F384449

General Info

Members Datasets Scaffolds Average Seq Length
281 201 562 134

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1522925|Ga0436365_1522925_433_927
Length 164
Sequence MGSLADVGLALPMIVFGIGQGHERPPTIQETAMQITRNSLDTNPGPSDWFTGTVYIDTIATPVATARAAAALVHFTPGSRTAWHTHPFGQTIFVTEGIGRCRREGGAVEEIRPGDRVYFEPGENHWHGAAPNRFMTHIAIQEADESGSPVTWGEQVTDDQYNDG

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
122 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
123 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
137 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
138 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
139 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
140 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 0
Rhizoplane 9.25
Rhizosphere 86.12
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1522925 3300039437 Bacteria 2017
2 JGI24737J22298_10096998 3300001990 Bacteria 874
3 Ga0070683_100597634 3300005329 Bacteria 1056
4 Ga0070690_100135610 3300005330 Bacteria 1667
5 Ga0070670_100345757 3300005331 Bacteria 1306
6 Ga0068869_100181067 3300005334 Bacteria 1652
7 Ga0068868_100099760 3300005338 Bacteria 2349
8 Ga0068868_100175738 3300005338 Bacteria 1775
9 Ga0068868_101014401 3300005338 Bacteria 760
10 Ga0070660_100065139 3300005339 Bacteria 2836
11 Ga0070660_101046855 3300005339 Bacteria 690
12 Ga0070689_100175123 3300005340 Bacteria 1740
13 Ga0070689_100341178 3300005340 Bacteria 1255
14 Ga0070687_100073427 3300005343 Bacteria 1844
15 Ga0070692_10521436 3300005345 Bacteria 774
16 Ga0070668_101404256 3300005347 Bacteria 637
17 Ga0070674_100331220 3300005356 Bacteria 1224
18 Ga0070673_102417147 3300005364 Bacteria 500
19 Ga0070688_100048107 3300005365 Bacteria 2649
20 Ga0070659_100098020 3300005366 Bacteria 2357
21 Ga0070659_100295420 3300005366 Bacteria 1350
22 Ga0070714_100001383 3300005435 Bacteria 17559
23 Ga0070714_100966890 3300005435 Bacteria 828
24 Ga0070710_10086983 3300005437 Bacteria 1836
25 Ga0070701_10119485 3300005438 Bacteria 1483
26 Ga0070711_101000119 3300005439 Bacteria 717
27 Ga0070705_100844880 3300005440 Bacteria 732
28 Ga0070700_100912357 3300005441 Bacteria 716
29 Ga0070663_100109608 3300005455 Bacteria 2073
30 Ga0070678_101319602 3300005456 Bacteria 672
31 Ga0070662_100406016 3300005457 Bacteria 1125
32 Ga0068867_100076904 3300005459 Bacteria 2507
33 Ga0070685_10118857 3300005466 Bacteria 1639
34 Ga0068853_100343750 3300005539 Bacteria 1387
35 Ga0070686_100211811 3300005544 Bacteria 1395
36 Ga0070693_101006765 3300005547 Bacteria 631
37 Ga0070665_101213947 3300005548 Bacteria 765
38 Ga0070704_100430699 3300005549 Bacteria 1131
39 Ga0070664_100585836 3300005564 Bacteria 1034
40 Ga0068854_100141994 3300005578 Bacteria 1844
41 Ga0070702_100012427 3300005615 Bacteria 4266
42 Ga0068852_101016906 3300005616 Bacteria 848
43 Ga0068852_101041305 3300005616 Bacteria 838
44 Ga0068852_101445789 3300005616 Bacteria 710
45 Ga0068859_100110128 3300005617 Bacteria 2816
46 Ga0068859_101784139 3300005617 Bacteria 680
47 Ga0068864_100269646 3300005618 Bacteria 1586
48 Ga0068864_101030875 3300005618 Bacteria 817
49 Ga0068866_10130459 3300005718 Bacteria 1429
50 Ga0068861_100045685 3300005719 Bacteria 3299
51 Ga0068861_100156287 3300005719 Bacteria 1877
52 Ga0068851_10126083 3300005834 Bacteria 1381
53 Ga0068870_10541984 3300005840 Bacteria 782
54 Ga0068863_100256237 3300005841 Bacteria 1691
55 Ga0068858_100204349 3300005842 Bacteria 1869
56 Ga0068860_100387952 3300005843 Bacteria 1380
57 Ga0068862_100065413 3300005844 Bacteria 3131
58 Ga0081455_10018549 3300005937 Bacteria 6622
59 Ga0081455_10033803 3300005937 Bacteria 4589
60 Ga0081455_10180063 3300005937 Bacteria 1601
61 Ga0081455_10576222 3300005937 Bacteria 739
62 Ga0070717_10044560 3300006028 Bacteria 3623
63 Ga0070717_10143207 3300006028 Bacteria 2063
64 Ga0070717_11020402 3300006028 Bacteria 753
65 Ga0075363_100551058 3300006048 Bacteria 688
66 Ga0070715_10308546 3300006163 Bacteria 849
67 Ga0070712_100778568 3300006175 Bacteria 820
68 Ga0075367_10418498 3300006178 Bacteria 848
69 Ga0068871_100249364 3300006358 Bacteria 1546
70 Ga0075428_101920970 3300006844 Bacteria 615
71 Ga0075431_101821564 3300006847 Bacteria 565
72 Ga0075434_100574910 3300006871 Bacteria 1146
73 Ga0068865_100037364 3300006881 Bacteria 3278
74 Ga0068865_100107005 3300006881 Bacteria 2056
75 Ga0097620_100110128 3300006931 Bacteria 2816
76 Ga0097620_101783939 3300006931 Bacteria 680
77 Ga0075435_101790523 3300007076 Bacteria 539
78 Ga0105240_10485288 3300009093 Bacteria 1377
79 Ga0105240_11020364 3300009093 Bacteria 884
80 Ga0111539_10330065 3300009094 Bacteria 1776
81 Ga0105245_10033183 3300009098 Bacteria 4574
82 Ga0105245_10035930 3300009098 Bacteria 4399
83 Ga0105247_11578803 3300009101 Bacteria 538
84 Ga0105243_10053636 3300009148 Bacteria 3199
85 Ga0105237_11591440 3300009545 Bacteria 660
86 Ga0105249_10184436 3300009553 Bacteria 2032
87 Ga0105249_10518925 3300009553 Bacteria 1238
88 Ga0105239_10065373 3300010375 Bacteria 3994
89 Ga0105239_10278317 3300010375 Bacteria 1883
90 Ga0157371_10975412 3300013102 Bacteria 645
91 Ga0157369_10876725 3300013105 Bacteria 921
92 Ga0157374_12225616 3300013296 Bacteria 575
93 Ga0157372_10730787 3300013307 Bacteria 1151
94 Ga0157375_10095138 3300013308 Bacteria 3049
95 Ga0163163_10267547 3300014325 Bacteria 1760
96 Ga0157380_10410626 3300014326 Bacteria 1288
97 Ga0182008_10163824 3300014497 Bacteria 1120
98 Ga0157376_10707974 3300014969 Bacteria 1013
99 Ga0163161_10594991 3300017792 Bacteria 911
100 Ga0206353_11513022 3300020082 Bacteria 572
101 Ga0213874_10002186 3300021377 Bacteria 4151
102 Ga0213876_10147668 3300021384 Bacteria 1250
103 Ga0213875_10330663 3300021388 Bacteria 723
104 Ga0207656_10134797 3300025321 Bacteria 1160
105 Ga0207642_10052181 3300025899 Bacteria 1854
106 Ga0207642_10154144 3300025899 Bacteria 1226
107 Ga0207710_10120448 3300025900 Bacteria 1253
108 Ga0207688_10105940 3300025901 Bacteria 1628
109 Ga0207680_10438343 3300025903 Bacteria 927
110 Ga0207647_10188435 3300025904 Bacteria 1196
111 Ga0207695_11027144 3300025913 Bacteria 704
112 Ga0207695_11653653 3300025913 Bacteria 521
113 Ga0207663_10050362 3300025916 Bacteria 2588
114 Ga0207663_10854591 3300025916 Bacteria 726
115 Ga0207662_10046641 3300025918 Bacteria 2564
116 Ga0207657_10426024 3300025919 Bacteria 1042
117 Ga0207657_10721993 3300025919 Bacteria 773
118 Ga0207681_10186548 3300025923 Bacteria 1584
119 Ga0207650_10446558 3300025925 Bacteria 1076
120 Ga0207659_10522690 3300025926 Bacteria 1006
121 Ga0207687_10047755 3300025927 Bacteria 2969
122 Ga0207687_10224166 3300025927 Bacteria 1482
123 Ga0207687_10345248 3300025927 Bacteria 1211
124 Ga0207700_11227722 3300025928 Bacteria 669
125 Ga0207664_10005625 3300025929 Bacteria 8572
126 Ga0207664_10064602 3300025929 Bacteria 2928
127 Ga0207690_10223098 3300025932 Bacteria 1443
128 Ga0207690_10267658 3300025932 Bacteria 1326
129 Ga0207690_10396934 3300025932 Bacteria 1099
130 Ga0207706_11262778 3300025933 Bacteria 611
131 Ga0207709_10018604 3300025935 Bacteria 3893
132 Ga0207709_10771689 3300025935 Bacteria 774
133 Ga0207670_10109057 3300025936 Bacteria 1991
134 Ga0207669_10231607 3300025937 Bacteria 1363
135 Ga0207669_10455544 3300025937 Bacteria 1015
136 Ga0207704_10009915 3300025938 Bacteria 4620
137 Ga0207704_10189055 3300025938 Bacteria 1496
138 Ga0207665_11458374 3300025939 Bacteria 544
139 Ga0207689_10031334 3300025942 Bacteria 4428
140 Ga0207679_10760154 3300025945 Bacteria 882
141 Ga0207712_10177811 3300025961 Bacteria 1669
142 Ga0207712_10349846 3300025961 Bacteria 1228
143 Ga0207668_10718083 3300025972 Bacteria 879
144 Ga0207640_10242307 3300025981 Bacteria 1394
145 Ga0207677_10051303 3300026023 Bacteria 2796
146 Ga0207677_10262210 3300026023 Bacteria 1409
147 Ga0207677_10690964 3300026023 Bacteria 904
148 Ga0207703_10100821 3300026035 Bacteria 2447
149 Ga0207639_10588328 3300026041 Bacteria 1025
150 Ga0207678_10089782 3300026067 Bacteria 2626
151 Ga0207708_10042639 3300026075 Bacteria 3458
152 Ga0207676_10106448 3300026095 Bacteria 2337
153 Ga0207675_100041117 3300026118 Bacteria 4317
154 Ga0207675_100203309 3300026118 Bacteria 1903
155 Ga0207675_100853507 3300026118 Bacteria 926
156 Ga0207683_10736792 3300026121 Bacteria 914
157 Ga0207683_11517137 3300026121 Bacteria 619
158 Ga0207698_11095348 3300026142 Bacteria 809
159 Ga0207698_11997802 3300026142 Bacteria 594
160 Ga0268265_10412350 3300028380 Bacteria 1252
161 Ga0268264_10567929 3300028381 Bacteria 1115
162 Ga0265319_1000088 3300028563 Bacteria 71590
163 Ga0265330_10430023 3300031235 Bacteria 559
164 Ga0265320_10251252 3300031240 Bacteria 784
165 Ga0307405_11290848 3300031731 Bacteria 635
166 Ga0307413_10569731 3300031824 Bacteria 922
167 Ga0307407_10731372 3300031903 Bacteria 748
168 Ga0307409_100396324 3300031995 Bacteria 1317
169 Ga0307416_100990760 3300032002 Bacteria 943
170 Ga0373955_0777048 3300035172 Bacteria 588
171 Ga0373937_0012772 3300036401 Bacteria 7393
172 Ga0395900_0135804 3300037418 Bacteria 2520
173 Ga0395900_0811892 3300037418 Bacteria 863
174 Ga0395900_1655894 3300037418 Bacteria 551
175 Ga0395898_0194819 3300037466 Bacteria 1936
176 Ga0436364_0013855 3300037853 Bacteria 4008
177 Ga0436364_1343259 3300037853 Bacteria 1476
178 Ga0395901_0815255 3300038443 Bacteria 921
179 Ga0436365_1932474 3300039437 Bacteria 17323
180 Ga0436363_0093411 3300039450 Bacteria 864
181 Ga0436363_1551174 3300039450 Bacteria 715
182 Ga0451833_0372805 3300041491 Bacteria 631
183 Ga0439464_0029069 3300042439 Bacteria 1543
184 Ga0439440_0041160 3300042993 Bacteria 1127
185 Ga0466969_0318838 3300044656 Bacteria 704
186 Ga0466965_0502558 3300044683 Unclassified 680
187 Ga0466966_0021607 3300044684 Bacteria 4226
188 Ga0466966_0273139 3300044684 Bacteria 1017
189 Ga0466961_0088072 3300044693 Bacteria 1961
190 Ga0466964_0252799 3300044706 Bacteria 870
191 Ga0466964_0589145 3300044706 Bacteria 608
192 Ga0466971_0010992 3300044719 Bacteria 3960
193 Ga0466971_0084655 3300044719 Unclassified 1448
194 Ga0466971_0117484 3300044719 Bacteria 1230
195 Ga0466968_0005437 3300044735 Bacteria 4767
196 Ga0466968_0283799 3300044735 Bacteria 793
197 Ga0466968_0434945 3300044735 Bacteria 647
198 Ga0466968_0472656 3300044735 Bacteria 622
199 Ga0466970_0695595 3300044765 Unclassified 593
200 Ga0466957_0003411 3300044842 Bacteria 8724
201 Ga0466957_0063207 3300044842 Bacteria 2275
202 Ga0466960_0048702 3300044901 Bacteria 2037
203 Ga0466960_0160916 3300044901 Bacteria 1205
204 Ga0466960_0421897 3300044901 Bacteria 771
205 Ga0466959_0058399 3300045049 Bacteria 2810
206 Ga0466959_0114289 3300045049 Bacteria 1924
207 Ga0466959_0120260 3300045049 Bacteria 1868
208 Ga0466958_0003849 3300045836 Bacteria 7849
209 Ga0466958_0006945 3300045836 Bacteria 6193
210 Ga0466958_0011047 3300045836 Bacteria 5076
211 Ga0466967_0002958 3300045976 Bacteria 10861
212 Ga0466967_0026429 3300045976 Bacteria 4809
213 Ga0466967_0056144 3300045976 Bacteria 3471
214 Ga0466967_0202740 3300045976 Bacteria 1879
215 Ga0466967_0298308 3300045976 Bacteria 1550
216 Ga0466967_0336783 3300045976 Bacteria 1458
217 Ga0466967_0405599 3300045976 Bacteria 1327
218 Ga0466967_1074530 3300045976 Bacteria 802
219 Ga0466967_1455689 3300045976 Bacteria 682
220 Ga0495592_0197795 3300046454 Bacteria 1358
221 Ga0495629_0176223 3300046459 Bacteria 1483
222 Ga0495651_0013317 3300046462 Bacteria 6362
223 Ga0495653_0541280 3300046463 Bacteria 721
224 Ga0495608_0002599 3300046511 Bacteria 12977
225 Ga0495652_0005203 3300046529 Bacteria 12297
226 Ga0495665_0640047 3300046531 Bacteria 530
227 Ga0495640_0011356 3300046533 Bacteria 6857
228 Ga0495645_0173108 3300046543 Bacteria 1485
229 Ga0495667_0008188 3300046559 Bacteria 7094
230 Ga0495634_0050002 3300046642 Bacteria 2809
231 Ga0495635_0005804 3300046663 Bacteria 8602
232 Ga0495657_0003222 3300046675 Bacteria 13423
233 Ga0495599_0050277 3300046678 Bacteria 2612
234 Ga0495623_0077023 3300046679 Bacteria 2068
235 Ga0495646_0007917 3300046680 Bacteria 6751
236 Ga0495613_0156200 3300046689 Bacteria 1625
237 Ga0495600_0001058 3300046809 Bacteria 14909
238 Ga0495604_0002791 3300047317 Bacteria 14012
239 Ga0495674_0004240 3300047319 Bacteria 13818
240 Ga0495680_0003896 3300047322 Bacteria 14443
241 Ga0495675_0018334 3300047444 Bacteria 4444
242 Ga0495684_0131652 3300047471 Bacteria 1878
243 Ga0495686_0609185 3300047472 Bacteria 565
244 Ga0495593_0242338 3300047673 Bacteria 903
245 Ga0495602_0010731 3300048088 Bacteria 9495
246 Ga0496101_0151472 3300048904 Bacteria 1774
247 Ga0496102_0241729 3300048905 Bacteria 1702
248 Ga0496102_0275216 3300048905 Bacteria 1587
249 Ga0496103_0089713 3300048906 Bacteria 1939
250 Ga0496104_0013060 3300048907 Bacteria 7480
251 Ga0496104_0335491 3300048907 Bacteria 1425
252 Ga0496105_0509691 3300048908 Bacteria 943
253 Ga0496105_0515283 3300048908 Bacteria 937
254 Ga0496106_0058493 3300048909 Bacteria 2918
255 Ga0496106_0388454 3300048909 Bacteria 1121
256 Ga0496106_0481563 3300048909 Bacteria 997
257 Ga0496107_0294689 3300048910 Bacteria 1207
258 Ga0496108_0006890 3300048911 Bacteria 9197
259 Ga0496108_0362373 3300048911 Bacteria 1265
260 Ga0496109_0008030 3300048912 Bacteria 8945
261 Ga0496109_1053748 3300048912 Bacteria 750
262 Ga0496110_0076063 3300048913 Bacteria 2984
263 Ga0496110_0180986 3300048913 Bacteria 1914
264 Ga0496110_0316629 3300048913 Bacteria 1421
265 Ga0496111_0071402 3300048914 Bacteria 2527
266 Ga0496111_0107642 3300048914 Bacteria 2052
267 Ga0496112_0053500 3300048915 Bacteria 3965
268 Ga0496112_0176346 3300048915 Bacteria 2102
269 Ga0496113_0414525 3300048916 Bacteria 1082
270 Ga0496114_1800037 3300048917 Bacteria 500
271 Ga0496115_0792225 3300048918 Bacteria 738
272 Ga0496126_1020131 3300048929 Bacteria 620
273 Ga0501034_1134066 3300049571 Bacteria 662
274 Ga0501039_0815308 3300049575 Bacteria 728
275 nmdc:mga08y16_207796_c1 3300050511 Bacteria 2028
276 nmdc:mga08y16_433448_c1 3300050511 Unclassified 1342
277 nmdc:mga0n895_669459_c1 3300050512 Bacteria 1035
278 nmdc:mga0a205_880370_c1 3300050515 Bacteria 742
279 Ga0495595_0020079 3300053084 Bacteria 2905
280 Ga0495619_0047747 3300053085 Bacteria 2821
281 Ga0466962_0007934 3300061719 Bacteria 5091
282 Ga0436365_1522925
283 JGI24737J22298_10096998
284 Ga0070683_100597634
285 Ga0070690_100135610
286 Ga0070670_100345757
287 Ga0068869_100181067
288 Ga0068868_100099760
289 Ga0068868_100175738
290 Ga0068868_101014401
291 Ga0070660_100065139
292 Ga0070660_101046855
293 Ga0070689_100175123
294 Ga0070689_100341178
295 Ga0070687_100073427
296 Ga0070692_10521436
297 Ga0070668_101404256
298 Ga0070674_100331220
299 Ga0070673_102417147
300 Ga0070688_100048107
301 Ga0070659_100098020
302 Ga0070659_100295420
303 Ga0070714_100001383
304 Ga0070714_100966890
305 Ga0070710_10086983
306 Ga0070701_10119485
307 Ga0070711_101000119
308 Ga0070705_100844880
309 Ga0070700_100912357
310 Ga0070663_100109608
311 Ga0070678_101319602
312 Ga0070662_100406016
313 Ga0068867_100076904
314 Ga0070685_10118857
315 Ga0068853_100343750
316 Ga0070686_100211811
317 Ga0070693_101006765
318 Ga0070665_101213947
319 Ga0070704_100430699
320 Ga0070664_100585836
321 Ga0068854_100141994
322 Ga0070702_100012427
323 Ga0068852_101016906
324 Ga0068852_101041305
325 Ga0068852_101445789
326 Ga0068859_100110128
327 Ga0068859_101784139
328 Ga0068864_100269646
329 Ga0068864_101030875
330 Ga0068866_10130459
331 Ga0068861_100045685
332 Ga0068861_100156287
333 Ga0068851_10126083
334 Ga0068870_10541984
335 Ga0068863_100256237
336 Ga0068858_100204349
337 Ga0068860_100387952
338 Ga0068862_100065413
339 Ga0081455_10018549
340 Ga0081455_10033803
341 Ga0081455_10180063
342 Ga0081455_10576222
343 Ga0070717_10044560
344 Ga0070717_10143207
345 Ga0070717_11020402
346 Ga0075363_100551058
347 Ga0070715_10308546
348 Ga0070712_100778568
349 Ga0075367_10418498
350 Ga0068871_100249364
351 Ga0075428_101920970
352 Ga0075431_101821564
353 Ga0075434_100574910
354 Ga0068865_100037364
355 Ga0068865_100107005
356 Ga0097620_100110128
357 Ga0097620_101783939
358 Ga0075435_101790523
359 Ga0105240_10485288
360 Ga0105240_11020364
361 Ga0111539_10330065
362 Ga0105245_10033183
363 Ga0105245_10035930
364 Ga0105247_11578803
365 Ga0105243_10053636
366 Ga0105237_11591440
367 Ga0105249_10184436
368 Ga0105249_10518925
369 Ga0105239_10065373
370 Ga0105239_10278317
371 Ga0157371_10975412
372 Ga0157369_10876725
373 Ga0157374_12225616
374 Ga0157372_10730787
375 Ga0157375_10095138
376 Ga0163163_10267547
377 Ga0157380_10410626
378 Ga0182008_10163824
379 Ga0157376_10707974
380 Ga0163161_10594991
381 Ga0206353_11513022
382 Ga0213874_10002186
383 Ga0213876_10147668
384 Ga0213875_10330663
385 Ga0207656_10134797
386 Ga0207642_10052181
387 Ga0207642_10154144
388 Ga0207710_10120448
389 Ga0207688_10105940
390 Ga0207680_10438343
391 Ga0207647_10188435
392 Ga0207695_11027144
393 Ga0207695_11653653
394 Ga0207663_10050362
395 Ga0207663_10854591
396 Ga0207662_10046641
397 Ga0207657_10426024
398 Ga0207657_10721993
399 Ga0207681_10186548
400 Ga0207650_10446558
401 Ga0207659_10522690
402 Ga0207687_10047755
403 Ga0207687_10224166
404 Ga0207687_10345248
405 Ga0207700_11227722
406 Ga0207664_10005625
407 Ga0207664_10064602
408 Ga0207690_10223098
409 Ga0207690_10267658
410 Ga0207690_10396934
411 Ga0207706_11262778
412 Ga0207709_10018604
413 Ga0207709_10771689
414 Ga0207670_10109057
415 Ga0207669_10231607
416 Ga0207669_10455544
417 Ga0207704_10009915
418 Ga0207704_10189055
419 Ga0207665_11458374
420 Ga0207689_10031334
421 Ga0207679_10760154
422 Ga0207712_10177811
423 Ga0207712_10349846
424 Ga0207668_10718083
425 Ga0207640_10242307
426 Ga0207677_10051303
427 Ga0207677_10262210
428 Ga0207677_10690964
429 Ga0207703_10100821
430 Ga0207639_10588328
431 Ga0207678_10089782
432 Ga0207708_10042639
433 Ga0207676_10106448
434 Ga0207675_100041117
435 Ga0207675_100203309
436 Ga0207675_100853507
437 Ga0207683_10736792
438 Ga0207683_11517137
439 Ga0207698_11095348
440 Ga0207698_11997802
441 Ga0268265_10412350
442 Ga0268264_10567929
443 Ga0265319_1000088
444 Ga0265330_10430023
445 Ga0265320_10251252
446 Ga0307405_11290848
447 Ga0307413_10569731
448 Ga0307407_10731372
449 Ga0307409_100396324
450 Ga0307416_100990760
451 Ga0373955_0777048
452 Ga0373937_0012772
453 Ga0395900_0135804
454 Ga0395900_0811892
455 Ga0395900_1655894
456 Ga0395898_0194819
457 Ga0436364_0013855
458 Ga0436364_1343259
459 Ga0395901_0815255
460 Ga0436365_1932474
461 Ga0436363_0093411
462 Ga0436363_1551174
463 Ga0451833_0372805
464 Ga0439464_0029069
465 Ga0439440_0041160
466 Ga0466969_0318838
467 Ga0466965_0502558
468 Ga0466966_0021607
469 Ga0466966_0273139
470 Ga0466961_0088072
471 Ga0466964_0252799
472 Ga0466964_0589145
473 Ga0466971_0010992
474 Ga0466971_0084655
475 Ga0466971_0117484
476 Ga0466968_0005437
477 Ga0466968_0283799
478 Ga0466968_0434945
479 Ga0466968_0472656
480 Ga0466970_0695595
481 Ga0466957_0003411
482 Ga0466957_0063207
483 Ga0466960_0048702
484 Ga0466960_0160916
485 Ga0466960_0421897
486 Ga0466959_0058399
487 Ga0466959_0114289
488 Ga0466959_0120260
489 Ga0466958_0003849
490 Ga0466958_0006945
491 Ga0466958_0011047
492 Ga0466967_0002958
493 Ga0466967_0026429
494 Ga0466967_0056144
495 Ga0466967_0202740
496 Ga0466967_0298308
497 Ga0466967_0336783
498 Ga0466967_0405599
499 Ga0466967_1074530
500 Ga0466967_1455689
501 Ga0495592_0197795
502 Ga0495629_0176223
503 Ga0495651_0013317
504 Ga0495653_0541280
505 Ga0495608_0002599
506 Ga0495652_0005203
507 Ga0495665_0640047
508 Ga0495640_0011356
509 Ga0495645_0173108
510 Ga0495667_0008188
511 Ga0495634_0050002
512 Ga0495635_0005804
513 Ga0495657_0003222
514 Ga0495599_0050277
515 Ga0495623_0077023
516 Ga0495646_0007917
517 Ga0495613_0156200
518 Ga0495600_0001058
519 Ga0495604_0002791
520 Ga0495674_0004240
521 Ga0495680_0003896
522 Ga0495675_0018334
523 Ga0495684_0131652
524 Ga0495686_0609185
525 Ga0495593_0242338
526 Ga0495602_0010731
527 Ga0496101_0151472
528 Ga0496102_0241729
529 Ga0496102_0275216
530 Ga0496103_0089713
531 Ga0496104_0013060
532 Ga0496104_0335491
533 Ga0496105_0509691
534 Ga0496105_0515283
535 Ga0496106_0058493
536 Ga0496106_0388454
537 Ga0496106_0481563
538 Ga0496107_0294689
539 Ga0496108_0006890
540 Ga0496108_0362373
541 Ga0496109_0008030
542 Ga0496109_1053748
543 Ga0496110_0076063
544 Ga0496110_0180986
545 Ga0496110_0316629
546 Ga0496111_0071402
547 Ga0496111_0107642
548 Ga0496112_0053500
549 Ga0496112_0176346
550 Ga0496113_0414525
551 Ga0496114_1800037
552 Ga0496115_0792225
553 Ga0496126_1020131
554 Ga0501034_1134066
555 Ga0501039_0815308
556 nmdc:mga08y16_207796_c1
557 nmdc:mga08y16_433448_c1
558 nmdc:mga0n895_669459_c1
559 nmdc:mga0a205_880370_c1
560 Ga0495595_0020079
561 Ga0495619_0047747
562 Ga0466962_0007934

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

71

137

0.94

PF02311

AraC_binding

AraC-like ligand binding domain

72

145

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bif-assembly2.cif.gz_H biochemical and structural characterisation of a novel manganese- dependent hydroxynitrile lyase from bacteria 0.9504 1 129
4uxa-assembly3.cif.gz_R improved variant of (r)-selective manganese-dependent hydroxynitrile lyase from bacteria 0.9418 1 130
4bif-assembly2.cif.gz_H biochemical and structural characterisation of a novel manganese- dependent hydroxynitrile lyase from bacteria 0.9292 1 129
4uxa-assembly3.cif.gz_R improved variant of (r)-selective manganese-dependent hydroxynitrile lyase from bacteria 0.9278 1 130
2f4p-assembly2.cif.gz_C crystal structure of a cupin-like protein (tm1010) from thermotoga maritima msb8 at 1.90 a resolution 0.9217 8 129
ID Description Score Start End Superfamily
4bifA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9512 1 129 2.60.120.10
4bifA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9299 1 129 2.60.120.10
2f4pA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9223 7 129 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8966 33 108 2.60.120.10
2aacA00 Mainly Beta;Sandwich;Jelly Rolls;Regulatory protein AraC 0.886 53 108 2.60.120.280
ID Description Score Start End GO Terms
AF-F3KPW6-F1-model_v4 Cupin 2 barrel domain-containing protein 1 38 129
AF-A0A659YKM7-F1-model_v4 deleted 0.9996 40 126
AF-A0A261PZ63-F1-model_v4 Cupin 0.9986 26 129
AF-A0A6J4PSV0-F1-model_v4 Cupin type-2 domain-containing protein 0.9977 38 129
AF-A0A536W0Z0-F1-model_v4 Cupin domain-containing protein 0.9971 17 129

Map