F384436

General Info

Members Datasets Scaffolds Average Seq Length
281 210 241 394

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0012926|Ga0395905_0012926_1869_3131
Length 420
Sequence MKLASRLDHIEPFYVMECAKAASEIARSAACDPARGGRPMIFLNIGEPDFTAPPPVLEAAQRCVAAGRTQYTDATGLPALREAISRWYGERFGLDVPARRIVVTAGASAALQLATLALFEPGDEVLLPDPSYPCNRHFVAATGATARLLPADAASRFQLDAASVQAAWNEHTRGVLLASPSNPTGTSIAHDEMQRIVELVRARGGVTLVDEIYLGLSYDPRLPSTAAAPRGDRVQLGSDPALDRSCDAAFGQSALHHGDDIVAINSFSKYFSMTGWRLGWLVLPEALVAPIERLAQNLYICPSSVAQHAALACFEPASIAEYERRRDEFKXXRDFIVPALERLGFAVPVPPDGAFYAWADCRAHASSSWDLCFDLMQRAHIALTPGRDFGPQWGERFLRLSFASSMAHLQEAVERLQRAL

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
6 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
7 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
8 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
9 2643221585 Pelomonas sp. Root662 Isolate Unclassified
10 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
11 2643221656 Pelomonas sp. Root405 Isolate Unclassified
12 2643221658 Variovorax sp. Root411 Isolate Unclassified
13 2643221660 Methylibium sp. Root1272 Isolate Unclassified
14 2643221672 Variovorax sp. Root434 Isolate Unclassified
15 2643221683 Variovorax sp. Root473 Isolate Unclassified
16 2738541277 Variovorax sp. GV051 Isolate Unclassified
17 2738541337 Pelomonas sp. BT06 Isolate Unclassified
18 2738543019 Variovorax sp. GV040 Isolate Unclassified
19 2818991446 Variovorax sp. 1180 Isolate Unclassified
20 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
21 2831864461 Roseateles noduli HZ7 Isolate Nodule
22 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
23 2842677519 Variovorax sp. R-72495 Isolate Unclassified
24 2842733646 Variovorax sp. R-72446 Isolate Unclassified
25 2885198086 Variovorax sp. 679 Isolate Unclassified
26 2885211737 Variovorax sp. 553 Isolate Unclassified
27 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
28 2899924645 Variovorax sp. 369 Isolate Unclassified
29 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
30 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
31 2928037797 Variovorax sp. 1126 Isolate Unclassified
32 2928044640 Variovorax sp. 1128 Isolate Unclassified
33 2928051484 Variovorax sp. 1133 Isolate Unclassified
34 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
35 2928070936 Variovorax gossypii 1167 Isolate Unclassified
36 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
37 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
38 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
39 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
40 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
41 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
42 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
43 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
44 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
45 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
46 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
47 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
48 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
49 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
50 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
51 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
52 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
53 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
54 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
55 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
56 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
57 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
58 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
98 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
100 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
132 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
133 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
134 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
135 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
136 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
137 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
153 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
154 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
155 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
186 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
197 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
198 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
199 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
200 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
204 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
205 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
206 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
207 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
208 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
209 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
210 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.05
Metatranscriptomes 0.71
Isolates 14.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.18
Nodule 0.71
Rhizoplane 2.49
Rhizosphere 53.74
Stem 0
Stem Tuber 0
Unclassified 13.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1005364 3300002774 Bacteria 2743
2 JGI25151J46595_10032388 3300003187 Bacteria 2027
3 JGI25153J46596_10007479 3300003215 Bacteria 5363
4 rootL2_10154830 3300003322 Bacteria 2549
5 Ga0055535_1000415 3300003761 Bacteria 40129
6 Ga0055542_1000004 3300003762 Bacteria 553532
7 Ga0055526_1006723 3300003771 Bacteria 6162
8 Ga0055524_1000277 3300003775 Bacteria 50913
9 Ga0055536_1008854 3300003781 Bacteria 4256
10 Ga0055536_1013829 3300003781 Bacteria 2877
11 Ga0055534_1005622 3300003784 Bacteria 3312
12 Ga0055530_10005897 3300003791 Bacteria 5658
13 Ga0055530_10008018 3300003791 Bacteria 4311
14 Ga0055540_1002318 3300003792 Bacteria 10210
15 Ga0055540_1006449 3300003792 Bacteria 4656
16 Ga0055540_1009707 3300003792 Bacteria 3289
17 Ga0055531_10000107 3300003794 Bacteria 91062
18 Ga0055531_10008459 3300003794 Bacteria 5419
19 Ga0055531_10019465 3300003794 Bacteria 2743
20 Ga0055531_10030674 3300003794 Bacteria 1798
21 Ga0055543_1006602 3300004625 Bacteria 2778
22 Ga0065165_1000092 3300005262 Bacteria 148435
23 Ga0065165_1000531 3300005262 Bacteria 58155
24 Ga0065165_1002514 3300005262 Bacteria 15295
25 Ga0070658_10088869 3300005327 Bacteria 2544
26 Ga0070682_100043178 3300005337 Bacteria 2787
27 Ga0070669_100081453 3300005353 Bacteria 2411
28 Ga0070700_100005599 3300005441 Bacteria 6658
29 Ga0070662_100031124 3300005457 Bacteria 3742
30 Ga0068867_100000018 3300005459 Bacteria 102056
31 Ga0070679_100018662 3300005530 Bacteria 6733
32 Ga0068853_100012188 3300005539 Bacteria 6992
33 Ga0070672_100255814 3300005543 Bacteria 1476
34 Ga0068855_100014853 3300005563 Bacteria 9377
35 Ga0070664_100057244 3300005564 Bacteria 3313
36 Ga0068852_100005610 3300005616 Bacteria 9001
37 Ga0068852_100071663 3300005616 Bacteria 3044
38 Ga0068861_100001871 3300005719 Bacteria 13552
39 Ga0068858_100018723 3300005842 Bacteria 6481
40 Ga0068860_100180120 3300005843 Bacteria 2042
41 Ga0075365_10025678 3300006038 Bacteria 3731
42 Ga0075365_10026156 3300006038 Bacteria 3702
43 Ga0075364_10050978 3300006051 Bacteria 2702
44 Ga0075432_10014802 3300006058 Bacteria 2658
45 Ga0075432_10050242 3300006058 Bacteria 1470
46 Ga0075366_10005437 3300006195 Bacteria 6901
47 Ga0075366_10027067 3300006195 Bacteria 3363
48 Ga0075366_10036986 3300006195 Bacteria 2880
49 Ga0075370_10059668 3300006353 Bacteria 2172
50 Ga0068865_100032673 3300006881 Bacteria 3479
51 Ga0105244_10006858 3300009036 Bacteria 7314
52 Ga0105240_10193111 3300009093 Bacteria 2393
53 Ga0105245_10120430 3300009098 Bacteria 2451
54 Ga0105243_10004206 3300009148 Bacteria 11405
55 Ga0105241_10161667 3300009174 Bacteria 1841
56 Ga0105238_10395390 3300009551 Bacteria 1375
57 Ga0157370_10231222 3300013104 Bacteria 1711
58 Ga0157370_10293467 3300013104 Bacteria 1502
59 Ga0157378_10000815 3300013297 Bacteria 28986
60 Ga0163162_10000821 3300013306 Bacteria 28874
61 Ga0163162_10077468 3300013306 Bacteria 3388
62 Ga0182008_10002743 3300014497 Bacteria 10924
63 Ga0182008_10026918 3300014497 Bacteria 2915
64 Ga0157377_10000051 3300014745 Bacteria 90204
65 Ga0157376_10025416 3300014969 Bacteria 4663
66 Ga0182006_1002615 3300015261 Bacteria 9731
67 Ga0182007_10001192 3300015262 Bacteria 14135
68 Ga0182007_10003016 3300015262 Bacteria 8134
69 Ga0163161_10000917 3300017792 Bacteria 22793
70 Ga0163161_10010742 3300017792 Bacteria 6343
71 Ga0213872_10000046 3300021361 Bacteria 109934
72 Ga0209436_106307 3300025208 Bacteria 2614
73 Ga0209672_102893 3300025228 Bacteria 3848
74 Ga0209147_101896 3300025229 Bacteria 6315
75 Ga0209258_100022 3300025242 Bacteria 553584
76 Ga0207425_1002777 3300025245 Bacteria 5943
77 Ga0209148_1000034 3300025254 Bacteria 553584
78 Ga0209129_1000023 3300025258 Bacteria 420646
79 Ga0209565_1002262 3300025263 Bacteria 7132
80 Ga0209673_1003367 3300025273 Bacteria 9513
81 Ga0209673_1011712 3300025273 Bacteria 3593
82 Ga0209675_1007113 3300025291 Bacteria 4351
83 Ga0209675_1007906 3300025291 Bacteria 3990
84 Ga0209676_1000005 3300025292 Bacteria 1076001
85 Ga0209676_1000437 3300025292 Bacteria 71544
86 Ga0209676_1000595 3300025292 Bacteria 53773
87 Ga0209676_1009209 3300025292 Bacteria 4292
88 Ga0209025_1000717 3300025294 Bacteria 56308
89 Ga0209025_1001078 3300025294 Bacteria 39551
90 Ga0209025_1008502 3300025294 Bacteria 7377
91 Ga0209025_1011627 3300025294 Bacteria 5771
92 Ga0209564_1000005 3300025295 Bacteria 1147192
93 Ga0209564_1000958 3300025295 Bacteria 36698
94 Ga0209564_1001121 3300025295 Bacteria 31519
95 Ga0209758_1000064 3300025297 Bacteria 311812
96 Ga0209050_1000007 3300025298 Bacteria 1187891
97 Ga0209050_1000471 3300025298 Bacteria 71466
98 Ga0209050_1000723 3300025298 Bacteria 48329
99 Ga0209256_1000115 3300025299 Bacteria 173607
100 Ga0209256_1000895 3300025299 Bacteria 36698
101 Ga0207426_1000001 3300025302 Bacteria 1341301
102 Ga0207426_1000031 3300025302 Bacteria 460699
103 Ga0209051_1000009 3300025303 Bacteria 706778
104 Ga0209051_1000312 3300025303 Bacteria 75251
105 Ga0209051_1000398 3300025303 Bacteria 60408
106 Ga0209051_1004111 3300025303 Bacteria 9128
107 Ga0209051_1007699 3300025303 Bacteria 5844
108 Ga0209051_1040043 3300025303 Bacteria 1684
109 Ga0209257_1000011 3300025304 Bacteria 1112630
110 Ga0209257_1000032 3300025304 Bacteria 680354
111 Ga0209257_1000669 3300025304 Bacteria 53655
112 Ga0209257_1014116 3300025304 Bacteria 3466
113 Ga0207655_1013951 3300025728 Bacteria 4577
114 Ga0207652_10089835 3300025921 Bacteria 2698
115 Ga0207681_10020146 3300025923 Bacteria 4223
116 Ga0207687_10043488 3300025927 Bacteria 3095
117 Ga0207709_10000889 3300025935 Bacteria 22596
118 Ga0207709_10001201 3300025935 Bacteria 18679
119 Ga0207709_10001654 3300025935 Bacteria 15057
120 Ga0207691_10038590 3300025940 Bacteria 4420
121 Ga0207691_10275197 3300025940 Bacteria 1449
122 Ga0207689_10148355 3300025942 Bacteria 1933
123 Ga0207679_10197166 3300025945 Bacteria 1679
124 Ga0207668_10130414 3300025972 Bacteria 1919
125 Ga0207703_10017179 3300026035 Bacteria 5645
126 Ga0207648_10000060 3300026089 Bacteria 102225
127 Ga0207648_10000542 3300026089 Bacteria 42144
128 Ga0207676_10310866 3300026095 Bacteria 1443
129 Ga0207675_100008495 3300026118 Bacteria 9668
130 Ga0207683_10028441 3300026121 Bacteria 4833
131 Ga0207698_10003996 3300026142 Bacteria 8945
132 Ga0209970_1000526 3300027614 Bacteria 6583
133 Ga0268265_10004197 3300028380 Bacteria 10082
134 Ga0268265_10087806 3300028380 Bacteria 2475
135 Ga0268264_10012552 3300028381 Bacteria 6978
136 Ga0307515_10000028 3300028794 Bacteria 368467
137 Ga0307515_10000366 3300028794 Bacteria 111195
138 Ga0307515_10001653 3300028794 Bacteria 49625
139 Ga0307515_10037329 3300028794 Bacteria 7817
140 Ga0307515_10064564 3300028794 Bacteria 5116
141 Ga0307515_10149719 3300028794 Bacteria 2447
142 Ga0307515_10185133 3300028794 Bacteria 2015
143 Ga0307512_10052835 3300030522 Bacteria 3237
144 Ga0307512_10122080 3300030522 Bacteria 1669
145 Ga0316177_1112436 3300030731 Bacteria 4990
146 Ga0314311_1106220 3300030733 Bacteria 8350
147 Ga0316179_1041506 3300030734 Bacteria 2596
148 Ga0316183_1044344 3300030742 Bacteria 6871
149 Ga0265332_10000003 3300031238 Bacteria 482849
150 Ga0265328_10031776 3300031239 Bacteria 1961
151 Ga0265331_10009064 3300031250 Bacteria 5619
152 Ga0265327_10000028 3300031251 Bacteria 361066
153 Ga0265327_10024613 3300031251 Bacteria 3530
154 Ga0307408_100053208 3300031548 Bacteria 2922
155 Ga0307408_100077778 3300031548 Bacteria 2471
156 Ga0307408_100142169 3300031548 Bacteria 1885
157 Ga0307514_10005491 3300031649 Bacteria 11272
158 Ga0307516_10044992 3300031730 Bacteria 4363
159 Ga0307405_10139625 3300031731 Bacteria 1687
160 Ga0307412_10021912 3300031911 Bacteria 3908
161 Ga0307412_10043335 3300031911 Bacteria 2929
162 Ga0307412_10135720 3300031911 Bacteria 1794
163 Ga0307412_10194589 3300031911 Bacteria 1535
164 Ga0307416_100101768 3300032002 Bacteria 2503
165 Ga0373928_0005647 3300035084 Bacteria 2395
166 Ga0373931_0007590 3300035691 Bacteria 5110
167 Ga0373931_0046055 3300035691 Bacteria 2304
168 Ga0373925_0004687 3300037068 Bacteria 10318
169 Ga0395905_0011805 3300037471 Bacteria 8434
170 Ga0395905_0012926 3300037471 Bacteria 8025
171 Ga0395905_0029018 3300037471 Bacteria 5214
172 Ga0395905_0102356 3300037471 Bacteria 2688
173 Ga0436361_0582353 3300039447 Bacteria 2845
174 Ga0436361_0633280 3300039447 Bacteria 103480
175 Ga0436361_0982187 3300039447 Bacteria 7703
176 Ga0451807_1870278 3300041486 Bacteria 1591
177 Ga0439449_0004284 3300042007 Bacteria 5511
178 Ga0450917_000471 3300042120 Bacteria 3038
179 Ga0450891_000047 3300042129 Bacteria 9224
180 Ga0450893_0011878 3300042532 Bacteria 1442
181 Ga0451577_0000068 3300042876 Bacteria 241923
182 Ga0451577_0014354 3300042876 Bacteria 7385
183 Ga0451577_0091541 3300042876 Bacteria 2714
184 Ga0466972_0000805 3300044658 Bacteria 14926
185 Ga0466966_0035847 3300044684 Bacteria 3204
186 Ga0466961_0092176 3300044693 Bacteria 1912
187 Ga0466963_0036768 3300044694 Bacteria 3194
188 Ga0453684_0000126 3300044712 Bacteria 336395
189 Ga0466968_0013513 3300044735 Bacteria 3211
190 Ga0466970_0010488 3300044765 Bacteria 4704
191 Ga0466959_0061042 3300045049 Bacteria 2742
192 Ga0451576_0006589 3300045051 Bacteria 14200
193 Ga0495627_010812 3300046453 Bacteria 3299
194 Ga0495603_0016405 3300046455 Bacteria 4481
195 Ga0495638_0059579 3300046460 Bacteria 2364
196 Ga0495585_0005768 3300046492 Bacteria 7769
197 Ga0495610_0006383 3300046512 Bacteria 8133
198 Ga0495630_0040864 3300046517 Bacteria 3465
199 Ga0495631_0003754 3300046518 Bacteria 8271
200 Ga0495637_0035012 3300046520 Bacteria 2195
201 Ga0495586_0015025 3300046535 Bacteria 4116
202 Ga0495656_0000923 3300046615 Bacteria 9491
203 Ga0495611_0103171 3300046648 Bacteria 1325
204 Ga0495625_0028379 3300046660 Bacteria 4197
205 Ga0495623_0007625 3300046679 Bacteria 7030
206 Ga0495647_0031406 3300046681 Bacteria 1975
207 Ga0495670_0066196 3300046691 Bacteria 1822
208 Ga0495670_0087471 3300046691 Bacteria 1592
209 Ga0495671_0021389 3300046692 Bacteria 3399
210 Ga0495672_0000005 3300047320 Bacteria 593294
211 Ga0495676_0013980 3300047321 Bacteria 7192
212 Ga0495676_0095548 3300047321 Bacteria 2211
213 Ga0495686_0202127 3300047472 Bacteria 1140
214 Ga0495593_0010741 3300047673 Bacteria 5279
215 Ga0495626_0001475 3300048091 Bacteria 18573
216 Ga0496101_0017964 3300048904 Bacteria 4801
217 Ga0496102_0016202 3300048905 Bacteria 6513
218 Ga0496114_0185044 3300048917 Bacteria 1820
219 Ga0496116_0027068 3300048919 Bacteria 4178
220 Ga0496116_0072910 3300048919 Bacteria 2168
221 Ga0496118_0061237 3300048921 Bacteria 2788
222 Ga0496121_0070689 3300048924 Bacteria 2810
223 Ga0496125_0048332 3300048928 Bacteria 3549
224 Ga0501309_000873 3300049129 Bacteria 2694
225 Ga0501314_000434 3300049530 Bacteria 2589
226 Ga0501211_000899 3300049658 Bacteria 3110
227 Ga0501222_004774 3300049662 Bacteria 1842
228 Ga0501221_002426 3300049704 Bacteria 3073
229 Ga0501262_000558 3300049759 Bacteria 4446
230 Ga0501267_000459 3300049764 Bacteria 3145
231 nmdc:mga0yw44_28938_c1 3300050492 Bacteria 3193
232 nmdc:mga0k408_14552_c1 3300050493 Bacteria 4338
233 nmdc:mga07m45_106421_c1 3300050496 Bacteria 1613
234 nmdc:mga07m45_6314_c1 3300050496 Bacteria 5986
235 Ga0500610_0046608 3300053079 Bacteria 2251
236 Ga0500651_0000241 3300053093 Bacteria 33596
237 Ga0500571_001351 3300053110 Bacteria 11367
238 Ga0500658_0032108 3300053134 Bacteria 2057
239 Ga0500568_0000542 3300053139 Bacteria 27928
240 Ga0500619_000004 3300053154 Bacteria 98915
241 Ga0590071_001450 3300059421 Bacteria 6254

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0202127 Ga0495686_0202127_94_1110 337
2 3300044693 Ga0466961_0092176 Ga0466961_0092176_796_1890 345
3 3300046679 Ga0495623_0007625 Ga0495623_0007625_5943_7016 347
4 iso_pu_bacteria 2886848708 2886853700 350
5 3300046648 Ga0495611_0103171 Ga0495611_0103171_247_1314 351
6 3300049658 Ga0501211_000899 Ga0501211_000899_2015_3076 353
7 3300037471 Ga0395905_0102356 Ga0395905_0102356_1594_2661 355
8 3300039447 Ga0436361_0982187 Ga0436361_0982187_5276_6460 368
9 3300025294 Ga0209025_1008502 Ga0209025_10085027 374
10 3300048919 Ga0496116_0027068 Ga0496116_0027068_39_1244 374
11 3300048924 Ga0496121_0070689 Ga0496121_0070689_58_1263 374
12 3300046517 Ga0495630_0040864 Ga0495630_0040864_1867_3039 375
13 3300044658 Ga0466972_0000805 Ga0466972_0000805_12359_13537 376
14 3300003187 JGI25151J46595_10032388 JGI25151J46595_100323882 379
15 3300042120 Ga0450917_000471 Ga0450917_000471_1751_2929 379
16 3300042129 Ga0450891_000047 Ga0450891_000047_4345_5523 379
17 3300042532 Ga0450893_0011878 Ga0450893_0011878_206_1384 379
18 3300049129 Ga0501309_000873 Ga0501309_000873_1450_2628 379
19 3300049530 Ga0501314_000434 Ga0501314_000434_587_1765 379
20 3300049764 Ga0501267_000459 Ga0501267_000459_1341_2519 379
21 3300044735 Ga0466968_0013513 Ga0466968_0013513_1108_2319 380
22 3300044765 Ga0466970_0010488 Ga0466970_0010488_2190_3401 380
23 3300003794 Ga0055531_10000107 Ga0055531_1000010712 381
24 3300025273 Ga0209673_1011712 Ga0209673_10117123 381
25 3300025303 Ga0209051_1004111 Ga0209051_100411113 381
26 3300025304 Ga0209257_1000032 Ga0209257_100003273 381
27 3300046535 Ga0495586_0015025 Ga0495586_0015025_2153_3340 382
28 3300003771 Ga0055526_1006723 Ga0055526_10067233 383
29 3300025295 Ga0209564_1000005 Ga0209564_1000005770 383
30 3300028794 Ga0307515_10037329 Ga0307515_100373296 383
31 3300037068 Ga0373925_0004687 Ga0373925_0004687_3457_4644 383
32 3300046681 Ga0495647_0031406 Ga0495647_0031406_690_1877 383
33 3300005459 Ga0068867_100000018 Ga0068867_10000001819 384
34 3300005530 Ga0070679_100018662 Ga0070679_1000186622 384
35 3300005563 Ga0068855_100014853 Ga0068855_1000148532 384
36 3300005616 Ga0068852_100005610 Ga0068852_1000056106 384
37 3300014745 Ga0157377_10000051 Ga0157377_100000517 384
38 3300025921 Ga0207652_10089835 Ga0207652_100898353 384
39 3300025935 Ga0207709_10000889 Ga0207709_1000088923 384
40 3300026089 Ga0207648_10000060 Ga0207648_1000006082 384
41 3300026142 Ga0207698_10003996 Ga0207698_100039966 384
42 3300042876 Ga0451577_0014354 Ga0451577_0014354_2975_4132 384
43 iso_pu_bacteria 2643221585 2643935741 384
44 iso_pu_bacteria 2643221639 2644222976 384
45 iso_pu_bacteria 2643221656 2644317524 384
46 iso_pu_bacteria 2643221660 2644338914 384
47 iso_pu_bacteria 2738541337 2739057701 384
48 3300006058 Ga0075432_10050242 Ga0075432_100502422 385
49 3300006195 Ga0075366_10036986 Ga0075366_100369862 385
50 3300035084 Ga0373928_0005647 Ga0373928_0005647_475_1659 385
51 3300035691 Ga0373931_0007590 Ga0373931_0007590_3873_5057 385
52 3300046455 Ga0495603_0016405 Ga0495603_0016405_1951_3168 385
53 3300046492 Ga0495585_0005768 Ga0495585_0005768_2181_3398 385
54 3300046691 Ga0495670_0066196 Ga0495670_0066196_323_1540 385
55 3300047320 Ga0495672_0000005 Ga0495672_0000005_509066_510328 385
56 3300047321 Ga0495676_0095548 Ga0495676_0095548_394_1566 385
57 3300048091 Ga0495626_0001475 Ga0495626_0001475_305_1522 385
58 3300050496 nmdc:mga07m45_106421_c1 nmdc:mga07m45_106421_c1_302_1474 385
59 iso_pu_bacteria 2585428057 2587727802 385
60 iso_pu_bacteria 2585428062 2587754479 385
61 iso_pu_bacteria 2588253510 2588292336 385
62 3300037471 Ga0395905_0029018 Ga0395905_0029018_595_1767 386
63 3300037471 Ga0395905_0011805 Ga0395905_0011805_4663_5841 387
64 3300037471 Ga0395905_0012926 Ga0395905_0012926_1869_3131 387
65 3300044684 Ga0466966_0035847 Ga0466966_0035847_907_2085 387
66 3300045049 Ga0466959_0061042 Ga0466959_0061042_671_1849 387
67 3300003322 rootL2_10154830 rootL2_101548304 388
68 3300005337 Ga0070682_100043178 Ga0070682_1000431782 388
69 3300005353 Ga0070669_100081453 Ga0070669_1000814532 388
70 3300005441 Ga0070700_100005599 Ga0070700_1000055997 388
71 3300005719 Ga0068861_100001871 Ga0068861_10000187110 388
72 3300005842 Ga0068858_100018723 Ga0068858_1000187235 388
73 3300005843 Ga0068860_100180120 Ga0068860_1001801203 388
74 3300006353 Ga0075370_10059668 Ga0075370_100596682 388
75 3300006881 Ga0068865_100032673 Ga0068865_1000326732 388
76 3300013297 Ga0157378_10000815 Ga0157378_1000081527 388
77 3300013306 Ga0163162_10000821 Ga0163162_1000082118 388
78 3300017792 Ga0163161_10010742 Ga0163161_100107422 388
79 3300021361 Ga0213872_10000046 Ga0213872_1000004633 388
80 3300025923 Ga0207681_10020146 Ga0207681_100201465 388
81 3300025940 Ga0207691_10038590 Ga0207691_100385904 388
82 3300025942 Ga0207689_10148355 Ga0207689_101483552 388
83 3300026035 Ga0207703_10017179 Ga0207703_100171795 388
84 3300026089 Ga0207648_10000542 Ga0207648_1000054231 388
85 3300026118 Ga0207675_100008495 Ga0207675_1000084956 388
86 3300028380 Ga0268265_10004197 Ga0268265_100041978 388
87 3300028380 Ga0268265_10087806 Ga0268265_100878062 388
88 3300028381 Ga0268264_10012552 Ga0268264_100125527 388
89 3300030522 Ga0307512_10122080 Ga0307512_101220802 388
90 3300031239 Ga0265328_10031776 Ga0265328_100317763 388
91 3300031250 Ga0265331_10009064 Ga0265331_100090647 388
92 3300031251 Ga0265327_10000028 Ga0265327_10000028301 388
93 3300031730 Ga0307516_10044992 Ga0307516_100449922 388
94 3300035691 Ga0373931_0046055 Ga0373931_0046055_431_1609 388
95 3300039447 Ga0436361_0633280 Ga0436361_0633280_73881_75059 388
96 3300049662 Ga0501222_004774 Ga0501222_004774_151_1329 388
97 3300049704 Ga0501221_002426 Ga0501221_002426_1747_2925 388
98 3300028794 Ga0307515_10000366 Ga0307515_1000036616 389
99 3300028794 Ga0307515_10001653 Ga0307515_1000165339 389
100 3300028794 Ga0307515_10064564 Ga0307515_100645642 389
101 3300028794 Ga0307515_10185133 Ga0307515_101851332 389
102 iso_pu_bacteria 2831864461 2831869748 389
103 3300006195 Ga0075366_10005437 Ga0075366_100054372 390
104 3300031548 Ga0307408_100077778 Ga0307408_1000777782 390
105 3300031548 Ga0307408_100142169 Ga0307408_1001421693 390
106 3300031649 Ga0307514_10005491 Ga0307514_100054914 390
107 3300039447 Ga0436361_0582353 Ga0436361_0582353_422_1606 390
108 3300050496 nmdc:mga07m45_6314_c1 nmdc:mga07m45_6314_c1_920_2140 390
109 iso_pu_bacteria 2842733646 2842736865 390
110 iso_pu_bacteria 2904541872 2904548477 390
111 iso_pu_bacteria 2929160207 2929163875 390
112 iso_pu_bacteria 2643221683 2644468731 391
113 3300005262 Ga0065165_1002514 Ga0065165_10025144 392
114 3300006038 Ga0075365_10026156 Ga0075365_100261565 392
115 3300027614 Ga0209970_1000526 Ga0209970_10005262 392
116 3300050492 nmdc:mga0yw44_28938_c1 nmdc:mga0yw44_28938_c1_279_1457 392
117 3300053154 Ga0500619_000004 Ga0500619_000004_70641_71885 392
118 3300003775 Ga0055524_1000277 Ga0055524_100027718 393
119 3300005262 Ga0065165_1000092 Ga0065165_1000092104 393
120 3300005262 Ga0065165_1000531 Ga0065165_100053116 393
121 3300041486 Ga0451807_1870278 Ga0451807_1870278_135_1352 393
122 3300044694 Ga0466963_0036768 Ga0466963_0036768_937_2148 393
123 3300059421 Ga0590071_001450 Ga0590071_001450_1698_2918 393
124 3300003792 Ga0055540_1009707 Ga0055540_10097074 394
125 3300009098 Ga0105245_10120430 Ga0105245_101204301 394
126 3300014969 Ga0157376_10025416 Ga0157376_100254166 394
127 3300025294 Ga0209025_1001078 Ga0209025_100107824 394
128 3300025927 Ga0207687_10043488 Ga0207687_100434883 394
129 3300042876 Ga0451577_0000068 Ga0451577_0000068_148772_149998 394
130 3300042876 Ga0451577_0091541 Ga0451577_0091541_768_1952 394
131 3300044712 Ga0453684_0000126 Ga0453684_0000126_58723_59949 394
132 3300045051 Ga0451576_0006589 Ga0451576_0006589_17_1201 394
133 iso_pu_bacteria 2513020051 2513231458 394
134 iso_pu_bacteria 2599185214 2599624627 394
135 iso_pu_bacteria 2599185226 2599672511 394
136 iso_pu_bacteria 2599185227 2599683511 394
137 iso_pu_bacteria 2599185229 2599694120 394
138 iso_pu_bacteria 2643221658 2644328165 394
139 iso_pu_bacteria 2643221672 2644398521 394
140 iso_pu_bacteria 2738541277 2738720097 394
141 iso_pu_bacteria 2738543019 2739279296 394
142 iso_pu_bacteria 2818991446 2819596026 394
143 iso_pu_bacteria 2831265667 2831266824 394
144 iso_pu_bacteria 2838054893 2838056883 394
145 iso_pu_bacteria 2842677519 2842682619 394
146 iso_pu_bacteria 2885198086 2885201366 394
147 iso_pu_bacteria 2885211737 2885215054 394
148 iso_pu_bacteria 2899924645 2899925376 394
149 iso_pu_bacteria 2919462493 2919464346 394
150 iso_pu_bacteria 2928037797 2928038502 394
151 iso_pu_bacteria 2928044640 2928045893 394
152 iso_pu_bacteria 2928051484 2928053568 394
153 iso_pu_bacteria 2928064002 2928067115 394
154 iso_pu_bacteria 2928070936 2928070982 394
155 iso_pu_bacteria 2928084124 2928085068 394
156 iso_pu_bacteria 2945909444 2945912586 394
157 iso_pu_bacteria 2945945610 2945947181 394
158 iso_pu_bacteria 2945984333 2945985128 394
159 3300003792 Ga0055540_1002318 Ga0055540_10023186 395
160 3300025292 Ga0209676_1000595 Ga0209676_100059545 395
161 3300025303 Ga0209051_1000398 Ga0209051_100039853 395
162 3300025304 Ga0209257_1014116 Ga0209257_10141165 395
163 3300025935 Ga0207709_10001201 Ga0207709_100012019 395
164 3300030522 Ga0307512_10052835 Ga0307512_100528352 395
165 3300031238 Ga0265332_10000003 Ga0265332_10000003160 395
166 3300046453 Ga0495627_010812 Ga0495627_010812_118_1305 395
167 3300046692 Ga0495671_0021389 Ga0495671_0021389_1960_3147 395
168 3300048919 Ga0496116_0072910 Ga0496116_0072910_445_1632 395
169 3300053079 Ga0500610_0046608 Ga0500610_0046608_387_1574 395
170 3300002774 JGI25150J39212_1005364 JGI25150J39212_10053643 398
171 3300003215 JGI25153J46596_10007479 JGI25153J46596_100074796 398
172 3300003761 Ga0055535_1000415 Ga0055535_100041522 398
173 3300003762 Ga0055542_1000004 Ga0055542_1000004233 398
174 3300003781 Ga0055536_1008854 Ga0055536_10088543 398
175 3300003781 Ga0055536_1013829 Ga0055536_10138292 398
176 3300003784 Ga0055534_1005622 Ga0055534_10056223 398
177 3300003791 Ga0055530_10005897 Ga0055530_100058976 398
178 3300003791 Ga0055530_10008018 Ga0055530_100080183 398
179 3300003792 Ga0055540_1006449 Ga0055540_10064494 398
180 3300003794 Ga0055531_10008459 Ga0055531_100084595 398
181 3300003794 Ga0055531_10019465 Ga0055531_100194653 398
182 3300003794 Ga0055531_10030674 Ga0055531_100306742 398
183 3300004625 Ga0055543_1006602 Ga0055543_10066022 398
184 3300005327 Ga0070658_10088869 Ga0070658_100888693 398
185 3300005457 Ga0070662_100031124 Ga0070662_1000311244 398
186 3300005539 Ga0068853_100012188 Ga0068853_1000121882 398
187 3300005543 Ga0070672_100255814 Ga0070672_1002558142 398
188 3300005564 Ga0070664_100057244 Ga0070664_1000572442 398
189 3300005616 Ga0068852_100071663 Ga0068852_1000716634 398
190 3300006038 Ga0075365_10025678 Ga0075365_100256785 398
191 3300006051 Ga0075364_10050978 Ga0075364_100509783 398
192 3300006058 Ga0075432_10014802 Ga0075432_100148022 398
193 3300006195 Ga0075366_10027067 Ga0075366_100270673 398
194 3300009036 Ga0105244_10006858 Ga0105244_100068589 398
195 3300009093 Ga0105240_10193111 Ga0105240_101931112 398
196 3300009148 Ga0105243_10004206 Ga0105243_100042063 398
197 3300009174 Ga0105241_10161667 Ga0105241_101616672 398
198 3300009551 Ga0105238_10395390 Ga0105238_103953902 398
199 3300013104 Ga0157370_10231222 Ga0157370_102312222 398
200 3300013104 Ga0157370_10293467 Ga0157370_102934672 398
201 3300013306 Ga0163162_10077468 Ga0163162_100774684 398
202 3300014497 Ga0182008_10002743 Ga0182008_100027434 398
203 3300014497 Ga0182008_10026918 Ga0182008_100269182 398
204 3300015261 Ga0182006_1002615 Ga0182006_10026157 398
205 3300015262 Ga0182007_10001192 Ga0182007_100011923 398
206 3300015262 Ga0182007_10003016 Ga0182007_100030164 398
207 3300017792 Ga0163161_10000917 Ga0163161_100009174 398
208 3300025208 Ga0209436_106307 Ga0209436_1063073 398
209 3300025228 Ga0209672_102893 Ga0209672_1028933 398
210 3300025229 Ga0209147_101896 Ga0209147_1018968 398
211 3300025242 Ga0209258_100022 Ga0209258_100022233 398
212 3300025245 Ga0207425_1002777 Ga0207425_10027776 398
213 3300025254 Ga0209148_1000034 Ga0209148_1000034233 398
214 3300025258 Ga0209129_1000023 Ga0209129_1000023314 398
215 3300025263 Ga0209565_1002262 Ga0209565_10022624 398
216 3300025273 Ga0209673_1003367 Ga0209673_10033676 398
217 3300025291 Ga0209675_1007113 Ga0209675_10071133 398
218 3300025291 Ga0209675_1007906 Ga0209675_10079063 398
219 3300025292 Ga0209676_1000005 Ga0209676_1000005489 398
220 3300025292 Ga0209676_1000437 Ga0209676_100043747 398
221 3300025292 Ga0209676_1009209 Ga0209676_10092095 398
222 3300025294 Ga0209025_1000717 Ga0209025_100071753 398
223 3300025294 Ga0209025_1011627 Ga0209025_10116276 398
224 3300025295 Ga0209564_1000958 Ga0209564_10009587 398
225 3300025295 Ga0209564_1001121 Ga0209564_10011218 398
226 3300025297 Ga0209758_1000064 Ga0209758_1000064215 398
227 3300025298 Ga0209050_1000007 Ga0209050_1000007608 398
228 3300025298 Ga0209050_1000471 Ga0209050_100047154 398
229 3300025298 Ga0209050_1000723 Ga0209050_10007234 398
230 3300025299 Ga0209256_1000115 Ga0209256_100011582 398
231 3300025299 Ga0209256_1000895 Ga0209256_10008957 398
232 3300025302 Ga0207426_1000001 Ga0207426_10000011221 398
233 3300025302 Ga0207426_1000031 Ga0207426_10000317 398
234 3300025303 Ga0209051_1000009 Ga0209051_1000009489 398
235 3300025303 Ga0209051_1000312 Ga0209051_100031214 398
236 3300025303 Ga0209051_1007699 Ga0209051_10076992 398
237 3300025303 Ga0209051_1040043 Ga0209051_10400432 398
238 3300025304 Ga0209257_1000011 Ga0209257_1000011463 398
239 3300025304 Ga0209257_1000669 Ga0209257_10006694 398
240 3300025728 Ga0207655_1013951 Ga0207655_10139514 398
241 3300025935 Ga0207709_10001654 Ga0207709_100016545 398
242 3300025940 Ga0207691_10275197 Ga0207691_102751972 398
243 3300025945 Ga0207679_10197166 Ga0207679_101971662 398
244 3300025972 Ga0207668_10130414 Ga0207668_101304141 398
245 3300026095 Ga0207676_10310866 Ga0207676_103108662 398
246 3300026121 Ga0207683_10028441 Ga0207683_100284416 398
247 3300028794 Ga0307515_10000028 Ga0307515_10000028213 398
248 3300028794 Ga0307515_10149719 Ga0307515_101497193 398
249 3300030731 Ga0316177_1112436 Ga0316177_11124364 398
250 3300030733 Ga0314311_1106220 Ga0314311_11062204 398
251 3300030734 Ga0316179_1041506 Ga0316179_10415063 398
252 3300030742 Ga0316183_1044344 Ga0316183_10443445 398
253 3300031251 Ga0265327_10024613 Ga0265327_100246133 398
254 3300031548 Ga0307408_100053208 Ga0307408_1000532083 398
255 3300031731 Ga0307405_10139625 Ga0307405_101396252 398
256 3300031911 Ga0307412_10021912 Ga0307412_100219125 398
257 3300031911 Ga0307412_10043335 Ga0307412_100433354 398
258 3300031911 Ga0307412_10135720 Ga0307412_101357201 398
259 3300031911 Ga0307412_10194589 Ga0307412_101945891 398
260 3300032002 Ga0307416_100101768 Ga0307416_1001017682 398
261 3300042007 Ga0439449_0004284 Ga0439449_0004284_1598_2797 398
262 3300046460 Ga0495638_0059579 Ga0495638_0059579_734_1930 398
263 3300046512 Ga0495610_0006383 Ga0495610_0006383_1044_2240 398
264 3300046518 Ga0495631_0003754 Ga0495631_0003754_177_1373 398
265 3300046520 Ga0495637_0035012 Ga0495637_0035012_432_1628 398
266 3300046615 Ga0495656_0000923 Ga0495656_0000923_4193_5392 398
267 3300046660 Ga0495625_0028379 Ga0495625_0028379_1254_2450 398
268 3300046691 Ga0495670_0087471 Ga0495670_0087471_326_1525 398
269 3300047321 Ga0495676_0013980 Ga0495676_0013980_914_2110 398
270 3300047673 Ga0495593_0010741 Ga0495593_0010741_2450_3646 398
271 3300048904 Ga0496101_0017964 Ga0496101_0017964_225_1424 398
272 3300048905 Ga0496102_0016202 Ga0496102_0016202_5210_6409 398
273 3300048917 Ga0496114_0185044 Ga0496114_0185044_63_1262 398
274 3300048921 Ga0496118_0061237 Ga0496118_0061237_1387_2583 398
275 3300048928 Ga0496125_0048332 Ga0496125_0048332_667_1863 398
276 3300049759 Ga0501262_000558 Ga0501262_000558_1540_2736 398
277 3300050493 nmdc:mga0k408_14552_c1 nmdc:mga0k408_14552_c1_1277_2473 398
278 3300053093 Ga0500651_0000241 Ga0500651_0000241_5402_6598 398
279 3300053110 Ga0500571_001351 Ga0500571_001351_3829_5025 398
280 3300053134 Ga0500658_0032108 Ga0500658_0032108_35_1231 398
281 3300053139 Ga0500568_0000542 Ga0500568_0000542_2089_3285 398

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

38

416

0.93

PF00266

Aminotran_5

Aminotransferase class-V

72

212

0.87

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

89

209

0.84

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

94

217

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yhv-assembly1.cif.gz_B crystal structure of an aminotransferase from mycobacterium tuberculosis 0.9543 1 394
3h14-assembly1.cif.gz_A crystal structure of a putative aminotransferase from silicibacter pomeroyi 0.954 1 394
5yhv-assembly1.cif.gz_D crystal structure of an aminotransferase from mycobacterium tuberculosis 0.9536 1 385
2z61-assembly1.cif.gz_A-2 crystal structure of mj0684 from methanococcus jannaschii reveals its similarity in the active site to kynurenine aminotransferases 0.9509 2 393
1o4s-assembly1.cif.gz_A crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution 0.949 3 395
ID Description Score Start End Superfamily
af_P96847_4_388_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9583 2 394 3.40.640.10
af_P96847_4_388_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.951 2 394 3.40.640.10
af_Q60317_288_372_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9506 298 390 3.90.1150.10
af_A0A0R0HS10_77_301_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9502 65 282 3.40.640.10
3h14A00 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9456 1 395 3.40.640.10
ID Description Score Start End GO Terms
AF-V7D227-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9842 53 394 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A1Y5G152-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9785 1 395 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A3M3MSU7-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9771 1 394 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A5Q2QDY2-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9765 16 396 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A7C5KWM6-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9745 16 398 GO:0006520
GO:0008483
GO:0009058
GO:0030170

Feature Viewer

pLDDT pTM Quality
94.47 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map