
258 Ga0495595_0203080 3300053084 Bacteria 987
259 Ga0495595_0704359 3300053084 Bacteria 518
260 Ga0495619_0000917 3300053085 Bacteria 19345
261 Ga0495619_0057084 3300053085 Unclassified 2590
262 Ga0495619_0087406 3300053085 Bacteria 2107
263 Ga0495619_0416906 3300053085 Bacteria 926
264 Ga0495619_0574478 3300053085 Unclassified 772
265 Ga0501084_0032854 3300054114 Unclassified 4342
266 Ga0501084_0060906 3300054114 Bacteria 3160
267 Ga0501084_0121767 3300054114 Bacteria 2193
268 Ga0501084_0456772 3300054114 Bacteria 1080
269 Ga0501084_0584598 3300054114 Bacteria 944
270 Ga0501084_1106036 3300054114 Bacteria 665
271 Ga0501082_0579913 3300060353 Bacteria 981
272 Ga0501082_0655700 3300060353 Bacteria 918
273 Ga0501082_0750378 3300060353 Bacteria 854
274 Ga0501082_0790867 3300060353 Bacteria 830
275 Ga0501082_1800664 3300060353 Unclassified 534
276 Ga0530510_0037015 3300061734 Bacteria 3516
277 Ga0530510_0161177 3300061734 Bacteria 1659
278 Ga0530510_0430642 3300061734 Bacteria 996
279 Ga0530510_0765620 3300061734 Bacteria 736
280 Ga0530510_0875536 3300061734 Bacteria 686
281 2896389529 2896384573 Bacteria 7700774
282 Ga0501039_0028786
283 Ga0070671_100089620
284 Ga0070688_100229235
285 Ga0070709_10007063
286 Ga0070709_10431747
287 Ga0070714_100026637
288 Ga0070713_100011980
289 Ga0070713_100712981
290 Ga0070710_10010896
291 Ga0070711_101072008
292 Ga0070681_10089715
293 Ga0070685_10791852
294 Ga0070679_100010641
295 Ga0070686_101234311
296 Ga0070696_100762909
297 Ga0070664_100038275
298 Ga0070702_100093209
299 Ga0068863_100079235
300 Ga0068858_100879674
301 Ga0081455_10056452
302 Ga0070717_10152147
303 Ga0070717_10998119
304 Ga0070716_100004168
305 Ga0097621_100379010
306 Ga0068871_100187455
307 Ga0075428_100016024
308 Ga0075434_100005391
309 Ga0111539_10012127
310 Ga0105247_10051676
311 Ga0114129_10004470
312 Ga0105239_10278800
313 Ga0105239_10512743
314 Ga0105246_10165272
315 Ga0105246_10207596
316 Ga0157370_10364733
317 Ga0157374_10655735
318 Ga0157375_10125487
319 Ga0163163_10022037
320 Ga0157379_10225903
321 Ga0157376_10520770
322 Ga0207692_10012823
323 Ga0207710_10129516
324 Ga0207699_10018339
325 Ga0207699_10497020
326 Ga0207707_10034292
327 Ga0207671_10534657
328 Ga0207652_10026253
329 Ga0207650_10010089
330 Ga0207700_10574710
331 Ga0207664_10196795
332 Ga0207690_10583773
333 Ga0207665_10012174
334 Ga0207661_10257629
335 Ga0207679_10219489
336 Ga0207712_10784470
337 Ga0207703_11458015
338 Ga0207678_10827902
339 Ga0207641_10623601
340 Ga0207676_10705075
341 Ga0207674_10835139
342 Ga0207683_10845492
343 Ga0265334_10048090
344 Ga0265334_10091861
345 Ga0265338_10029329
346 Ga0265330_10032660
347 Ga0265325_10039059
348 Ga0265340_10033307
349 Ga0265339_10585485
350 Ga0265331_10154081
351 Ga0265316_10681676
352 Ga0316575_10021962
353 Ga0316575_10067596
354 Ga0316579_10010873
355 Ga0265342_10015956
356 Ga0316576_10334552
357 Ga0316576_11316020
358 Ga0316578_10077532
359 Ga0316578_10139271
360 Ga0316577_10094967
361 Ga0316583_10005010
362 Ga0316593_10131199
363 Ga0316587_1030600
364 Ga0373923_0133745
365 Ga0373939_0000443
366 Ga0373939_0050166
367 Ga0373941_0220368
368 Ga0373954_0089439
369 Ga0373956_0251770
370 Ga0373956_0553534
371 Ga0373960_0187820
372 Ga0373946_0190887
373 Ga0373955_0307813
374 Ga0373942_0015960
375 Ga0373961_0083081
376 Ga0316574_0031387
377 Ga0316574_0043997
378 Ga0373931_0054456
379 Ga0373931_0781051
380 Ga0373933_0005323
381 Ga0373933_0242226
382 Ga0373947_0053832
383 Ga0373937_0424200
384 Ga0373937_0959136
385 Ga0373937_1289741
386 Ga0373937_1328297
387 Ga0316582_0059072
388 Ga0316582_0265651
389 Ga0316584_0059457
390 Ga0373925_0216375
391 Ga0373925_0420540
392 Ga0316581_0098269
393 Ga0495592_0083903
394 Ga0495592_0367923
395 Ga0495603_0075077
396 Ga0495603_0304200
397 Ga0495629_0145964
398 Ga0495651_0002742
399 Ga0495651_0088016
400 Ga0495651_0153916
401 Ga0495653_0379412
402 Ga0495582_0113762
403 Ga0495639_0549813
404 Ga0495594_0422573
405 Ga0495608_0434160
406 Ga0495618_0095914
407 Ga0495618_0306560
408 Ga0495630_0120499
409 Ga0495652_0090173
410 Ga0495652_0134118
411 Ga0495652_0330347
412 Ga0495587_0013171
413 Ga0495634_0546048
414 Ga0495635_0664711
415 Ga0495657_0191765
416 Ga0495599_0202730
417 Ga0495623_0048826
418 Ga0495623_0108275
419 Ga0495623_0214181
420 Ga0495623_0347671
421 Ga0495658_0074246
422 Ga0495613_0495418
423 Ga0495581_0172759
424 Ga0495581_0190352
425 Ga0495604_0039014
426 Ga0495604_0129224
427 Ga0495604_0186143
428 Ga0495674_0353915
429 Ga0495676_0730655
430 Ga0495680_0070338
431 Ga0495680_0166382
432 Ga0495680_0551225
433 Ga0495675_0141722
434 Ga0495684_0065988
435 Ga0495684_0247781
436 Ga0495593_0103450
437 Ga0495593_0275569
438 Ga0495602_0050763
439 Ga0495602_0064063
440 Ga0495602_0108117
441 Ga0495602_0715548
442 Ga0496100_0226060
443 Ga0496101_0139255
444 Ga0496101_0637479
445 Ga0496101_0649996
446 Ga0496102_0102197
447 Ga0496103_0021696
448 Ga0496104_0000358
449 Ga0496104_0006789
450 Ga0496104_0545003
451 Ga0496105_0017835
452 Ga0496105_0035202
453 Ga0496105_0617770
454 Ga0496106_0038857
455 Ga0496106_0892928
456 Ga0496106_1034831
457 Ga0496107_0170177
458 Ga0496108_0021010
459 Ga0496109_0001209
460 Ga0496110_0013085
461 Ga0496112_0094237
462 Ga0496112_0915593
463 Ga0496113_0005079
464 Ga0496114_0064730
465 Ga0496115_0619571
466 Ga0501031_0679159
467 Ga0501032_0407035
468 Ga0501039_0015321
469 Ga0501039_0597813
470 Ga0501040_0707060
471 Ga0501041_0020914
472 Ga0501041_0154648
473 Ga0501041_0302450
474 Ga0501041_0316576
475 Ga0501041_0607348
476 Ga0501041_0769156
477 Ga0501042_0364065
478 Ga0501042_0512007
479 Ga0501042_0798418
480 Ga0501043_0565523
481 Ga0501047_0108185
482 Ga0501048_0114376
483 Ga0501068_0380168
484 Ga0501069_0286142
485 Ga0501071_0083695
486 Ga0501071_0517753
487 Ga0501072_0292715
488 Ga0501072_0324006
489 Ga0501072_1538465
490 Ga0501073_0063214
491 Ga0501074_0103432
492 Ga0501074_0187024
493 Ga0501074_1341062
494 Ga0501075_0014545
495 Ga0501075_0135965
496 Ga0501075_0400476
497 Ga0501076_0048975
498 Ga0501076_0258449
499 Ga0501076_0364133
500 Ga0501076_0516791
501 Ga0501076_0719604
502 Ga0501076_0760868
503 Ga0501077_0166041
504 Ga0501077_0195834
505 Ga0501077_0268300
506 Ga0501079_0023697
507 Ga0501079_0202401
508 Ga0501079_0424225
509 Ga0501079_0553480
510 Ga0501080_0131451
511 Ga0501080_1314101
512 Ga0501080_1430831
513 Ga0501081_0063415
514 Ga0501081_0083485
515 Ga0501081_0253788
516 Ga0501083_0075078
517 Ga0501083_0355159
518 Ga0501083_0537582
519 Ga0501044_0041392
520 Ga0501044_0726506
521 Ga0501045_0309398
522 Ga0501045_0380117
523 Ga0501045_0957704
524 Ga0501045_1260688
525 Ga0501045_1275161
526 nmdc:mga05p37_157362_c1
527 nmdc:mga08y16_58106_c1
528 nmdc:mga0n895_22261_c1
529 Ga0495601_0023906
530 Ga0495601_0031365
531 Ga0495601_0074020
532 Ga0495601_0478110
533 Ga0495612_0027414
534 Ga0495612_0107343
535 Ga0495612_0164816
536 Ga0495595_0002108
537 Ga0495595_0056114
538 Ga0495595_0125635
539 Ga0495595_0203080
540 Ga0495595_0704359
541 Ga0495619_0000917
542 Ga0495619_0057084
543 Ga0495619_0087406
544 Ga0495619_0416906
545 Ga0495619_0574478
546 Ga0501084_0032854
547 Ga0501084_0060906
548 Ga0501084_0121767
549 Ga0501084_0456772
550 Ga0501084_0584598
551 Ga0501084_1106036
552 Ga0501082_0579913
553 Ga0501082_0655700
554 Ga0501082_0750378
555 Ga0501082_0790867
556 Ga0501082_1800664
557 Ga0530510_0037015
558 Ga0530510_0161177
559 Ga0530510_0430642
560 Ga0530510_0765620
561 Ga0530510_0875536
562 2896389529

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01951

Archease

Archease protein family (MTH1598/TM1083)

17

151

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8btx-assembly1.cif.gz_A structure of human archease 0.8919 13 147
4n2p-assembly1.cif.gz_A structure of archease from pyrococcus horikoshii 0.8856 14 147
5yzl-assembly1.cif.gz_B crystal structure of human archease d178a 0.8572 15 145
4n2p-assembly1.cif.gz_A structure of archease from pyrococcus horikoshii 0.8264 14 147
5yzj-assembly1.cif.gz_B crystal structure of human archease mutant d51a 0.8195 15 146
ID Description Score Start End Superfamily
af_Q60334_1_139_3.55.10.10 Alpha Beta;3-Layer(bab) Sandwich;Archease, Possible Chaperone; Chain: A; domain 1;Archease domain 0.9057 14 147 3.55.10.10
af_Q8ILH4_99_237_3.55.10.10 Alpha Beta;3-Layer(bab) Sandwich;Archease, Possible Chaperone; Chain: A; domain 1;Archease domain 0.9034 13 147 3.55.10.10
af_Q54BU9_8_151_3.55.10.10 Alpha Beta;3-Layer(bab) Sandwich;Archease, Possible Chaperone; Chain: A; domain 1;Archease domain 0.8932 13 147 3.55.10.10
af_Q9TZN1_15_155_3.55.10.10 Alpha Beta;3-Layer(bab) Sandwich;Archease, Possible Chaperone; Chain: A; domain 1;Archease domain 0.8927 14 147 3.55.10.10
4n2pD00 Alpha Beta;3-Layer(bab) Sandwich;Archease, Possible Chaperone; Chain: A; domain 1;Archease domain 0.8732 14 147 3.55.10.10
ID Description Score Start End GO Terms
AF-A0A7T9JKR5-F1-model_v4 deleted 0.958 12 147
AF-A0A7C2KTJ7-F1-model_v4 Archease 0.9524 10 147 GO:0008033
GO:0046872
AF-A0A1G0R5M7-F1-model_v4 deleted 0.9514 9 147
AF-D3HQ88-F1-model_v4 Archease domain-containing protein 0.9485 40 147 GO:0008033
GO:0046872
AF-A0A1M3GVL9-F1-model_v4 Multifunctional CCA protein [Includes: CCA-adding enzyme (EC 2.7.7.72) (CCA tRNA nucleotidyltransferase) (tRNA CCA-pyrophosphorylase) (tRNA adenylyl-/cytidylyl-transferase) (tRNA nucleotidyltransferase) (tRNA-NT); 2'-nucleotidase (EC 3.1.3.-); 2',3'-cyclic phosphodiesterase (EC 3.1.4.-); Phosphatase] 0.9466 11 147 GO:0000049
GO:0000287
GO:0001680
GO:0004112
GO:0005524
GO:0016791
GO:0042245
GO:0160016

Map