F384428

General Info

Members Datasets Scaffolds Average Seq Length
281 221 562 196

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0009287|Ga0395899_0009287_4611_5207
Length 198
Sequence MEKFVAHTGTAVPLRRSNVDTDQIIPAVYLKRVTRTGFEDGLFSAWRQDPEFVLNKPEHVGASILVAGPDFGTGSSREHAVWALMDYGFKVVLSPRFADIFRGNSAKGGLLTAQVPLDVVERLWALIEADPALAVTVDLAAREVRAGDLVAPFEVDDYTRWRLMEGLDDIGLTLRHVDDITAFEAQRPAWLPTTTPVG

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
29 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
30 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
31 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
32 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
33 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
34 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
35 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
57 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
58 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
59 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
60 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
63 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
64 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
65 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
66 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
70 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
71 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
72 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
78 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
79 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
80 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
81 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
82 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
83 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
95 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
104 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
105 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
106 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
113 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
114 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
115 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
123 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
151 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
152 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
153 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
154 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
155 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
156 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
157 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
158 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
159 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
160 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
161 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
162 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
163 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
164 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
165 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
166 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
167 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
168 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
169 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
170 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
171 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
174 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
175 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
176 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
177 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
178 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
179 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
180 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
181 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
182 2643221548 Streptomyces sp. Root55 Isolate Unclassified
183 2643221647 Streptomyces sp. Root369 Isolate Unclassified
184 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
185 2643221714 Streptomyces sp. Root264 Isolate Unclassified
186 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
187 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
188 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
189 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
190 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
191 2808606448 Streptomyces sp. 193411 Isolate Unclassified
192 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
193 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
194 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
195 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
196 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
197 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
198 2867428634 Streptomyces sp. RP5T Isolate Unclassified
199 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
200 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
201 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
202 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
203 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
204 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
205 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
206 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
207 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
208 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
209 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
210 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
211 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
212 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
213 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
214 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
215 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
216 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
217 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
218 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
219 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
220 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
221 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.29
Metatranscriptomes 4.27
Isolates 17.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.25
Nodule 0.71
Rhizoplane 0.36
Rhizosphere 78.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0009287 3300037312 Bacteria 7551
2 Ga0006562J51391_1154204 3300003578 Bacteria 2558
3 Ga0006562J51391_1154205 3300003578 Bacteria 2430
4 JGI25405J52794_10024390 3300003911 Bacteria 1235
5 Ga0070658_10000672 3300005327 Bacteria 29591
6 Ga0070658_10001329 3300005327 Bacteria 21084
7 Ga0070658_10014462 3300005327 Bacteria 6332
8 Ga0070680_100000056 3300005336 Bacteria 57426
9 Ga0070660_100066234 3300005339 Bacteria 2811
10 Ga0070660_100252704 3300005339 Bacteria 1438
11 Ga0070691_10420956 3300005341 Bacteria 757
12 Ga0070714_100036281 3300005435 Bacteria 4134
13 Ga0070663_100826328 3300005455 Bacteria 796
14 Ga0070681_10000262 3300005458 Bacteria 42009
15 Ga0070681_10060923 3300005458 Bacteria 3750
16 Ga0070679_100001397 3300005530 Bacteria 21275
17 Ga0070679_100004551 3300005530 Bacteria 12801
18 Ga0070679_100016585 3300005530 Bacteria 7112
19 Ga0070684_100564354 3300005535 Bacteria 1057
20 Ga0068855_100002824 3300005563 Bacteria 21384
21 Ga0068855_100434836 3300005563 Bacteria 1434
22 Ga0068858_100000002 3300005842 Bacteria 351633
23 Ga0068860_101467012 3300005843 Bacteria 704
24 Ga0081455_10000995 3300005937 Bacteria 35927
25 Ga0081540_1011334 3300005983 Bacteria 5964
26 Ga0075368_10027130 3300006042 Bacteria 2207
27 Ga0075363_100009713 3300006048 Bacteria 4530
28 Ga0075367_10009235 3300006178 Bacteria 5147
29 Ga0114129_10141546 3300009147 Bacteria 3296
30 Ga0105248_10000943 3300009177 Bacteria 32364
31 Ga0105237_10005140 3300009545 Bacteria 14823
32 Ga0105238_11130771 3300009551 Bacteria 806
33 Ga0157370_10320869 3300013104 Bacteria 1429
34 Ga0157369_10000870 3300013105 Bacteria 38542
35 Ga0157369_10032486 3300013105 Bacteria 5739
36 Ga0157369_10213418 3300013105 Bacteria 2022
37 Ga0157369_10758621 3300013105 Bacteria 998
38 Ga0157372_10731609 3300013307 Bacteria 1151
39 Ga0163163_10012382 3300014325 Bacteria 7770
40 Ga0182008_10000253 3300014497 Bacteria 41589
41 Ga0157379_10000007 3300014968 Bacteria 142402
42 Ga0182006_1035714 3300015261 Bacteria 1979
43 Ga0182007_10000295 3300015262 Bacteria 32455
44 Ga0182005_1015008 3300015265 Bacteria 2163
45 Ga0183367_1013 3300015688 Bacteria 334176
46 Ga0197907_11239461 3300020069 Bacteria 1360
47 Ga0206354_11192273 3300020081 Bacteria 6719
48 Ga0206354_11222647 3300020081 Bacteria 1575
49 Ga0206353_10862407 3300020082 Bacteria 3623
50 Ga0206353_11550826 3300020082 Bacteria 36029
51 Ga0224712_10002887 3300022467 Bacteria 4346
52 Ga0207426_1024652 3300025302 Bacteria 2038
53 Ga0207426_1051444 3300025302 Bacteria 1223
54 Ga0207692_10194626 3300025898 Bacteria 1189
55 Ga0207705_10002593 3300025909 Bacteria 13883
56 Ga0207705_10005762 3300025909 Bacteria 9242
57 Ga0207705_10064273 3300025909 Bacteria 2651
58 Ga0207707_10000393 3300025912 Bacteria 45647
59 Ga0207695_10226496 3300025913 Bacteria 1775
60 Ga0207671_10011271 3300025914 Bacteria 7293
61 Ga0207660_10003461 3300025917 Bacteria 10291
62 Ga0207657_10237041 3300025919 Bacteria 1457
63 Ga0207657_10479024 3300025919 Bacteria 976
64 Ga0207652_10000817 3300025921 Bacteria 29736
65 Ga0207652_10022017 3300025921 Bacteria 5267
66 Ga0207652_10135833 3300025921 Bacteria 2196
67 Ga0207700_10073113 3300025928 Bacteria 2646
68 Ga0207664_10041631 3300025929 Bacteria 3580
69 Ga0207690_10636729 3300025932 Bacteria 873
70 Ga0207711_10001278 3300025941 Bacteria 23847
71 Ga0207689_10550798 3300025942 Bacteria 969
72 Ga0207667_10050736 3300025949 Bacteria 4377
73 Ga0207667_10377837 3300025949 Bacteria 1444
74 Ga0207703_10000001 3300026035 Bacteria 822925
75 Ga0209371_1015286 3300027312 Bacteria 2070
76 Ga0209813_10016667 3300027866 Bacteria 2008
77 Ga0307517_10118166 3300028786 Bacteria 1975
78 Ga0268256_1017213 3300030500 Bacteria 2043
79 Ga0307511_10067643 3300030521 Bacteria 2648
80 Ga0307511_10077167 3300030521 Bacteria 2374
81 Ga0307512_10261225 3300030522 Bacteria 850
82 Ga0265316_10494928 3300031344 Bacteria 874
83 Ga0307509_10041083 3300031507 Bacteria 5023
84 Ga0307509_10148751 3300031507 Bacteria 2262
85 Ga0307509_10517989 3300031507 Bacteria 874
86 Ga0307508_10034575 3300031616 Bacteria 4556
87 Ga0265342_10025082 3300031712 Bacteria 3755
88 Ga0316576_10009020 3300031727 Bacteria 6412
89 Ga0307516_10029967 3300031730 Bacteria 5496
90 Ga0307410_10049269 3300031852 Bacteria 2827
91 Ga0307409_100685413 3300031995 Bacteria 1022
92 Ga0307415_100368773 3300032126 Bacteria 1215
93 Ga0307510_10047263 3300033180 Bacteria 4615
94 Ga0307510_10409667 3300033180 Bacteria 798
95 Ga0316574_0005349 3300035398 Bacteria 6840
96 Ga0373933_0285828 3300035724 Bacteria 1066
97 Ga0395898_0262225 3300037466 Bacteria 1648
98 Ga0395905_0087780 3300037471 Bacteria 2916
99 Ga0436364_0096391 3300037853 Bacteria 918
100 Ga0395901_0036602 3300038443 Bacteria 5073
101 Ga0439453_0031323 3300041408 Bacteria 1009
102 Ga0439450_043048 3300042008 Bacteria 1054
103 Ga0439455_0002259 3300042012 Bacteria 3461
104 Ga0450898_001090 3300042134 Bacteria 3458
105 Ga0450903_000222 3300042138 Bacteria 12668
106 Ga0450906_001150 3300042145 Bacteria 5845
107 Ga0439458_0002124 3300042157 Bacteria 4902
108 Ga0451577_0076377 3300042876 Bacteria 2987
109 Ga0466969_0000873 3300044656 Bacteria 16345
110 Ga0466969_0008901 3300044656 Bacteria 5323
111 Ga0466969_0054599 3300044656 Bacteria 1956
112 Ga0466966_0007169 3300044684 Bacteria 7385
113 Ga0466966_0017061 3300044684 Bacteria 4802
114 Ga0466966_0030550 3300044684 Bacteria 3497
115 Ga0466966_0042308 3300044684 Bacteria 2924
116 Ga0466966_0681098 3300044684 Bacteria 619
117 Ga0466961_0068958 3300044693 Bacteria 2245
118 Ga0466963_0116652 3300044694 Bacteria 1835
119 Ga0466963_0136141 3300044694 Bacteria 1699
120 Ga0466971_0000629 3300044719 Bacteria 14080
121 Ga0466971_0000945 3300044719 Bacteria 11907
122 Ga0466971_0022002 3300044719 Bacteria 2837
123 Ga0466968_0281281 3300044735 Bacteria 796
124 Ga0466957_0012435 3300044842 Bacteria 4926
125 Ga0466959_0000617 3300045049 Bacteria 20706
126 Ga0466959_0005269 3300045049 Bacteria 8832
127 Ga0466959_0008369 3300045049 Bacteria 7311
128 Ga0466959_0025516 3300045049 Bacteria 4380
129 Ga0466958_0003232 3300045836 Bacteria 8411
130 Ga0466958_0034347 3300045836 Bacteria 3025
131 Ga0466958_0046288 3300045836 Bacteria 2625
132 Ga0466958_0290091 3300045836 Bacteria 1049
133 Ga0495627_022566 3300046453 Bacteria 2070
134 Ga0495592_0070144 3300046454 Bacteria 2554
135 Ga0495629_0077805 3300046459 Bacteria 2315
136 Ga0495651_0001993 3300046462 Bacteria 15807
137 Ga0495664_0023872 3300046477 Bacteria 3551
138 Ga0495594_0054412 3300046499 Bacteria 2205
139 Ga0495608_0405683 3300046511 Bacteria 833
140 Ga0495618_0016172 3300046514 Bacteria 4560
141 Ga0495628_0061023 3300046516 Bacteria 2957
142 Ga0495631_0059538 3300046518 Bacteria 1659
143 Ga0495632_0036847 3300046519 Bacteria 2486
144 Ga0495643_0001559 3300046522 Bacteria 20433
145 Ga0495642_0306513 3300046528 Bacteria 696
146 Ga0495652_0198902 3300046529 Bacteria 1522
147 Ga0495645_0208691 3300046543 Bacteria 1320
148 Ga0495622_0054907 3300046557 Bacteria 1848
149 Ga0495634_0079747 3300046642 Bacteria 2143
150 Ga0495635_0006046 3300046663 Bacteria 8443
151 Ga0495599_0140995 3300046678 Bacteria 1495
152 Ga0495623_0060062 3300046679 Bacteria 2386
153 Ga0495646_0195118 3300046680 Bacteria 1105
154 Ga0495669_0026462 3300046684 Bacteria 2535
155 Ga0495613_0022069 3300046689 Bacteria 4744
156 Ga0495613_0100242 3300046689 Bacteria 2092
157 Ga0495624_0141906 3300046690 Bacteria 1471
158 Ga0495670_0016990 3300046691 Bacteria 3577
159 Ga0495600_0018502 3300046809 Bacteria 4439
160 Ga0495660_0016005 3300046810 Bacteria 4326
161 Ga0495687_088765 3300047443 Bacteria 1189
162 Ga0495685_000247 3300047447 Bacteria 18692
163 Ga0495681_0000245 3300047470 Bacteria 45204
164 Ga0495602_0112597 3300048088 Bacteria 2208
165 Ga0495614_0004209 3300048089 Bacteria 6484
166 Ga0496109_0918485 3300048912 Bacteria 813
167 Ga0496126_0684124 3300048929 Bacteria 799
168 Ga0501306_042642 3300049127 Bacteria 708
169 Ga0501321_000695 3300049537 Bacteria 2321
170 Ga0501031_0039499 3300049568 Bacteria 3080
171 Ga0501031_0090961 3300049568 Bacteria 1990
172 Ga0501031_0157931 3300049568 Bacteria 1482
173 Ga0501032_0074515 3300049569 Bacteria 2261
174 Ga0501032_0168817 3300049569 Bacteria 1435
175 Ga0501033_0016338 3300049570 Bacteria 5621
176 Ga0501033_0027413 3300049570 Bacteria 4283
177 Ga0501036_0007336 3300049572 Bacteria 8982
178 Ga0501036_0914305 3300049572 Bacteria 720
179 Ga0501037_0064032 3300049573 Bacteria 2680
180 Ga0501038_0052118 3300049574 Bacteria 3528
181 Ga0501039_0036913 3300049575 Bacteria 3770
182 Ga0501039_0135050 3300049575 Bacteria 1937
183 Ga0501043_0065980 3300049579 Bacteria 2842
184 Ga0501047_0000195 3300049581 Bacteria 73381
185 Ga0501047_0038070 3300049581 Bacteria 4652
186 Ga0501068_0118004 3300049584 Bacteria 1653
187 Ga0501068_0695914 3300049584 Bacteria 665
188 Ga0501070_0007711 3300049586 Bacteria 9124
189 Ga0501070_0017872 3300049586 Bacteria 5954
190 Ga0501070_0227479 3300049586 Bacteria 1529
191 Ga0501070_0343999 3300049586 Bacteria 1211
192 Ga0501071_0254529 3300049587 Bacteria 1326
193 Ga0501072_0414681 3300049588 Bacteria 1068
194 Ga0501073_0232703 3300049589 Bacteria 1273
195 Ga0501073_0385715 3300049589 Bacteria 968
196 Ga0501074_0090744 3300049590 Bacteria 2188
197 Ga0501075_0533341 3300049591 Bacteria 896
198 Ga0501079_0970707 3300049741 Bacteria 669
199 Ga0501035_0180335 3300049822 Bacteria 1819
200 Ga0501035_0221269 3300049822 Bacteria 1616
201 Ga0501044_0020196 3300049823 Bacteria 7110
202 Ga0501044_0136251 3300049823 Bacteria 2446
203 Ga0501044_0405294 3300049823 Bacteria 1275
204 Ga0501045_0095031 3300049824 Bacteria 2205
205 nmdc:mga06z11_3504_c1 3300050494 Bacteria 6075
206 nmdc:mga04h51_27772_c1 3300050495 Bacteria 1761
207 nmdc:mga06r32_475448_c1 3300050510 Bacteria 1228
208 Ga0495612_0018557 3300053078 Bacteria 2784
209 Ga0500610_0230573 3300053079 Bacteria 869
210 Ga0500578_0002457 3300053086 Bacteria 15378
211 Ga0500646_0203297 3300053090 Bacteria 680
212 Ga0500654_179341 3300053099 Bacteria 678
213 Ga0500569_005668 3300053109 Bacteria 2694
214 Ga0500580_115213 3300053113 Bacteria 1032
215 Ga0500614_011323 3300053123 Bacteria 1928
216 Ga0500621_048809 3300053126 Bacteria 1713
217 Ga0500628_002591 3300053129 Bacteria 2983
218 Ga0500652_003814 3300053131 Bacteria 4601
219 Ga0500658_0001595 3300053134 Bacteria 9060
220 Ga0500573_0100333 3300053140 Bacteria 1629
221 Ga0500600_0004486 3300053149 Bacteria 8205
222 Ga0500616_0003874 3300053153 Bacteria 11009
223 Ga0500616_0097077 3300053153 Bacteria 1447
224 Ga0500627_0067995 3300053158 Bacteria 1575
225 Ga0500633_0000206 3300053160 Bacteria 8321
226 Ga0500634_0004099 3300053161 Bacteria 6666
227 Ga0587106_057907 3300059605 Bacteria 704
228 Ga0587067_122927 3300059640 Bacteria 625
229 Ga0466962_0000765 3300061719 Bacteria 14422
230 Ga0466962_0005717 3300061719 Bacteria 5976
231 Ga0466962_0007554 3300061719 Bacteria 5216
232 Ga0466962_0009448 3300061719 Bacteria 4675
233 2515496074 2515154088 Bacteria 5526283
234 2515719847 2515154129 Bacteria 5584369
235 2515757913 2515154137 Bacteria 5711575
236 2516082396 2515154202 Bacteria 5471270
237 2516090338 2515154203 Bacteria 5458536
238 2554256069 2554235005 Bacteria 6457341
239 2585310984 2582581313 Bacteria 10042643
240 2585311355 2582581313 Bacteria 10042643
241 2585316688 2582581314 Bacteria 11452267
242 2643761471 2643221548 Bacteria 8053412
243 2644269527 2643221647 Bacteria 10741251
244 2644458828 2643221682 Bacteria 6743283
245 2644629785 2643221714 Bacteria 9015452
246 2768647046 2767802112 Bacteria 6465194
247 2784590581 2784132148 Bacteria 8627943
248 2785371751 2784746768 Bacteria 10036182
249 2786672856 2786546132 Bacteria 10419719
250 2808844204 2808606359 Bacteria 9866990
251 2809234272 2808606448 Bacteria 8656184
252 2819699000 2818991463 Bacteria 7948711
253 2861522847 2861520306 Bacteria 8348283
254 2862284402 2862281513 Bacteria 9621493
255 2862294724 2862290372 Bacteria 7471434
256 2862385168 2862382967 Bacteria 10317375
257 2862515661 2862507626 Bacteria 9425308
258 2867430380 2867428634 Bacteria 9590268
259 2873317251 2873314349 Bacteria 8512634
260 2875396938 2875391855 Bacteria 7600475
261 2877678847 2877676314 Bacteria 9512378
262 2946077922 2946072368 Bacteria 8999607
263 2954679160 2954673503 Bacteria 9685905
264 2954684992 2954682443 Bacteria 9862841
265 2954694607 2954691527 Bacteria 10720516
266 2954709811 2954701450 Bacteria 10834262
267 2954714108 2954711539 Bacteria 10867210
268 2954724061 2954721474 Bacteria 10456478
269 2954737779 2954731030 Bacteria 10243860
270 2954742959 2954740390 Bacteria 10229294
271 2954756614 2954749733 Bacteria 10366972
272 2954761917 2954759201 Bacteria 9358192
273 2966600657 2966598605 Bacteria 7676064
274 2997453053 2997451912 Bacteria 8492419
275 3006426579 3006425503 Bacteria 6491253
276 8008562994 8008558824 Bacteria 10610750
277 8023624792 8023623736 Bacteria 8593882
278 8025414158 8025413630 Bacteria 7014048
279 8025481123 8025478263 Bacteria 8209203
280 8055071660 8055066027 Bacteria 9479577
281 8056671166 8056667051 Bacteria 6953971
282 Ga0395899_0009287
283 Ga0006562J51391_1154204
284 Ga0006562J51391_1154205
285 JGI25405J52794_10024390
286 Ga0070658_10000672
287 Ga0070658_10001329
288 Ga0070658_10014462
289 Ga0070680_100000056
290 Ga0070660_100066234
291 Ga0070660_100252704
292 Ga0070691_10420956
293 Ga0070714_100036281
294 Ga0070663_100826328
295 Ga0070681_10000262
296 Ga0070681_10060923
297 Ga0070679_100001397
298 Ga0070679_100004551
299 Ga0070679_100016585
300 Ga0070684_100564354
301 Ga0068855_100002824
302 Ga0068855_100434836
303 Ga0068858_100000002
304 Ga0068860_101467012
305 Ga0081455_10000995
306 Ga0081540_1011334
307 Ga0075368_10027130
308 Ga0075363_100009713
309 Ga0075367_10009235
310 Ga0114129_10141546
311 Ga0105248_10000943
312 Ga0105237_10005140
313 Ga0105238_11130771
314 Ga0157370_10320869
315 Ga0157369_10000870
316 Ga0157369_10032486
317 Ga0157369_10213418
318 Ga0157369_10758621
319 Ga0157372_10731609
320 Ga0163163_10012382
321 Ga0182008_10000253
322 Ga0157379_10000007
323 Ga0182006_1035714
324 Ga0182007_10000295
325 Ga0182005_1015008
326 Ga0183367_1013
327 Ga0197907_11239461
328 Ga0206354_11192273
329 Ga0206354_11222647
330 Ga0206353_10862407
331 Ga0206353_11550826
332 Ga0224712_10002887
333 Ga0207426_1024652
334 Ga0207426_1051444
335 Ga0207692_10194626
336 Ga0207705_10002593
337 Ga0207705_10005762
338 Ga0207705_10064273
339 Ga0207707_10000393
340 Ga0207695_10226496
341 Ga0207671_10011271
342 Ga0207660_10003461
343 Ga0207657_10237041
344 Ga0207657_10479024
345 Ga0207652_10000817
346 Ga0207652_10022017
347 Ga0207652_10135833
348 Ga0207700_10073113
349 Ga0207664_10041631
350 Ga0207690_10636729
351 Ga0207711_10001278
352 Ga0207689_10550798
353 Ga0207667_10050736
354 Ga0207667_10377837
355 Ga0207703_10000001
356 Ga0209371_1015286
357 Ga0209813_10016667
358 Ga0307517_10118166
359 Ga0268256_1017213
360 Ga0307511_10067643
361 Ga0307511_10077167
362 Ga0307512_10261225
363 Ga0265316_10494928
364 Ga0307509_10041083
365 Ga0307509_10148751
366 Ga0307509_10517989
367 Ga0307508_10034575
368 Ga0265342_10025082
369 Ga0316576_10009020
370 Ga0307516_10029967
371 Ga0307410_10049269
372 Ga0307409_100685413
373 Ga0307415_100368773
374 Ga0307510_10047263
375 Ga0307510_10409667
376 Ga0316574_0005349
377 Ga0373933_0285828
378 Ga0395898_0262225
379 Ga0395905_0087780
380 Ga0436364_0096391
381 Ga0395901_0036602
382 Ga0439453_0031323
383 Ga0439450_043048
384 Ga0439455_0002259
385 Ga0450898_001090
386 Ga0450903_000222
387 Ga0450906_001150
388 Ga0439458_0002124
389 Ga0451577_0076377
390 Ga0466969_0000873
391 Ga0466969_0008901
392 Ga0466969_0054599
393 Ga0466966_0007169
394 Ga0466966_0017061
395 Ga0466966_0030550
396 Ga0466966_0042308
397 Ga0466966_0681098
398 Ga0466961_0068958
399 Ga0466963_0116652
400 Ga0466963_0136141
401 Ga0466971_0000629
402 Ga0466971_0000945
403 Ga0466971_0022002
404 Ga0466968_0281281
405 Ga0466957_0012435
406 Ga0466959_0000617
407 Ga0466959_0005269
408 Ga0466959_0008369
409 Ga0466959_0025516
410 Ga0466958_0003232
411 Ga0466958_0034347
412 Ga0466958_0046288
413 Ga0466958_0290091
414 Ga0495627_022566
415 Ga0495592_0070144
416 Ga0495629_0077805
417 Ga0495651_0001993
418 Ga0495664_0023872
419 Ga0495594_0054412
420 Ga0495608_0405683
421 Ga0495618_0016172
422 Ga0495628_0061023
423 Ga0495631_0059538
424 Ga0495632_0036847
425 Ga0495643_0001559
426 Ga0495642_0306513
427 Ga0495652_0198902
428 Ga0495645_0208691
429 Ga0495622_0054907
430 Ga0495634_0079747
431 Ga0495635_0006046
432 Ga0495599_0140995
433 Ga0495623_0060062
434 Ga0495646_0195118
435 Ga0495669_0026462
436 Ga0495613_0022069
437 Ga0495613_0100242
438 Ga0495624_0141906
439 Ga0495670_0016990
440 Ga0495600_0018502
441 Ga0495660_0016005
442 Ga0495687_088765
443 Ga0495685_000247
444 Ga0495681_0000245
445 Ga0495602_0112597
446 Ga0495614_0004209
447 Ga0496109_0918485
448 Ga0496126_0684124
449 Ga0501306_042642
450 Ga0501321_000695
451 Ga0501031_0039499
452 Ga0501031_0090961
453 Ga0501031_0157931
454 Ga0501032_0074515
455 Ga0501032_0168817
456 Ga0501033_0016338
457 Ga0501033_0027413
458 Ga0501036_0007336
459 Ga0501036_0914305
460 Ga0501037_0064032
461 Ga0501038_0052118
462 Ga0501039_0036913
463 Ga0501039_0135050
464 Ga0501043_0065980
465 Ga0501047_0000195
466 Ga0501047_0038070
467 Ga0501068_0118004
468 Ga0501068_0695914
469 Ga0501070_0007711
470 Ga0501070_0017872
471 Ga0501070_0227479
472 Ga0501070_0343999
473 Ga0501071_0254529
474 Ga0501072_0414681
475 Ga0501073_0232703
476 Ga0501073_0385715
477 Ga0501074_0090744
478 Ga0501075_0533341
479 Ga0501079_0970707
480 Ga0501035_0180335
481 Ga0501035_0221269
482 Ga0501044_0020196
483 Ga0501044_0136251
484 Ga0501044_0405294
485 Ga0501045_0095031
486 nmdc:mga06z11_3504_c1
487 nmdc:mga04h51_27772_c1
488 nmdc:mga06r32_475448_c1
489 Ga0495612_0018557
490 Ga0500610_0230573
491 Ga0500578_0002457
492 Ga0500646_0203297
493 Ga0500654_179341
494 Ga0500569_005668
495 Ga0500580_115213
496 Ga0500614_011323
497 Ga0500621_048809
498 Ga0500628_002591
499 Ga0500652_003814
500 Ga0500658_0001595
501 Ga0500573_0100333
502 Ga0500600_0004486
503 Ga0500616_0003874
504 Ga0500616_0097077
505 Ga0500627_0067995
506 Ga0500633_0000206
507 Ga0500634_0004099
508 Ga0587106_057907
509 Ga0587067_122927
510 Ga0466962_0000765
511 Ga0466962_0005717
512 Ga0466962_0007554
513 Ga0466962_0009448
514 2515496074
515 2515719847
516 2515757913
517 2516082396
518 2516090338
519 2554256069
520 2585310984
521 2585311355
522 2585316688
523 2643761471
524 2644269527
525 2644458828
526 2644629785
527 2768647046
528 2784590581
529 2785371751
530 2786672856
531 2808844204
532 2809234272
533 2819699000
534 2861522847
535 2862284402
536 2862294724
537 2862385168
538 2862515661
539 2867430380
540 2873317251
541 2875396938
542 2877678847
543 2946077922
544 2954679160
545 2954684992
546 2954694607
547 2954709811
548 2954714108
549 2954724061
550 2954737779
551 2954742959
552 2954756614
553 2954761917
554 2966600657
555 2997453053
556 3006426579
557 8008562994
558 8023624792
559 8025414158
560 8025481123
561 8055071660
562 8056671166

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00694

Aconitase_C

Aconitase C-terminal domain

1

117

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h5j-assembly1.cif.gz_A leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9612 1 168
3h5j-assembly1.cif.gz_A leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9557 1 168
3h5e-assembly2.cif.gz_B leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9424 4 155
2hcu-assembly1.cif.gz_A crystal structure of smu.1381 (or leud) from streptococcus mutans 0.9373 1 168
3h5e-assembly2.cif.gz_B leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9365 4 155
ID Description Score Start End Superfamily
3h5jA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9612 1 168 3.20.19.10
3h5jA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9557 1 168 3.20.19.10
af_O14289_535_712_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9397 3 170 3.20.19.10
3q3wA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9344 1 169 3.20.19.10
af_Q2FWK0_1_171_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.914 2 168 3.20.19.10
ID Description Score Start End GO Terms
AF-Q44428-F1-model_v4 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (IPMI) (Isopropylmalate isomerase) 0.982 1 92 GO:0003861
GO:0009098
AF-A0A1B6AWJ5-F1-model_v4 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (Isopropylmalate isomerase) 0.9775 1 148 GO:0003861
GO:0009098
GO:0009316
AF-A0A537YM36-F1-model_v4 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (IPMI) (Isopropylmalate isomerase) 0.9761 1 196 GO:0003861
GO:0009098
GO:0009316
AF-A0A7K2BX69-F1-model_v4 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (Isopropylmalate isomerase) 0.9749 1 89 GO:0009098
GO:0016829
AF-A0A6L6EMB2-F1-model_v4 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (Isopropylmalate isomerase) 0.9744 1 169 GO:0003861
GO:0009098
GO:0009316

Map