F384373

General Info

Members Datasets Scaffolds Average Seq Length
281 168 562 344

Family's Representative Sequence

Representative Sequence 3300031090|Ga0265760_10007295|Ga0265760_100072952
Length 394
Sequence MNCSPASSDSAGYGQASTTILAGKPNTYNKGFAHKDFAAWDWSPDLAQPTQPEERNNDERYSRQILFRGIGAEGQHKLAAGRVAIVGCGATGSALAGLLARAGVGTLRIIDRDYVEPSNLQRQSLFDEADAAESLPKAIAAARKIAAFNSEITIEPRVEDLVPANIEPMLEGMSLILDGTDNFETRYLINDYAVDRSLPWIYSAAVGSYAVTLNILPSETACLACIFPESPRGMVETCETAGILNSAVNLVASIAATEAIKLLVGDAGISQLRRTLLSFDVWTNEHAEISAAKPRVGCRACGERDFIHLAGEGRPHITLCGRNSVQIHERQRPIDFAEMDRRLQPHGAVRHNDFVLKFWHEPYEMTLFPDGRAIIKGTTDTAVARSLYARYVGS

Samples

Sample ID Description Type Environment
1 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
80 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
81 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.86
Metatranscriptomes 2.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.91
Rhizosphere 95.37
Stem 0
Stem Tuber 0
Unclassified 13.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265760_10007295 3300031090 Bacteria 3165
2 rootL2_10112714 3300003322 Bacteria 3646
3 Ga0070658_10231157 3300005327 Bacteria 1566
4 Ga0070676_10012358 3300005328 Bacteria 4657
5 Ga0070683_100027230 3300005329 Bacteria 5154
6 Ga0070683_100279867 3300005329 Unclassified 1587
7 Ga0070690_100028082 3300005330 Bacteria 3482
8 Ga0070666_10063052 3300005335 Bacteria 2512
9 Ga0070682_100042966 3300005337 Bacteria 2793
10 Ga0068868_100024003 3300005338 Bacteria 4621
11 Ga0068868_100031333 3300005338 Bacteria 4084
12 Ga0068868_100111828 3300005338 Unclassified 2220
13 Ga0070691_10013556 3300005341 Bacteria 3734
14 Ga0070661_100021722 3300005344 Bacteria 4588
15 Ga0070692_10111230 3300005345 Bacteria 1515
16 Ga0070668_100012553 3300005347 Bacteria 6308
17 Ga0070675_100146935 3300005354 Bacteria 2019
18 Ga0070673_100296169 3300005364 Bacteria 1423
19 Ga0070688_100219190 3300005365 Bacteria 1340
20 Ga0070667_100018255 3300005367 Bacteria 5815
21 Ga0070709_10000447 3300005434 Bacteria 24956
22 Ga0070709_10005564 3300005434 Bacteria 6823
23 Ga0070709_10015288 3300005434 Unclassified 4364
24 Ga0070709_10366611 3300005434 Bacteria 1068
25 Ga0070714_100126998 3300005435 Bacteria 2275
26 Ga0070713_100000352 3300005436 Bacteria 29758
27 Ga0070713_100000531 3300005436 Bacteria 24184
28 Ga0070713_100021637 3300005436 Unclassified 4952
29 Ga0070713_100168620 3300005436 Unclassified 1960
30 Ga0070710_10006851 3300005437 Bacteria 5499
31 Ga0070710_10035736 3300005437 Unclassified 2711
32 Ga0070711_100002479 3300005439 Bacteria 10539
33 Ga0070711_100016659 3300005439 Bacteria 4668
34 Ga0070711_100170200 3300005439 Bacteria 1660
35 Ga0070694_100126903 3300005444 Bacteria 1838
36 Ga0070708_100000729 3300005445 Bacteria 24960
37 Ga0070708_100048177 3300005445 Bacteria 3766
38 Ga0070708_100082095 3300005445 Unclassified 2919
39 Ga0070663_100007564 3300005455 Bacteria 6624
40 Ga0070662_100003109 3300005457 Bacteria 10316
41 Ga0070681_10008354 3300005458 Bacteria 10141
42 Ga0070681_10247802 3300005458 Bacteria 1694
43 Ga0068867_100060617 3300005459 Bacteria 2807
44 Ga0070706_100000410 3300005467 Bacteria 51662
45 Ga0070706_100023738 3300005467 Bacteria 5646
46 Ga0070706_100035465 3300005467 Bacteria 4608
47 Ga0070706_100039912 3300005467 Bacteria 4333
48 Ga0070707_100002005 3300005468 Bacteria 19504
49 Ga0070707_100135963 3300005468 Bacteria 2391
50 Ga0070698_100001258 3300005471 Bacteria 28295
51 Ga0070698_100023373 3300005471 Bacteria 6463
52 Ga0070698_100151471 3300005471 Bacteria 2267
53 Ga0070698_100213280 3300005471 Unclassified 1865
54 Ga0070699_100000621 3300005518 Bacteria 33511
55 Ga0070699_100029307 3300005518 Bacteria 4745
56 Ga0070699_100152396 3300005518 Bacteria 2045
57 Ga0070679_100032688 3300005530 Bacteria 5148
58 Ga0070679_100083112 3300005530 Bacteria 3191
59 Ga0070679_100189300 3300005530 Bacteria 2027
60 Ga0070679_100274462 3300005530 Bacteria 1639
61 Ga0070684_100028860 3300005535 Bacteria 4696
62 Ga0070697_100000258 3300005536 Bacteria 42993
63 Ga0070697_100015119 3300005536 Bacteria 6061
64 Ga0070697_100024037 3300005536 Bacteria 4850
65 Ga0070672_100129825 3300005543 Bacteria 2070
66 Ga0070693_100086539 3300005547 Bacteria 1880
67 Ga0070665_100123646 3300005548 Bacteria 2589
68 Ga0070704_100044427 3300005549 Bacteria 3087
69 Ga0070664_100019296 3300005564 Bacteria 5609
70 Ga0070664_100340980 3300005564 Bacteria 1361
71 Ga0068857_100018768 3300005577 Bacteria 6067
72 Ga0068854_100102418 3300005578 Bacteria 2148
73 Ga0068856_100001051 3300005614 Bacteria 29257
74 Ga0068856_100027514 3300005614 Bacteria 5547
75 Ga0068856_100243461 3300005614 Bacteria 1813
76 Ga0068863_100035398 3300005841 Unclassified 4756
77 Ga0068863_100138218 3300005841 Bacteria 2328
78 Ga0068863_100284330 3300005841 Bacteria 1603
79 Ga0068858_100292389 3300005842 Bacteria 1553
80 Ga0068860_100013082 3300005843 Bacteria 8144
81 Ga0068862_100013188 3300005844 Bacteria 6836
82 Ga0070717_10002067 3300006028 Bacteria 14050
83 Ga0070717_10002671 3300006028 Bacteria 12556
84 Ga0070717_10137396 3300006028 Unclassified 2106
85 Ga0070717_10221515 3300006028 Bacteria 1663
86 Ga0070717_10275907 3300006028 Unclassified 1490
87 Ga0070716_100030400 3300006173 Unclassified 2929
88 Ga0070716_100111635 3300006173 Bacteria 1695
89 Ga0070712_100000658 3300006175 Bacteria 20372
90 Ga0070712_100001245 3300006175 Bacteria 15390
91 Ga0097621_100001165 3300006237 Bacteria 18212
92 Ga0068871_100006358 3300006358 Bacteria 8349
93 Ga0068871_100025652 3300006358 Bacteria 4589
94 Ga0068871_100028063 3300006358 Bacteria 4408
95 Ga0075434_100389286 3300006871 Bacteria 1415
96 Ga0105240_10033323 3300009093 Bacteria 6657
97 Ga0105245_10012660 3300009098 Bacteria 7345
98 Ga0105245_10021336 3300009098 Bacteria 5680
99 Ga0105245_10033162 3300009098 Bacteria 4575
100 Ga0105245_10070837 3300009098 Bacteria 3165
101 Ga0105247_10018389 3300009101 Bacteria 4192
102 Ga0105247_10114209 3300009101 Bacteria 1742
103 Ga0114129_10057003 3300009147 Bacteria 5470
104 Ga0105243_10014631 3300009148 Bacteria 5936
105 Ga0105241_10007839 3300009174 Bacteria 7853
106 Ga0105241_10333676 3300009174 Bacteria 1311
107 Ga0105241_10423555 3300009174 Bacteria 1172
108 Ga0105242_10022323 3300009176 Bacteria 4975
109 Ga0105248_10004120 3300009177 Bacteria 16083
110 Ga0105248_10010043 3300009177 Bacteria 10424
111 Ga0105237_10254587 3300009545 Bacteria 1758
112 Ga0105238_10024994 3300009551 Bacteria 6089
113 Ga0105249_10019906 3300009553 Bacteria 5992
114 Ga0105239_10032342 3300010375 Bacteria 5749
115 Ga0157373_10150668 3300013100 Bacteria 1636
116 Ga0157371_10039203 3300013102 Bacteria 3387
117 Ga0157369_10061137 3300013105 Bacteria 4062
118 Ga0157374_10005255 3300013296 Bacteria 10863
119 Ga0157374_10053642 3300013296 Bacteria 3759
120 Ga0157378_10000537 3300013297 Bacteria 36009
121 Ga0163162_10021902 3300013306 Bacteria 6296
122 Ga0163162_10054787 3300013306 Bacteria 4012
123 Ga0157372_10052402 3300013307 Unclassified 4543
124 Ga0157372_10107448 3300013307 Bacteria 3193
125 Ga0157375_10082624 3300013308 Bacteria 3255
126 Ga0163163_10011405 3300014325 Bacteria 8058
127 Ga0182008_10001046 3300014497 Bacteria 19199
128 Ga0157379_10121183 3300014968 Bacteria 2353
129 Ga0157376_10065212 3300014969 Bacteria 3074
130 Ga0182007_10039263 3300015262 Bacteria 1584
131 Ga0224569_100033 3300022732 Bacteria 8310
132 Ga0224571_100007 3300022734 Bacteria 5948
133 Ga0228598_1000003 3300024227 Bacteria 33664
134 Ga0228598_1002528 3300024227 Bacteria 3984
135 Ga0228598_1004879 3300024227 Bacteria 2826
136 Ga0228598_1008632 3300024227 Unclassified 2052
137 Ga0207692_10024019 3300025898 Bacteria 2828
138 Ga0207680_10112978 3300025903 Bacteria 1765
139 Ga0207645_10041306 3300025907 Bacteria 2953
140 Ga0207684_10000132 3300025910 Bacteria 134931
141 Ga0207684_10006688 3300025910 Bacteria 10476
142 Ga0207684_10044760 3300025910 Unclassified 3754
143 Ga0207684_10131422 3300025910 Bacteria 2148
144 Ga0207654_10007155 3300025911 Bacteria 5619
145 Ga0207654_10041442 3300025911 Unclassified 2600
146 Ga0207654_10309753 3300025911 Bacteria 1076
147 Ga0207707_10004957 3300025912 Bacteria 11702
148 Ga0207707_10046854 3300025912 Bacteria 3765
149 Ga0207695_10061826 3300025913 Unclassified 3869
150 Ga0207695_10077605 3300025913 Bacteria 3373
151 Ga0207693_10000140 3300025915 Bacteria 65993
152 Ga0207693_10001275 3300025915 Bacteria 22444
153 Ga0207693_10016159 3300025915 Bacteria 5970
154 Ga0207693_10032783 3300025915 Bacteria 4100
155 Ga0207663_10000470 3300025916 Bacteria 17512
156 Ga0207657_10008120 3300025919 Bacteria 10704
157 Ga0207652_10088777 3300025921 Bacteria 2713
158 Ga0207652_10373939 3300025921 Bacteria 1286
159 Ga0207646_10000301 3300025922 Bacteria 67088
160 Ga0207646_10075451 3300025922 Bacteria 3013
161 Ga0207694_10103098 3300025924 Bacteria 2262
162 Ga0207687_10023683 3300025927 Bacteria 4096
163 Ga0207687_10173249 3300025927 Bacteria 1666
164 Ga0207700_10000708 3300025928 Bacteria 19279
165 Ga0207700_10005034 3300025928 Bacteria 7861
166 Ga0207700_10015642 3300025928 Bacteria 5013
167 Ga0207700_10116741 3300025928 Bacteria 2157
168 Ga0207664_10000037 3300025929 Bacteria 171467
169 Ga0207664_10045539 3300025929 Bacteria 3441
170 Ga0207664_10097549 3300025929 Bacteria 2421
171 Ga0207664_10409583 3300025929 Bacteria 1207
172 Ga0207706_10001395 3300025933 Bacteria 24143
173 Ga0207686_10088088 3300025934 Bacteria 2043
174 Ga0207709_10090606 3300025935 Bacteria 1998
175 Ga0207665_10003741 3300025939 Bacteria 10160
176 Ga0207665_10009990 3300025939 Bacteria 6231
177 Ga0207665_10020712 3300025939 Unclassified 4323
178 Ga0207665_10020967 3300025939 Bacteria 4294
179 Ga0207711_10002093 3300025941 Bacteria 18016
180 Ga0207689_10091626 3300025942 Bacteria 2497
181 Ga0207661_10160317 3300025944 Bacteria 1951
182 Ga0207679_10147683 3300025945 Bacteria 1909
183 Ga0207679_10433332 3300025945 Bacteria 1163
184 Ga0207667_10002616 3300025949 Bacteria 22316
185 Ga0207667_10133038 3300025949 Bacteria 2562
186 Ga0207640_10028858 3300025981 Bacteria 3398
187 Ga0207677_10181646 3300026023 Unclassified 1655
188 Ga0207678_10008018 3300026067 Bacteria 9312
189 Ga0207702_10000396 3300026078 Bacteria 49721
190 Ga0207702_10036446 3300026078 Unclassified 4114
191 Ga0207702_10273129 3300026078 Bacteria 1595
192 Ga0207641_10082630 3300026088 Bacteria 2791
193 Ga0207674_10008756 3300026116 Bacteria 11651
194 Ga0207698_10375932 3300026142 Bacteria 1350
195 Ga0207698_10418135 3300026142 Unclassified 1286
196 Ga0265356_1002230 3300028017 Bacteria 2635
197 Ga0265338_10010154 3300028800 Bacteria 11102
198 Ga0265338_10019431 3300028800 Bacteria 7210
199 Ga0265762_1001493 3300030760 Bacteria 4245
200 Ga0265762_1015791 3300030760 Bacteria 1367
201 Ga0265760_10000172 3300031090 Bacteria 17165
202 Ga0265760_10000297 3300031090 Bacteria 13616
203 Ga0265760_10000517 3300031090 Bacteria 10806
204 Ga0265330_10013439 3300031235 Bacteria 3814
205 Ga0265330_10105674 3300031235 Bacteria 1204
206 Ga0265325_10001467 3300031241 Bacteria 16594
207 Ga0265325_10009257 3300031241 Bacteria 5759
208 Ga0265325_10075842 3300031241 Bacteria 1679
209 Ga0265340_10003583 3300031247 Bacteria 8734
210 Ga0265340_10003664 3300031247 Bacteria 8644
211 Ga0265340_10042490 3300031247 Bacteria 2232
212 Ga0265340_10057274 3300031247 Bacteria 1873
213 Ga0265339_10012917 3300031249 Bacteria 5075
214 Ga0265339_10028361 3300031249 Unclassified 3185
215 Ga0265339_10065706 3300031249 Bacteria 1944
216 Ga0265339_10071930 3300031249 Bacteria 1841
217 Ga0265331_10015756 3300031250 Bacteria 3983
218 Ga0265316_10034464 3300031344 Bacteria 4112
219 Ga0265316_10056677 3300031344 Bacteria 3059
220 Ga0265313_10008208 3300031595 Bacteria 6976
221 Ga0307405_10139266 3300031731 Bacteria 1689
222 Ga0307410_10053928 3300031852 Bacteria 2723
223 Ga0307410_10367914 3300031852 Bacteria 1153
224 Ga0307406_10004955 3300031901 Bacteria 7255
225 Ga0307416_100016957 3300032002 Bacteria 5080
226 Ga0307414_10406936 3300032004 Bacteria 1183
227 Ga0373923_0033296 3300035111 Unclassified 2086
228 Ga0373936_0001231 3300035113 Bacteria 9231
229 Ga0373945_0004459 3300035116 Unclassified 4451
230 Ga0373945_0035542 3300035116 Unclassified 1781
231 Ga0373953_0013596 3300035117 Bacteria 2909
232 Ga0373956_0076731 3300035119 Bacteria 1529
233 Ga0373943_0000148 3300035170 Bacteria 27189
234 Ga0373943_0031086 3300035170 Unclassified 2532
235 Ga0373955_0159240 3300035172 Bacteria 1331
236 Ga0373927_0001079 3300035695 Bacteria 20827
237 Ga0373933_0119656 3300035724 Unclassified 1648
238 Ga0373947_0003970 3300035725 Bacteria 8689
239 Ga0373947_0019312 3300035725 Bacteria 3929
240 Ga0373937_0038823 3300036401 Bacteria 4338
241 Ga0373937_0092179 3300036401 Unclassified 2808
242 Ga0373937_0101761 3300036401 Unclassified 2667
243 Ga0373937_0431148 3300036401 Unclassified 1251
244 Ga0373925_0001762 3300037068 Bacteria 18111
245 Ga0395898_0349870 3300037466 Unclassified 1409
246 Ga0395905_0019115 3300037471 Bacteria 6499
247 Ga0395905_0051872 3300037471 Bacteria 3842
248 Ga0395905_0072404 3300037471 Bacteria 3231
249 Ga0395905_0501548 3300037471 Bacteria 1114
250 Ga0436365_1801470 3300039437 Unclassified 2691
251 Ga0436360_1070654 3300039438 Bacteria 1117
252 Ga0466963_0083962 3300044694 Bacteria 2160
253 Ga0453684_0345277 3300044712 Unclassified 1680
254 Ga0451576_0160223 3300045051 Bacteria 2348
255 Ga0466967_0000691 3300045976 Bacteria 17142
256 Ga0495629_0007154 3300046459 Bacteria 8222
257 Ga0495580_0001908 3300046472 Bacteria 18328
258 Ga0495580_0002629 3300046472 Bacteria 15598
259 Ga0495580_0020619 3300046472 Bacteria 4875
260 Ga0495580_0020766 3300046472 Bacteria 4855
261 Ga0495584_0021047 3300046491 Bacteria 3312
262 Ga0495594_0062444 3300046499 Bacteria 2063
263 Ga0495630_0074087 3300046517 Bacteria 2564
264 Ga0495665_0041937 3300046531 Unclassified 2437
265 Ga0495635_0232796 3300046663 Bacteria 1244
266 Ga0495674_0018366 3300047319 Bacteria 6509
267 Ga0495674_0052176 3300047319 Unclassified 3600
268 Ga0495602_0121546 3300048088 Unclassified 2100
269 Ga0496100_0149911 3300048903 Bacteria 1662
270 Ga0496100_0246469 3300048903 Bacteria 1320
271 Ga0496103_0085733 3300048906 Bacteria 1985
272 Ga0496104_0453381 3300048907 Unclassified 1194
273 Ga0496106_0052201 3300048909 Bacteria 3084
274 Ga0496108_0275130 3300048911 Bacteria 1466
275 Ga0496110_0132113 3300048913 Bacteria 2255
276 Ga0496112_0080268 3300048915 Unclassified 3226
277 Ga0496112_0280366 3300048915 Unclassified 1614
278 Ga0496113_0030084 3300048916 Bacteria 3928
279 Ga0496114_0351465 3300048917 Bacteria 1304
280 Ga0501299_041864 3300049522 Bacteria 922
281 nmdc:mga0n895_111306_c1 3300050512 Bacteria 2754
282 Ga0265760_10007295
283 rootL2_10112714
284 Ga0070658_10231157
285 Ga0070676_10012358
286 Ga0070683_100027230
287 Ga0070683_100279867
288 Ga0070690_100028082
289 Ga0070666_10063052
290 Ga0070682_100042966
291 Ga0068868_100024003
292 Ga0068868_100031333
293 Ga0068868_100111828
294 Ga0070691_10013556
295 Ga0070661_100021722
296 Ga0070692_10111230
297 Ga0070668_100012553
298 Ga0070675_100146935
299 Ga0070673_100296169
300 Ga0070688_100219190
301 Ga0070667_100018255
302 Ga0070709_10000447
303 Ga0070709_10005564
304 Ga0070709_10015288
305 Ga0070709_10366611
306 Ga0070714_100126998
307 Ga0070713_100000352
308 Ga0070713_100000531
309 Ga0070713_100021637
310 Ga0070713_100168620
311 Ga0070710_10006851
312 Ga0070710_10035736
313 Ga0070711_100002479
314 Ga0070711_100016659
315 Ga0070711_100170200
316 Ga0070694_100126903
317 Ga0070708_100000729
318 Ga0070708_100048177
319 Ga0070708_100082095
320 Ga0070663_100007564
321 Ga0070662_100003109
322 Ga0070681_10008354
323 Ga0070681_10247802
324 Ga0068867_100060617
325 Ga0070706_100000410
326 Ga0070706_100023738
327 Ga0070706_100035465
328 Ga0070706_100039912
329 Ga0070707_100002005
330 Ga0070707_100135963
331 Ga0070698_100001258
332 Ga0070698_100023373
333 Ga0070698_100151471
334 Ga0070698_100213280
335 Ga0070699_100000621
336 Ga0070699_100029307
337 Ga0070699_100152396
338 Ga0070679_100032688
339 Ga0070679_100083112
340 Ga0070679_100189300
341 Ga0070679_100274462
342 Ga0070684_100028860
343 Ga0070697_100000258
344 Ga0070697_100015119
345 Ga0070697_100024037
346 Ga0070672_100129825
347 Ga0070693_100086539
348 Ga0070665_100123646
349 Ga0070704_100044427
350 Ga0070664_100019296
351 Ga0070664_100340980
352 Ga0068857_100018768
353 Ga0068854_100102418
354 Ga0068856_100001051
355 Ga0068856_100027514
356 Ga0068856_100243461
357 Ga0068863_100035398
358 Ga0068863_100138218
359 Ga0068863_100284330
360 Ga0068858_100292389
361 Ga0068860_100013082
362 Ga0068862_100013188
363 Ga0070717_10002067
364 Ga0070717_10002671
365 Ga0070717_10137396
366 Ga0070717_10221515
367 Ga0070717_10275907
368 Ga0070716_100030400
369 Ga0070716_100111635
370 Ga0070712_100000658
371 Ga0070712_100001245
372 Ga0097621_100001165
373 Ga0068871_100006358
374 Ga0068871_100025652
375 Ga0068871_100028063
376 Ga0075434_100389286
377 Ga0105240_10033323
378 Ga0105245_10012660
379 Ga0105245_10021336
380 Ga0105245_10033162
381 Ga0105245_10070837
382 Ga0105247_10018389
383 Ga0105247_10114209
384 Ga0114129_10057003
385 Ga0105243_10014631
386 Ga0105241_10007839
387 Ga0105241_10333676
388 Ga0105241_10423555
389 Ga0105242_10022323
390 Ga0105248_10004120
391 Ga0105248_10010043
392 Ga0105237_10254587
393 Ga0105238_10024994
394 Ga0105249_10019906
395 Ga0105239_10032342
396 Ga0157373_10150668
397 Ga0157371_10039203
398 Ga0157369_10061137
399 Ga0157374_10005255
400 Ga0157374_10053642
401 Ga0157378_10000537
402 Ga0163162_10021902
403 Ga0163162_10054787
404 Ga0157372_10052402
405 Ga0157372_10107448
406 Ga0157375_10082624
407 Ga0163163_10011405
408 Ga0182008_10001046
409 Ga0157379_10121183
410 Ga0157376_10065212
411 Ga0182007_10039263
412 Ga0224569_100033
413 Ga0224571_100007
414 Ga0228598_1000003
415 Ga0228598_1002528
416 Ga0228598_1004879
417 Ga0228598_1008632
418 Ga0207692_10024019
419 Ga0207680_10112978
420 Ga0207645_10041306
421 Ga0207684_10000132
422 Ga0207684_10006688
423 Ga0207684_10044760
424 Ga0207684_10131422
425 Ga0207654_10007155
426 Ga0207654_10041442
427 Ga0207654_10309753
428 Ga0207707_10004957
429 Ga0207707_10046854
430 Ga0207695_10061826
431 Ga0207695_10077605
432 Ga0207693_10000140
433 Ga0207693_10001275
434 Ga0207693_10016159
435 Ga0207693_10032783
436 Ga0207663_10000470
437 Ga0207657_10008120
438 Ga0207652_10088777
439 Ga0207652_10373939
440 Ga0207646_10000301
441 Ga0207646_10075451
442 Ga0207694_10103098
443 Ga0207687_10023683
444 Ga0207687_10173249
445 Ga0207700_10000708
446 Ga0207700_10005034
447 Ga0207700_10015642
448 Ga0207700_10116741
449 Ga0207664_10000037
450 Ga0207664_10045539
451 Ga0207664_10097549
452 Ga0207664_10409583
453 Ga0207706_10001395
454 Ga0207686_10088088
455 Ga0207709_10090606
456 Ga0207665_10003741
457 Ga0207665_10009990
458 Ga0207665_10020712
459 Ga0207665_10020967
460 Ga0207711_10002093
461 Ga0207689_10091626
462 Ga0207661_10160317
463 Ga0207679_10147683
464 Ga0207679_10433332
465 Ga0207667_10002616
466 Ga0207667_10133038
467 Ga0207640_10028858
468 Ga0207677_10181646
469 Ga0207678_10008018
470 Ga0207702_10000396
471 Ga0207702_10036446
472 Ga0207702_10273129
473 Ga0207641_10082630
474 Ga0207674_10008756
475 Ga0207698_10375932
476 Ga0207698_10418135
477 Ga0265356_1002230
478 Ga0265338_10010154
479 Ga0265338_10019431
480 Ga0265762_1001493
481 Ga0265762_1015791
482 Ga0265760_10000172
483 Ga0265760_10000297
484 Ga0265760_10000517
485 Ga0265330_10013439
486 Ga0265330_10105674
487 Ga0265325_10001467
488 Ga0265325_10009257
489 Ga0265325_10075842
490 Ga0265340_10003583
491 Ga0265340_10003664
492 Ga0265340_10042490
493 Ga0265340_10057274
494 Ga0265339_10012917
495 Ga0265339_10028361
496 Ga0265339_10065706
497 Ga0265339_10071930
498 Ga0265331_10015756
499 Ga0265316_10034464
500 Ga0265316_10056677
501 Ga0265313_10008208
502 Ga0307405_10139266
503 Ga0307410_10053928
504 Ga0307410_10367914
505 Ga0307406_10004955
506 Ga0307416_100016957
507 Ga0307414_10406936
508 Ga0373923_0033296
509 Ga0373936_0001231
510 Ga0373945_0004459
511 Ga0373945_0035542
512 Ga0373953_0013596
513 Ga0373956_0076731
514 Ga0373943_0000148
515 Ga0373943_0031086
516 Ga0373955_0159240
517 Ga0373927_0001079
518 Ga0373933_0119656
519 Ga0373947_0003970
520 Ga0373947_0019312
521 Ga0373937_0038823
522 Ga0373937_0092179
523 Ga0373937_0101761
524 Ga0373937_0431148
525 Ga0373925_0001762
526 Ga0395898_0349870
527 Ga0395905_0019115
528 Ga0395905_0051872
529 Ga0395905_0072404
530 Ga0395905_0501548
531 Ga0436365_1801470
532 Ga0436360_1070654
533 Ga0466963_0083962
534 Ga0453684_0345277
535 Ga0451576_0160223
536 Ga0466967_0000691
537 Ga0495629_0007154
538 Ga0495580_0001908
539 Ga0495580_0002629
540 Ga0495580_0020619
541 Ga0495580_0020766
542 Ga0495584_0021047
543 Ga0495594_0062444
544 Ga0495630_0074087
545 Ga0495665_0041937
546 Ga0495635_0232796
547 Ga0495674_0018366
548 Ga0495674_0052176
549 Ga0495602_0121546
550 Ga0496100_0149911
551 Ga0496100_0246469
552 Ga0496103_0085733
553 Ga0496104_0453381
554 Ga0496106_0052201
555 Ga0496108_0275130
556 Ga0496110_0132113
557 Ga0496112_0080268
558 Ga0496112_0280366
559 Ga0496113_0030084
560 Ga0496114_0351465
561 Ga0501299_041864
562 nmdc:mga0n895_111306_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00899

ThiF

ThiF family

61

300

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zud-assembly3.cif.gz_1 structure of this-thif protein complex 0.9443 19 264
1jwa-assembly1.cif.gz_B-2 structure of the atp-bound moeb-moad protein complex 0.944 19 252
1zkm-assembly2.cif.gz_D structural analysis of escherichia coli thif 0.942 19 264
1zfn-assembly1.cif.gz_B structural analysis of escherichia coli thif 0.9394 19 264
1zfn-assembly1.cif.gz_A structural analysis of escherichia coli thif 0.9354 19 264
ID Description Score Start End Superfamily
af_L7N674_15_263_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9457 19 264 3.40.50.720
1zkmD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.942 19 264 3.40.50.720
af_O44510_10_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9362 20 264 3.40.50.720
af_P9WM11_85_248_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.936 22 168 3.40.50.720
af_Q2FVX7_2_246_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.933 22 264 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3C0GNI2-F1-model_v4 Molybdopterin biosynthesis protein MoeB 0.9857 22 164 GO:0004792
GO:0005524
GO:0005829
GO:0008146
GO:0008641
GO:0016779
AF-A0A2V9HWS4-F1-model_v4 Thiamine biosynthesis protein ThiF 0.9842 31 188 GO:0008641
GO:0016020
GO:0061503
GO:0061504
AF-A0A3L7WIQ3-F1-model_v4 HesA/MoeB/ThiF family protein 0.9807 20 162 GO:0004792
GO:0005829
GO:0008146
GO:0008641
GO:0016779
AF-A0A3D2REG5-F1-model_v4 Molybdopterin biosynthesis protein MoeB 0.9804 20 155 GO:0004792
GO:0005524
GO:0005829
GO:0008146
GO:0008641
GO:0016779
AF-A0A3C0FBK2-F1-model_v4 THIF-type NAD/FAD binding fold domain-containing protein 0.98 19 159 GO:0004792
GO:0005829
GO:0008146
GO:0008641
GO:0016779

Map