F384333
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 281 | 175 | 281 | 178 |
Family's Representative Sequence
| Representative Sequence | 3300025922|Ga0207646_11042421|Ga0207646_110424211 |
| Length | 191 |
| Sequence | MLATMARPRRRKAAPVFNATAPATVSRSALLVEGSDAEFRGLIHDLIAYGHRLDTCRDAFAAIVGISGAQYEILMLVSRAAGLLSVGEVATRLHRSGAFITIEANKLVASGTLEKVGDPSDGRRVLLRANQRSRELLERLAPFQRRVNDQLFERLDAKRFRQLRALARDLVESGDRAVAMLEFMLHDSKAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 104 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 106 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 107 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 108 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 109 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 110 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 111 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 112 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 113 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 114 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 115 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 116 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 117 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 119 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 120 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 121 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 124 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 125 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 126 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 127 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 128 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 129 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 130 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 131 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 143 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 156 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 173 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 174 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 175 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 99.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10045929 | 3300003203 | Bacteria | 1500 |
| 2 | Ga0070683_100042288 | 3300005329 | Bacteria | 4196 |
| 3 | Ga0070690_100167034 | 3300005330 | Unclassified | 1512 |
| 4 | Ga0070690_100534461 | 3300005330 | Bacteria | 882 |
| 5 | Ga0070670_100461826 | 3300005331 | Bacteria | 1126 |
| 6 | Ga0070677_10280855 | 3300005333 | Bacteria | 839 |
| 7 | Ga0068869_100367271 | 3300005334 | Bacteria | 1176 |
| 8 | Ga0070680_100055213 | 3300005336 | Bacteria | 3246 |
| 9 | Ga0070680_100258838 | 3300005336 | Bacteria | 1472 |
| 10 | Ga0070689_100201714 | 3300005340 | Bacteria | 1625 |
| 11 | Ga0070689_101085623 | 3300005340 | Bacteria | 715 |
| 12 | Ga0070691_10151974 | 3300005341 | Bacteria | 1188 |
| 13 | Ga0070691_10368484 | 3300005341 | Unclassified | 802 |
| 14 | Ga0070687_100025005 | 3300005343 | Bacteria | 2859 |
| 15 | Ga0070692_10032296 | 3300005345 | Bacteria | 2631 |
| 16 | Ga0070692_10060092 | 3300005345 | Bacteria | 2000 |
| 17 | Ga0070668_100071747 | 3300005347 | Bacteria | 2698 |
| 18 | Ga0070669_100014122 | 3300005353 | Bacteria | 5682 |
| 19 | Ga0070675_100020836 | 3300005354 | Bacteria | 5233 |
| 20 | Ga0070674_100253450 | 3300005356 | Bacteria | 1383 |
| 21 | Ga0070703_10179962 | 3300005406 | Unclassified | 816 |
| 22 | Ga0070701_10274061 | 3300005438 | Bacteria | 1028 |
| 23 | Ga0070705_100041801 | 3300005440 | Bacteria | 2616 |
| 24 | Ga0070705_100050414 | 3300005440 | Bacteria | 2422 |
| 25 | Ga0070700_100101004 | 3300005441 | Bacteria | 1900 |
| 26 | Ga0070700_100270384 | 3300005441 | Bacteria | 1228 |
| 27 | Ga0070694_100012277 | 3300005444 | Bacteria | 5322 |
| 28 | Ga0070694_100049141 | 3300005444 | Bacteria | 2840 |
| 29 | Ga0070694_100100831 | 3300005444 | Bacteria | 2042 |
| 30 | Ga0070694_100101031 | 3300005444 | Bacteria | 2040 |
| 31 | Ga0070694_100248932 | 3300005444 | Bacteria | 1343 |
| 32 | Ga0070694_100789038 | 3300005444 | Bacteria | 778 |
| 33 | Ga0070662_100421599 | 3300005457 | Bacteria | 1104 |
| 34 | Ga0070681_10019103 | 3300005458 | Bacteria | 6859 |
| 35 | Ga0068867_100142893 | 3300005459 | Bacteria | 1872 |
| 36 | Ga0068867_100755594 | 3300005459 | Bacteria | 863 |
| 37 | Ga0070685_10115682 | 3300005466 | Unclassified | 1659 |
| 38 | Ga0070706_100240357 | 3300005467 | Bacteria | 1691 |
| 39 | Ga0070699_100005634 | 3300005518 | Bacteria | 10978 |
| 40 | Ga0070699_100142047 | 3300005518 | Bacteria | 2121 |
| 41 | Ga0070679_100076603 | 3300005530 | Bacteria | 3334 |
| 42 | Ga0070684_100055636 | 3300005535 | Bacteria | 3450 |
| 43 | Ga0070697_100012545 | 3300005536 | Bacteria | 6638 |
| 44 | Ga0070697_100251771 | 3300005536 | Bacteria | 1511 |
| 45 | Ga0070672_100688331 | 3300005543 | Bacteria | 895 |
| 46 | Ga0070686_100087056 | 3300005544 | Unclassified | 2081 |
| 47 | Ga0070686_100106534 | 3300005544 | Bacteria | 1903 |
| 48 | Ga0070686_100213855 | 3300005544 | Bacteria | 1389 |
| 49 | Ga0070695_100005735 | 3300005545 | Bacteria | 7314 |
| 50 | Ga0070695_100076917 | 3300005545 | Bacteria | 2198 |
| 51 | Ga0070695_100192649 | 3300005545 | Bacteria | 1452 |
| 52 | Ga0070696_100038920 | 3300005546 | Bacteria | 3284 |
| 53 | Ga0070696_100083734 | 3300005546 | Bacteria | 2262 |
| 54 | Ga0070696_101002793 | 3300005546 | Unclassified | 698 |
| 55 | Ga0070693_100403141 | 3300005547 | Unclassified | 949 |
| 56 | Ga0070704_100100661 | 3300005549 | Bacteria | 2176 |
| 57 | Ga0070704_100159136 | 3300005549 | Bacteria | 1784 |
| 58 | Ga0070704_100699805 | 3300005549 | Unclassified | 898 |
| 59 | Ga0070704_100949114 | 3300005549 | Bacteria | 776 |
| 60 | Ga0068857_100201243 | 3300005577 | Unclassified | 1816 |
| 61 | Ga0070702_100054392 | 3300005615 | Bacteria | 2303 |
| 62 | Ga0070702_100117477 | 3300005615 | Bacteria | 1659 |
| 63 | Ga0070702_100357339 | 3300005615 | Unclassified | 1031 |
| 64 | Ga0068859_100563051 | 3300005617 | Bacteria | 1234 |
| 65 | Ga0068859_100924200 | 3300005617 | Bacteria | 956 |
| 66 | Ga0068866_10045921 | 3300005718 | Bacteria | 2194 |
| 67 | Ga0068861_100012712 | 3300005719 | Bacteria | 5874 |
| 68 | Ga0068870_10094799 | 3300005840 | Bacteria | 1676 |
| 69 | Ga0068863_101253486 | 3300005841 | Bacteria | 748 |
| 70 | Ga0068862_100003371 | 3300005844 | Bacteria | 13778 |
| 71 | Ga0068862_100484244 | 3300005844 | Unclassified | 1171 |
| 72 | Ga0081538_10202990 | 3300005981 | Unclassified | 811 |
| 73 | Ga0081539_10000332 | 3300005985 | Bacteria | 104677 |
| 74 | Ga0070715_10126359 | 3300006163 | Bacteria | 1225 |
| 75 | Ga0070716_100719227 | 3300006173 | Bacteria | 765 |
| 76 | Ga0097621_100006938 | 3300006237 | Bacteria | 8063 |
| 77 | Ga0068871_100003199 | 3300006358 | Bacteria | 11236 |
| 78 | Ga0075428_100006591 | 3300006844 | Bacteria | 12915 |
| 79 | Ga0075428_100064509 | 3300006844 | Bacteria | 4011 |
| 80 | Ga0075430_100002769 | 3300006846 | Bacteria | 14650 |
| 81 | Ga0075430_100040813 | 3300006846 | Bacteria | 3927 |
| 82 | Ga0075431_100045926 | 3300006847 | Bacteria | 4503 |
| 83 | Ga0075431_100095401 | 3300006847 | Bacteria | 3070 |
| 84 | Ga0075431_101145860 | 3300006847 | Unclassified | 741 |
| 85 | Ga0075433_10124583 | 3300006852 | Unclassified | 2289 |
| 86 | Ga0075433_11107018 | 3300006852 | Unclassified | 689 |
| 87 | Ga0075433_11158084 | 3300006852 | Bacteria | 672 |
| 88 | Ga0075434_100000283 | 3300006871 | Bacteria | 36124 |
| 89 | Ga0075434_100070720 | 3300006871 | Bacteria | 3480 |
| 90 | Ga0075434_100261838 | 3300006871 | Unclassified | 1748 |
| 91 | Ga0075429_100025168 | 3300006880 | Bacteria | 5166 |
| 92 | Ga0075429_100329758 | 3300006880 | Bacteria | 1335 |
| 93 | Ga0068865_100014208 | 3300006881 | Bacteria | 5054 |
| 94 | Ga0075436_100001164 | 3300006914 | Bacteria | 17802 |
| 95 | Ga0075436_100014023 | 3300006914 | Bacteria | 5485 |
| 96 | Ga0075436_100071099 | 3300006914 | Bacteria | 2406 |
| 97 | Ga0075436_100080027 | 3300006914 | Unclassified | 2264 |
| 98 | Ga0097620_100563102 | 3300006931 | Bacteria | 1234 |
| 99 | Ga0097620_100924173 | 3300006931 | Bacteria | 956 |
| 100 | Ga0075435_100063066 | 3300007076 | Bacteria | 3010 |
| 101 | Ga0075435_100202236 | 3300007076 | Bacteria | 1683 |
| 102 | Ga0075435_100395081 | 3300007076 | Bacteria | 1189 |
| 103 | Ga0111539_10012682 | 3300009094 | Bacteria | 10557 |
| 104 | Ga0111539_10206496 | 3300009094 | Bacteria | 2289 |
| 105 | Ga0114129_10056966 | 3300009147 | Bacteria | 5471 |
| 106 | Ga0114129_10351377 | 3300009147 | Bacteria | 1953 |
| 107 | Ga0114129_11036222 | 3300009147 | Unclassified | 1031 |
| 108 | Ga0105243_10046102 | 3300009148 | Bacteria | 3427 |
| 109 | Ga0105249_10238672 | 3300009553 | Bacteria | 1796 |
| 110 | Ga0157369_10222230 | 3300013105 | Bacteria | 1977 |
| 111 | Ga0157380_10047659 | 3300014326 | Bacteria | 3372 |
| 112 | Ga0157376_10081689 | 3300014969 | Unclassified | 2775 |
| 113 | Ga0207682_10031294 | 3300025893 | Bacteria | 2135 |
| 114 | Ga0207642_10031384 | 3300025899 | Bacteria | 2225 |
| 115 | Ga0207688_10059509 | 3300025901 | Bacteria | 2152 |
| 116 | Ga0207680_10216031 | 3300025903 | Unclassified | 1313 |
| 117 | Ga0207685_10224066 | 3300025905 | Unclassified | 896 |
| 118 | Ga0207685_10266761 | 3300025905 | Bacteria | 834 |
| 119 | Ga0207643_10010297 | 3300025908 | Bacteria | 5031 |
| 120 | Ga0207684_10150012 | 3300025910 | Bacteria | 2006 |
| 121 | Ga0207707_10116744 | 3300025912 | Bacteria | 2332 |
| 122 | Ga0207660_10029306 | 3300025917 | Bacteria | 3774 |
| 123 | Ga0207660_10070682 | 3300025917 | Bacteria | 2538 |
| 124 | Ga0207660_10373134 | 3300025917 | Bacteria | 1146 |
| 125 | Ga0207660_10895251 | 3300025917 | Bacteria | 724 |
| 126 | Ga0207662_10585898 | 3300025918 | Unclassified | 775 |
| 127 | Ga0207662_10610326 | 3300025918 | Bacteria | 760 |
| 128 | Ga0207652_10288608 | 3300025921 | Bacteria | 1480 |
| 129 | Ga0207652_11287215 | 3300025921 | Bacteria | 634 |
| 130 | Ga0207646_11042421 | 3300025922 | Bacteria | 721 |
| 131 | Ga0207681_10002576 | 3300025923 | Bacteria | 11497 |
| 132 | Ga0207681_10249953 | 3300025923 | Bacteria | 1384 |
| 133 | Ga0207650_10466465 | 3300025925 | Bacteria | 1052 |
| 134 | Ga0207659_10040969 | 3300025926 | Bacteria | 3242 |
| 135 | Ga0207709_10029611 | 3300025935 | Bacteria | 3178 |
| 136 | Ga0207670_10073521 | 3300025936 | Bacteria | 2371 |
| 137 | Ga0207670_10185168 | 3300025936 | Bacteria | 1571 |
| 138 | Ga0207670_10808440 | 3300025936 | Bacteria | 781 |
| 139 | Ga0207669_10144239 | 3300025937 | Bacteria | 1658 |
| 140 | Ga0207669_10189982 | 3300025937 | Bacteria | 1481 |
| 141 | Ga0207704_10011437 | 3300025938 | Bacteria | 4370 |
| 142 | Ga0207665_10147189 | 3300025939 | Bacteria | 1684 |
| 143 | Ga0207691_10217754 | 3300025940 | Bacteria | 1656 |
| 144 | Ga0207689_10047407 | 3300025942 | Bacteria | 3548 |
| 145 | Ga0207661_10091921 | 3300025944 | Bacteria | 2529 |
| 146 | Ga0207651_10151008 | 3300025960 | Unclassified | 1808 |
| 147 | Ga0207712_10035229 | 3300025961 | Bacteria | 3398 |
| 148 | Ga0207668_10183497 | 3300025972 | Bacteria | 1652 |
| 149 | Ga0207703_10231505 | 3300026035 | Unclassified | 1657 |
| 150 | Ga0207708_10012792 | 3300026075 | Bacteria | 6259 |
| 151 | Ga0207708_10158350 | 3300026075 | Bacteria | 1787 |
| 152 | Ga0207708_10489309 | 3300026075 | Bacteria | 1030 |
| 153 | Ga0207648_10024176 | 3300026089 | Bacteria | 5428 |
| 154 | Ga0207674_10400911 | 3300026116 | Bacteria | 1326 |
| 155 | Ga0207675_100025078 | 3300026118 | Bacteria | 5549 |
| 156 | Ga0207683_10370452 | 3300026121 | Bacteria | 1316 |
| 157 | Ga0209969_1048028 | 3300027360 | Unclassified | 668 |
| 158 | Ga0210000_1010816 | 3300027462 | Bacteria | 1350 |
| 159 | Ga0209970_1009461 | 3300027614 | Bacteria | 1592 |
| 160 | Ga0209971_1005499 | 3300027682 | Bacteria | 3007 |
| 161 | Ga0207428_10088584 | 3300027907 | Bacteria | 2407 |
| 162 | Ga0268265_10001655 | 3300028380 | Bacteria | 18241 |
| 163 | Ga0268265_10081790 | 3300028380 | Bacteria | 2551 |
| 164 | Ga0307408_100235902 | 3300031548 | Bacteria | 1501 |
| 165 | Ga0307408_100251959 | 3300031548 | Bacteria | 1457 |
| 166 | Ga0307405_10610662 | 3300031731 | Bacteria | 891 |
| 167 | Ga0307406_10532579 | 3300031901 | Bacteria | 958 |
| 168 | Ga0307416_100028157 | 3300032002 | Bacteria | 4175 |
| 169 | Ga0307416_100463209 | 3300032002 | Bacteria | 1323 |
| 170 | Ga0307416_100747014 | 3300032002 | Bacteria | 1071 |
| 171 | Ga0307416_100919968 | 3300032002 | Bacteria | 975 |
| 172 | Ga0307411_10419432 | 3300032005 | Bacteria | 1111 |
| 173 | Ga0307415_100213033 | 3300032126 | Bacteria | 1543 |
| 174 | Ga0373930_0049354 | 3300034816 | Unclassified | 915 |
| 175 | Ga0373934_0118189 | 3300035086 | Bacteria | 1077 |
| 176 | Ga0373941_0006559 | 3300035115 | Bacteria | 2811 |
| 177 | Ga0373954_0000071 | 3300035118 | Bacteria | 36140 |
| 178 | Ga0373956_0080109 | 3300035119 | Bacteria | 1498 |
| 179 | Ga0373960_0063211 | 3300035121 | Bacteria | 1128 |
| 180 | Ga0373960_0164557 | 3300035121 | Unclassified | 766 |
| 181 | Ga0373942_0026790 | 3300035207 | Bacteria | 1495 |
| 182 | Ga0373961_0140413 | 3300035241 | Unclassified | 816 |
| 183 | Ga0373961_0155915 | 3300035241 | Unclassified | 781 |
| 184 | Ga0373931_0074490 | 3300035691 | Bacteria | 1860 |
| 185 | Ga0373933_0005400 | 3300035724 | Bacteria | 6954 |
| 186 | Ga0373937_0000282 | 3300036401 | Bacteria | 48656 |
| 187 | Ga0373925_0802741 | 3300037068 | Unclassified | 776 |
| 188 | Ga0439453_0002655 | 3300041408 | Bacteria | 2489 |
| 189 | Ga0451853_3178932 | 3300041512 | Archaea | 752 |
| 190 | Ga0439446_0097808 | 3300042156 | Bacteria | 925 |
| 191 | Ga0439435_0000449 | 3300042436 | Bacteria | 6473 |
| 192 | Ga0439444_0003317 | 3300042437 | Bacteria | 2268 |
| 193 | Ga0439460_0001182 | 3300042461 | Bacteria | 6135 |
| 194 | Ga0466968_0537664 | 3300044735 | Bacteria | 585 |
| 195 | Ga0451576_0235516 | 3300045051 | Bacteria | 1912 |
| 196 | Ga0495592_0252527 | 3300046454 | Bacteria | 1165 |
| 197 | Ga0495642_0022061 | 3300046528 | Bacteria | 2507 |
| 198 | Ga0495621_0087474 | 3300046539 | Bacteria | 1170 |
| 199 | Ga0495667_0079091 | 3300046559 | Bacteria | 2138 |
| 200 | Ga0495659_0030730 | 3300046664 | Bacteria | 1871 |
| 201 | Ga0495669_0088228 | 3300046684 | Bacteria | 1430 |
| 202 | Ga0495604_0211833 | 3300047317 | Bacteria | 1339 |
| 203 | Ga0495636_0022184 | 3300047318 | Bacteria | 2565 |
| 204 | Ga0495675_0719969 | 3300047444 | Bacteria | 558 |
| 205 | Ga0495677_0337026 | 3300047445 | Unclassified | 595 |
| 206 | Ga0495602_0281783 | 3300048088 | Bacteria | 1224 |
| 207 | Ga0501300_056930 | 3300049523 | Bacteria | 613 |
| 208 | Ga0501033_0354573 | 3300049570 | Bacteria | 1027 |
| 209 | Ga0501036_0273362 | 3300049572 | Bacteria | 1414 |
| 210 | Ga0501036_0481887 | 3300049572 | Bacteria | 1033 |
| 211 | Ga0501039_0052841 | 3300049575 | Bacteria | 3143 |
| 212 | Ga0501039_0104231 | 3300049575 | Bacteria | 2214 |
| 213 | Ga0501040_0059121 | 3300049576 | Bacteria | 2633 |
| 214 | Ga0501040_0137878 | 3300049576 | Bacteria | 1718 |
| 215 | Ga0501040_0253854 | 3300049576 | Unclassified | 1254 |
| 216 | Ga0501040_0322459 | 3300049576 | Bacteria | 1105 |
| 217 | Ga0501041_0026338 | 3300049577 | Bacteria | 3497 |
| 218 | Ga0501041_0056813 | 3300049577 | Bacteria | 2392 |
| 219 | Ga0501041_0070304 | 3300049577 | Bacteria | 2148 |
| 220 | Ga0501042_0012409 | 3300049578 | Bacteria | 5772 |
| 221 | Ga0501042_0167971 | 3300049578 | Unclassified | 1583 |
| 222 | Ga0501042_0239126 | 3300049578 | Bacteria | 1310 |
| 223 | Ga0501042_0503765 | 3300049578 | Bacteria | 879 |
| 224 | Ga0501043_0170924 | 3300049579 | Bacteria | 1696 |
| 225 | Ga0501048_0431214 | 3300049582 | Unclassified | 943 |
| 226 | Ga0501048_0727326 | 3300049582 | Unclassified | 713 |
| 227 | Ga0501048_1203212 | 3300049582 | Bacteria | 545 |
| 228 | Ga0501067_0195337 | 3300049583 | Bacteria | 1127 |
| 229 | Ga0501071_0039634 | 3300049587 | Bacteria | 3370 |
| 230 | Ga0501072_0131172 | 3300049588 | Bacteria | 1997 |
| 231 | Ga0501072_0891107 | 3300049588 | Unclassified | 695 |
| 232 | Ga0501072_1239474 | 3300049588 | Unclassified | 579 |
| 233 | Ga0501075_0066715 | 3300049591 | Bacteria | 2715 |
| 234 | Ga0501076_0169767 | 3300049592 | Bacteria | 1778 |
| 235 | Ga0501077_0171877 | 3300049593 | Unclassified | 1377 |
| 236 | Ga0501077_0462791 | 3300049593 | Bacteria | 812 |
| 237 | Ga0501079_0005830 | 3300049741 | Bacteria | 9210 |
| 238 | Ga0501079_0548500 | 3300049741 | Unclassified | 909 |
| 239 | Ga0501079_0635635 | 3300049741 | Unclassified | 840 |
| 240 | Ga0501080_0550063 | 3300049742 | Bacteria | 1028 |
| 241 | Ga0501080_0691306 | 3300049742 | Bacteria | 900 |
| 242 | Ga0501081_0025257 | 3300049743 | Bacteria | 3995 |
| 243 | Ga0501081_0044699 | 3300049743 | Bacteria | 3041 |
| 244 | Ga0501035_0377527 | 3300049822 | Bacteria | 1183 |
| 245 | Ga0501035_0957179 | 3300049822 | Unclassified | 675 |
| 246 | Ga0501045_0191056 | 3300049824 | Bacteria | 1526 |
| 247 | Ga0501045_0758342 | 3300049824 | Unclassified | 715 |
| 248 | nmdc:mga05p37_885895_c1 | 3300050507 | Bacteria | 964 |
| 249 | nmdc:mga09592_750976_c1 | 3300050508 | Bacteria | 828 |
| 250 | nmdc:mga0qj67_206695_c1 | 3300050509 | Bacteria | 1595 |
| 251 | nmdc:mga0qj67_2300_c1 | 3300050509 | Bacteria | 13583 |
| 252 | nmdc:mga0qj67_2525_c1 | 3300050509 | Bacteria | 13071 |
| 253 | nmdc:mga0qj67_397856_c1 | 3300050509 | Bacteria | 1112 |
| 254 | nmdc:mga06r32_1036438_c1 | 3300050510 | Bacteria | 772 |
| 255 | nmdc:mga06r32_117280_c1 | 3300050510 | Bacteria | 2624 |
| 256 | nmdc:mga06r32_54138_c1 | 3300050510 | Bacteria | 3847 |
| 257 | nmdc:mga08y16_206648_c1 | 3300050511 | Unclassified | 2034 |
| 258 | nmdc:mga08y16_212446_c1 | 3300050511 | Bacteria | 2004 |
| 259 | nmdc:mga08y16_43153_c1 | 3300050511 | Bacteria | 4725 |
| 260 | nmdc:mga08y16_48515_c1 | 3300050511 | Bacteria | 4444 |
| 261 | nmdc:mga0n895_1714_c1 | 3300050512 | Bacteria | 16563 |
| 262 | nmdc:mga0n895_274516_c1 | 3300050512 | Unclassified | 1710 |
| 263 | nmdc:mga0n895_51389_c1 | 3300050512 | Bacteria | 4044 |
| 264 | nmdc:mga0rr50_148540_c1 | 3300050513 | Unclassified | 1892 |
| 265 | nmdc:mga0rr50_40585_c1 | 3300050513 | Bacteria | 3385 |
| 266 | nmdc:mga0rr50_518920_c1 | 3300050513 | Unclassified | 1014 |
| 267 | nmdc:mga08x19_17437_c1 | 3300050514 | Bacteria | 4392 |
| 268 | nmdc:mga08x19_1750_c1 | 3300050514 | Bacteria | 13388 |
| 269 | nmdc:mga08x19_17858_c1 | 3300050514 | Bacteria | 4343 |
| 270 | nmdc:mga08x19_7149_c1 | 3300050514 | Bacteria | 6629 |
| 271 | nmdc:mga0a205_136695_c1 | 3300050515 | Bacteria | 2351 |
| 272 | nmdc:mga0a205_7705_c1 | 3300050515 | Bacteria | 9768 |
| 273 | nmdc:mga0a205_987315_c1 | 3300050515 | Unclassified | 689 |
| 274 | Ga0501084_0050524 | 3300054114 | Bacteria | 3480 |
| 275 | Ga0590071_005901 | 3300059421 | Bacteria | 2936 |
| 276 | Ga0590074_032481 | 3300059423 | Bacteria | 925 |
| 277 | Ga0590077_043249 | 3300059426 | Bacteria | 1004 |
| 278 | Ga0590077_097168 | 3300059426 | Unclassified | 687 |
| 279 | Ga0590077_106111 | 3300059426 | Bacteria | 659 |
| 280 | Ga0530510_0028411 | 3300061734 | Bacteria | 4010 |
| 281 | Ga0530510_1126013 | 3300061734 | Bacteria | 601 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049593 | Ga0501077_0171877 | Ga0501077_0171877_11_478 | 155 |
| 2 | 3300050515 | nmdc:mga0a205_136695_c1 | nmdc:mga0a205_136695_c1_1507_2040 | 159 |
| 3 | 3300049576 | Ga0501040_0322459 | Ga0501040_0322459_46_528 | 160 |
| 4 | 3300049822 | Ga0501035_0957179 | Ga0501035_0957179_152_634 | 160 |
| 5 | 3300006852 | Ga0075433_10124583 | Ga0075433_101245834 | 161 |
| 6 | 3300006914 | Ga0075436_100080027 | Ga0075436_1000800272 | 161 |
| 7 | 3300044735 | Ga0466968_0537664 | Ga0466968_0537664_25_510 | 161 |
| 8 | 3300050514 | nmdc:mga08x19_17858_c1 | nmdc:mga08x19_17858_c1_1731_2270 | 161 |
| 9 | 3300047444 | Ga0495675_0719969 | Ga0495675_0719969_29_532 | 166 |
| 10 | 3300049523 | Ga0501300_056930 | Ga0501300_056930_100_600 | 166 |
| 11 | 3300049582 | Ga0501048_1203212 | Ga0501048_1203212_30_533 | 166 |
| 12 | 3300049588 | Ga0501072_1239474 | Ga0501072_1239474_62_565 | 166 |
| 13 | 3300059421 | Ga0590071_005901 | Ga0590071_005901_1504_2013 | 168 |
| 14 | 3300059423 | Ga0590074_032481 | Ga0590074_032481_166_675 | 168 |
| 15 | 3300059426 | Ga0590077_043249 | Ga0590077_043249_198_707 | 168 |
| 16 | 3300005459 | Ga0068867_100755594 | Ga0068867_1007555942 | 170 |
| 17 | 3300035121 | Ga0373960_0063211 | Ga0373960_0063211_12_530 | 170 |
| 18 | 3300032002 | Ga0307416_100463209 | Ga0307416_1004632092 | 172 |
| 19 | 3300049741 | Ga0501079_0548500 | Ga0501079_0548500_155_673 | 172 |
| 20 | 3300006163 | Ga0070715_10126359 | Ga0070715_101263592 | 173 |
| 21 | 3300025905 | Ga0207685_10266761 | Ga0207685_102667612 | 173 |
| 22 | 3300005341 | Ga0070691_10151974 | Ga0070691_101519742 | 174 |
| 23 | 3300005438 | Ga0070701_10274061 | Ga0070701_102740611 | 174 |
| 24 | 3300005440 | Ga0070705_100050414 | Ga0070705_1000504142 | 174 |
| 25 | 3300005444 | Ga0070694_100100831 | Ga0070694_1001008314 | 174 |
| 26 | 3300005444 | Ga0070694_100101031 | Ga0070694_1001010314 | 174 |
| 27 | 3300005544 | Ga0070686_100213855 | Ga0070686_1002138552 | 174 |
| 28 | 3300005545 | Ga0070695_100076917 | Ga0070695_1000769174 | 174 |
| 29 | 3300005546 | Ga0070696_100038920 | Ga0070696_1000389202 | 174 |
| 30 | 3300005546 | Ga0070696_100083734 | Ga0070696_1000837341 | 174 |
| 31 | 3300005615 | Ga0070702_100054392 | Ga0070702_1000543922 | 174 |
| 32 | 3300005841 | Ga0068863_101253486 | Ga0068863_1012534862 | 174 |
| 33 | 3300006852 | Ga0075433_11107018 | Ga0075433_111070182 | 174 |
| 34 | 3300007076 | Ga0075435_100395081 | Ga0075435_1003950812 | 174 |
| 35 | 3300009094 | Ga0111539_10012682 | Ga0111539_100126824 | 174 |
| 36 | 3300041512 | Ga0451853_3178932 | Ga0451853_3178932_159_683 | 174 |
| 37 | 3300050508 | nmdc:mga09592_750976_c1 | nmdc:mga09592_750976_c1_84_608 | 174 |
| 38 | 3300050511 | nmdc:mga08y16_43153_c1 | nmdc:mga08y16_43153_c1_54_578 | 174 |
| 39 | 3300050515 | nmdc:mga0a205_987315_c1 | nmdc:mga0a205_987315_c1_105_629 | 174 |
| 40 | 3300027360 | Ga0209969_1048028 | Ga0209969_10480281 | 175 |
| 41 | 3300005340 | Ga0070689_100201714 | Ga0070689_1002017141 | 176 |
| 42 | 3300005356 | Ga0070674_100253450 | Ga0070674_1002534502 | 176 |
| 43 | 3300005406 | Ga0070703_10179962 | Ga0070703_101799622 | 176 |
| 44 | 3300005440 | Ga0070705_100041801 | Ga0070705_1000418013 | 176 |
| 45 | 3300005444 | Ga0070694_100012277 | Ga0070694_1000122773 | 176 |
| 46 | 3300005544 | Ga0070686_100106534 | Ga0070686_1001065342 | 176 |
| 47 | 3300005549 | Ga0070704_100159136 | Ga0070704_1001591361 | 176 |
| 48 | 3300005617 | Ga0068859_100563051 | Ga0068859_1005630512 | 176 |
| 49 | 3300006931 | Ga0097620_100563102 | Ga0097620_1005631022 | 176 |
| 50 | 3300025917 | Ga0207660_10070682 | Ga0207660_100706823 | 176 |
| 51 | 3300025917 | Ga0207660_10895251 | Ga0207660_108952511 | 176 |
| 52 | 3300025936 | Ga0207670_10185168 | Ga0207670_101851681 | 176 |
| 53 | 3300025937 | Ga0207669_10189982 | Ga0207669_101899823 | 176 |
| 54 | 3300047318 | Ga0495636_0022184 | Ga0495636_0022184_1638_2171 | 176 |
| 55 | 3300049582 | Ga0501048_0727326 | Ga0501048_0727326_17_553 | 176 |
| 56 | 3300059426 | Ga0590077_097168 | Ga0590077_097168_113_649 | 176 |
| 57 | 3300059426 | Ga0590077_106111 | Ga0590077_106111_107_637 | 176 |
| 58 | 3300005329 | Ga0070683_100042288 | Ga0070683_1000422882 | 177 |
| 59 | 3300005330 | Ga0070690_100167034 | Ga0070690_1001670342 | 177 |
| 60 | 3300005330 | Ga0070690_100534461 | Ga0070690_1005344611 | 177 |
| 61 | 3300005331 | Ga0070670_100461826 | Ga0070670_1004618261 | 177 |
| 62 | 3300005333 | Ga0070677_10280855 | Ga0070677_102808551 | 177 |
| 63 | 3300005341 | Ga0070691_10368484 | Ga0070691_103684841 | 177 |
| 64 | 3300005343 | Ga0070687_100025005 | Ga0070687_1000250051 | 177 |
| 65 | 3300005354 | Ga0070675_100020836 | Ga0070675_1000208367 | 177 |
| 66 | 3300005466 | Ga0070685_10115682 | Ga0070685_101156823 | 177 |
| 67 | 3300005535 | Ga0070684_100055636 | Ga0070684_1000556362 | 177 |
| 68 | 3300005544 | Ga0070686_100087056 | Ga0070686_1000870563 | 177 |
| 69 | 3300005546 | Ga0070696_101002793 | Ga0070696_1010027931 | 177 |
| 70 | 3300005547 | Ga0070693_100403141 | Ga0070693_1004031411 | 177 |
| 71 | 3300005549 | Ga0070704_100699805 | Ga0070704_1006998052 | 177 |
| 72 | 3300005577 | Ga0068857_100201243 | Ga0068857_1002012432 | 177 |
| 73 | 3300005615 | Ga0070702_100117477 | Ga0070702_1001174773 | 177 |
| 74 | 3300005617 | Ga0068859_100924200 | Ga0068859_1009242002 | 177 |
| 75 | 3300005840 | Ga0068870_10094799 | Ga0068870_100947992 | 177 |
| 76 | 3300005981 | Ga0081538_10202990 | Ga0081538_102029901 | 177 |
| 77 | 3300006237 | Ga0097621_100006938 | Ga0097621_1000069383 | 177 |
| 78 | 3300006358 | Ga0068871_100003199 | Ga0068871_1000031999 | 177 |
| 79 | 3300006844 | Ga0075428_100006591 | Ga0075428_1000065913 | 177 |
| 80 | 3300006844 | Ga0075428_100064509 | Ga0075428_1000645093 | 177 |
| 81 | 3300006846 | Ga0075430_100002769 | Ga0075430_10000276910 | 177 |
| 82 | 3300006847 | Ga0075431_100045926 | Ga0075431_1000459264 | 177 |
| 83 | 3300006847 | Ga0075431_100095401 | Ga0075431_1000954013 | 177 |
| 84 | 3300006847 | Ga0075431_101145860 | Ga0075431_1011458601 | 177 |
| 85 | 3300006852 | Ga0075433_11158084 | Ga0075433_111580841 | 177 |
| 86 | 3300006880 | Ga0075429_100025168 | Ga0075429_1000251683 | 177 |
| 87 | 3300006880 | Ga0075429_100329758 | Ga0075429_1003297582 | 177 |
| 88 | 3300006931 | Ga0097620_100924173 | Ga0097620_1009241732 | 177 |
| 89 | 3300009147 | Ga0114129_10056966 | Ga0114129_100569663 | 177 |
| 90 | 3300009147 | Ga0114129_11036222 | Ga0114129_110362222 | 177 |
| 91 | 3300014969 | Ga0157376_10081689 | Ga0157376_100816893 | 177 |
| 92 | 3300025901 | Ga0207688_10059509 | Ga0207688_100595093 | 177 |
| 93 | 3300025903 | Ga0207680_10216031 | Ga0207680_102160312 | 177 |
| 94 | 3300025908 | Ga0207643_10010297 | Ga0207643_100102973 | 177 |
| 95 | 3300025918 | Ga0207662_10585898 | Ga0207662_105858982 | 177 |
| 96 | 3300025918 | Ga0207662_10610326 | Ga0207662_106103262 | 177 |
| 97 | 3300025923 | Ga0207681_10249953 | Ga0207681_102499533 | 177 |
| 98 | 3300025925 | Ga0207650_10466465 | Ga0207650_104664652 | 177 |
| 99 | 3300025926 | Ga0207659_10040969 | Ga0207659_100409694 | 177 |
| 100 | 3300025936 | Ga0207670_10073521 | Ga0207670_100735213 | 177 |
| 101 | 3300025940 | Ga0207691_10217754 | Ga0207691_102177542 | 177 |
| 102 | 3300025942 | Ga0207689_10047407 | Ga0207689_100474074 | 177 |
| 103 | 3300025944 | Ga0207661_10091921 | Ga0207661_100919214 | 177 |
| 104 | 3300025960 | Ga0207651_10151008 | Ga0207651_101510084 | 177 |
| 105 | 3300026035 | Ga0207703_10231505 | Ga0207703_102315052 | 177 |
| 106 | 3300026075 | Ga0207708_10158350 | Ga0207708_101583503 | 177 |
| 107 | 3300026075 | Ga0207708_10489309 | Ga0207708_104893093 | 177 |
| 108 | 3300026116 | Ga0207674_10400911 | Ga0207674_104009111 | 177 |
| 109 | 3300026121 | Ga0207683_10370452 | Ga0207683_103704523 | 177 |
| 110 | 3300027462 | Ga0210000_1010816 | Ga0210000_10108161 | 177 |
| 111 | 3300027614 | Ga0209970_1009461 | Ga0209970_10094613 | 177 |
| 112 | 3300027682 | Ga0209971_1005499 | Ga0209971_10054993 | 177 |
| 113 | 3300031548 | Ga0307408_100235902 | Ga0307408_1002359023 | 177 |
| 114 | 3300031548 | Ga0307408_100251959 | Ga0307408_1002519592 | 177 |
| 115 | 3300031731 | Ga0307405_10610662 | Ga0307405_106106622 | 177 |
| 116 | 3300031901 | Ga0307406_10532579 | Ga0307406_105325792 | 177 |
| 117 | 3300032002 | Ga0307416_100028157 | Ga0307416_1000281573 | 177 |
| 118 | 3300032002 | Ga0307416_100919968 | Ga0307416_1009199682 | 177 |
| 119 | 3300032005 | Ga0307411_10419432 | Ga0307411_104194321 | 177 |
| 120 | 3300032126 | Ga0307415_100213033 | Ga0307415_1002130334 | 177 |
| 121 | 3300034816 | Ga0373930_0049354 | Ga0373930_0049354_29_562 | 177 |
| 122 | 3300035086 | Ga0373934_0118189 | Ga0373934_0118189_315_851 | 177 |
| 123 | 3300035118 | Ga0373954_0000071 | Ga0373954_0000071_29416_29952 | 177 |
| 124 | 3300035119 | Ga0373956_0080109 | Ga0373956_0080109_668_1204 | 177 |
| 125 | 3300035241 | Ga0373961_0155915 | Ga0373961_0155915_28_561 | 177 |
| 126 | 3300035724 | Ga0373933_0005400 | Ga0373933_0005400_2267_2803 | 177 |
| 127 | 3300036401 | Ga0373937_0000282 | Ga0373937_0000282_20104_20640 | 177 |
| 128 | 3300041408 | Ga0439453_0002655 | Ga0439453_0002655_1884_2420 | 177 |
| 129 | 3300042156 | Ga0439446_0097808 | Ga0439446_0097808_74_610 | 177 |
| 130 | 3300042436 | Ga0439435_0000449 | Ga0439435_0000449_3440_3976 | 177 |
| 131 | 3300042437 | Ga0439444_0003317 | Ga0439444_0003317_1071_1607 | 177 |
| 132 | 3300042461 | Ga0439460_0001182 | Ga0439460_0001182_349_885 | 177 |
| 133 | 3300046454 | Ga0495592_0252527 | Ga0495592_0252527_566_1102 | 177 |
| 134 | 3300046559 | Ga0495667_0079091 | Ga0495667_0079091_1205_1741 | 177 |
| 135 | 3300047317 | Ga0495604_0211833 | Ga0495604_0211833_393_929 | 177 |
| 136 | 3300048088 | Ga0495602_0281783 | Ga0495602_0281783_610_1146 | 177 |
| 137 | 3300049570 | Ga0501033_0354573 | Ga0501033_0354573_215_751 | 177 |
| 138 | 3300049572 | Ga0501036_0273362 | Ga0501036_0273362_128_664 | 177 |
| 139 | 3300049572 | Ga0501036_0481887 | Ga0501036_0481887_379_912 | 177 |
| 140 | 3300049575 | Ga0501039_0052841 | Ga0501039_0052841_682_1218 | 177 |
| 141 | 3300049575 | Ga0501039_0104231 | Ga0501039_0104231_1487_2023 | 177 |
| 142 | 3300049576 | Ga0501040_0059121 | Ga0501040_0059121_2037_2573 | 177 |
| 143 | 3300049576 | Ga0501040_0137878 | Ga0501040_0137878_395_931 | 177 |
| 144 | 3300049576 | Ga0501040_0253854 | Ga0501040_0253854_377_913 | 177 |
| 145 | 3300049577 | Ga0501041_0026338 | Ga0501041_0026338_1578_2114 | 177 |
| 146 | 3300049577 | Ga0501041_0056813 | Ga0501041_0056813_1187_1723 | 177 |
| 147 | 3300049577 | Ga0501041_0070304 | Ga0501041_0070304_1553_2089 | 177 |
| 148 | 3300049578 | Ga0501042_0012409 | Ga0501042_0012409_3049_3585 | 177 |
| 149 | 3300049578 | Ga0501042_0167971 | Ga0501042_0167971_841_1377 | 177 |
| 150 | 3300049578 | Ga0501042_0239126 | Ga0501042_0239126_415_951 | 177 |
| 151 | 3300049578 | Ga0501042_0503765 | Ga0501042_0503765_182_721 | 177 |
| 152 | 3300049579 | Ga0501043_0170924 | Ga0501043_0170924_256_792 | 177 |
| 153 | 3300049582 | Ga0501048_0431214 | Ga0501048_0431214_365_901 | 177 |
| 154 | 3300049587 | Ga0501071_0039634 | Ga0501071_0039634_810_1346 | 177 |
| 155 | 3300049588 | Ga0501072_0131172 | Ga0501072_0131172_1050_1586 | 177 |
| 156 | 3300049588 | Ga0501072_0891107 | Ga0501072_0891107_77_613 | 177 |
| 157 | 3300049591 | Ga0501075_0066715 | Ga0501075_0066715_1531_2067 | 177 |
| 158 | 3300049593 | Ga0501077_0462791 | Ga0501077_0462791_79_615 | 177 |
| 159 | 3300049741 | Ga0501079_0005830 | Ga0501079_0005830_47_583 | 177 |
| 160 | 3300049741 | Ga0501079_0635635 | Ga0501079_0635635_60_596 | 177 |
| 161 | 3300049742 | Ga0501080_0550063 | Ga0501080_0550063_56_592 | 177 |
| 162 | 3300049742 | Ga0501080_0691306 | Ga0501080_0691306_305_841 | 177 |
| 163 | 3300049743 | Ga0501081_0025257 | Ga0501081_0025257_606_1142 | 177 |
| 164 | 3300049743 | Ga0501081_0044699 | Ga0501081_0044699_948_1484 | 177 |
| 165 | 3300049822 | Ga0501035_0377527 | Ga0501035_0377527_67_621 | 177 |
| 166 | 3300049824 | Ga0501045_0191056 | Ga0501045_0191056_762_1298 | 177 |
| 167 | 3300050509 | nmdc:mga0qj67_206695_c1 | nmdc:mga0qj67_206695_c1_837_1370 | 177 |
| 168 | 3300050509 | nmdc:mga0qj67_2525_c1 | nmdc:mga0qj67_2525_c1_4592_5128 | 177 |
| 169 | 3300050509 | nmdc:mga0qj67_397856_c1 | nmdc:mga0qj67_397856_c1_332_865 | 177 |
| 170 | 3300050510 | nmdc:mga06r32_1036438_c1 | nmdc:mga06r32_1036438_c1_218_751 | 177 |
| 171 | 3300050510 | nmdc:mga06r32_117280_c1 | nmdc:mga06r32_117280_c1_924_1457 | 177 |
| 172 | 3300050510 | nmdc:mga06r32_54138_c1 | nmdc:mga06r32_54138_c1_841_1377 | 177 |
| 173 | 3300050511 | nmdc:mga08y16_206648_c1 | nmdc:mga08y16_206648_c1_34_567 | 177 |
| 174 | 3300054114 | Ga0501084_0050524 | Ga0501084_0050524_63_599 | 177 |
| 175 | 3300061734 | Ga0530510_0028411 | Ga0530510_0028411_207_743 | 177 |
| 176 | 3300061734 | Ga0530510_1126013 | Ga0530510_1126013_52_585 | 177 |
| 177 | 3300032002 | Ga0307416_100747014 | Ga0307416_1007470142 | 178 |
| 178 | 3300005334 | Ga0068869_100367271 | Ga0068869_1003672712 | 179 |
| 179 | 3300005336 | Ga0070680_100055213 | Ga0070680_1000552135 | 179 |
| 180 | 3300005336 | Ga0070680_100258838 | Ga0070680_1002588382 | 179 |
| 181 | 3300005340 | Ga0070689_101085623 | Ga0070689_1010856232 | 179 |
| 182 | 3300005345 | Ga0070692_10032296 | Ga0070692_100322962 | 179 |
| 183 | 3300005345 | Ga0070692_10060092 | Ga0070692_100600923 | 179 |
| 184 | 3300005347 | Ga0070668_100071747 | Ga0070668_1000717472 | 179 |
| 185 | 3300005353 | Ga0070669_100014122 | Ga0070669_1000141226 | 179 |
| 186 | 3300005441 | Ga0070700_100101004 | Ga0070700_1001010043 | 179 |
| 187 | 3300005441 | Ga0070700_100270384 | Ga0070700_1002703842 | 179 |
| 188 | 3300005444 | Ga0070694_100049141 | Ga0070694_1000491413 | 179 |
| 189 | 3300005444 | Ga0070694_100248932 | Ga0070694_1002489322 | 179 |
| 190 | 3300005444 | Ga0070694_100789038 | Ga0070694_1007890382 | 179 |
| 191 | 3300005457 | Ga0070662_100421599 | Ga0070662_1004215992 | 179 |
| 192 | 3300005458 | Ga0070681_10019103 | Ga0070681_100191036 | 179 |
| 193 | 3300005459 | Ga0068867_100142893 | Ga0068867_1001428933 | 179 |
| 194 | 3300005467 | Ga0070706_100240357 | Ga0070706_1002403573 | 179 |
| 195 | 3300005518 | Ga0070699_100142047 | Ga0070699_1001420474 | 179 |
| 196 | 3300005530 | Ga0070679_100076603 | Ga0070679_1000766034 | 179 |
| 197 | 3300005536 | Ga0070697_100251771 | Ga0070697_1002517713 | 179 |
| 198 | 3300005543 | Ga0070672_100688331 | Ga0070672_1006883312 | 179 |
| 199 | 3300005545 | Ga0070695_100192649 | Ga0070695_1001926493 | 179 |
| 200 | 3300005549 | Ga0070704_100949114 | Ga0070704_1009491141 | 179 |
| 201 | 3300005615 | Ga0070702_100357339 | Ga0070702_1003573391 | 179 |
| 202 | 3300005718 | Ga0068866_10045921 | Ga0068866_100459213 | 179 |
| 203 | 3300005719 | Ga0068861_100012712 | Ga0068861_1000127126 | 179 |
| 204 | 3300005844 | Ga0068862_100003371 | Ga0068862_10000337117 | 179 |
| 205 | 3300005844 | Ga0068862_100484244 | Ga0068862_1004842443 | 179 |
| 206 | 3300006173 | Ga0070716_100719227 | Ga0070716_1007192272 | 179 |
| 207 | 3300006846 | Ga0075430_100040813 | Ga0075430_1000408134 | 179 |
| 208 | 3300006871 | Ga0075434_100000283 | Ga0075434_10000028319 | 179 |
| 209 | 3300006871 | Ga0075434_100070720 | Ga0075434_1000707205 | 179 |
| 210 | 3300006871 | Ga0075434_100261838 | Ga0075434_1002618382 | 179 |
| 211 | 3300006881 | Ga0068865_100014208 | Ga0068865_1000142084 | 179 |
| 212 | 3300006914 | Ga0075436_100071099 | Ga0075436_1000710994 | 179 |
| 213 | 3300007076 | Ga0075435_100063066 | Ga0075435_1000630664 | 179 |
| 214 | 3300007076 | Ga0075435_100202236 | Ga0075435_1002022363 | 179 |
| 215 | 3300009094 | Ga0111539_10206496 | Ga0111539_102064964 | 179 |
| 216 | 3300009147 | Ga0114129_10351377 | Ga0114129_103513774 | 179 |
| 217 | 3300009148 | Ga0105243_10046102 | Ga0105243_100461024 | 179 |
| 218 | 3300009553 | Ga0105249_10238672 | Ga0105249_102386723 | 179 |
| 219 | 3300013105 | Ga0157369_10222230 | Ga0157369_102222302 | 179 |
| 220 | 3300014326 | Ga0157380_10047659 | Ga0157380_100476593 | 179 |
| 221 | 3300025893 | Ga0207682_10031294 | Ga0207682_100312944 | 179 |
| 222 | 3300025899 | Ga0207642_10031384 | Ga0207642_100313843 | 179 |
| 223 | 3300025910 | Ga0207684_10150012 | Ga0207684_101500122 | 179 |
| 224 | 3300025912 | Ga0207707_10116744 | Ga0207707_101167441 | 179 |
| 225 | 3300025917 | Ga0207660_10029306 | Ga0207660_100293065 | 179 |
| 226 | 3300025917 | Ga0207660_10373134 | Ga0207660_103731343 | 179 |
| 227 | 3300025921 | Ga0207652_10288608 | Ga0207652_102886081 | 179 |
| 228 | 3300025921 | Ga0207652_11287215 | Ga0207652_112872151 | 179 |
| 229 | 3300025923 | Ga0207681_10002576 | Ga0207681_1000257612 | 179 |
| 230 | 3300025935 | Ga0207709_10029611 | Ga0207709_100296114 | 179 |
| 231 | 3300025936 | Ga0207670_10808440 | Ga0207670_108084401 | 179 |
| 232 | 3300025937 | Ga0207669_10144239 | Ga0207669_101442392 | 179 |
| 233 | 3300025938 | Ga0207704_10011437 | Ga0207704_100114376 | 179 |
| 234 | 3300025961 | Ga0207712_10035229 | Ga0207712_100352295 | 179 |
| 235 | 3300025972 | Ga0207668_10183497 | Ga0207668_101834973 | 179 |
| 236 | 3300026075 | Ga0207708_10012792 | Ga0207708_100127924 | 179 |
| 237 | 3300026089 | Ga0207648_10024176 | Ga0207648_100241766 | 179 |
| 238 | 3300026118 | Ga0207675_100025078 | Ga0207675_1000250783 | 179 |
| 239 | 3300027907 | Ga0207428_10088584 | Ga0207428_100885844 | 179 |
| 240 | 3300028380 | Ga0268265_10001655 | Ga0268265_100016555 | 179 |
| 241 | 3300028380 | Ga0268265_10081790 | Ga0268265_100817903 | 179 |
| 242 | 3300035115 | Ga0373941_0006559 | Ga0373941_0006559_1693_2238 | 179 |
| 243 | 3300035121 | Ga0373960_0164557 | Ga0373960_0164557_113_652 | 179 |
| 244 | 3300035207 | Ga0373942_0026790 | Ga0373942_0026790_889_1455 | 179 |
| 245 | 3300035241 | Ga0373961_0140413 | Ga0373961_0140413_230_775 | 179 |
| 246 | 3300035691 | Ga0373931_0074490 | Ga0373931_0074490_721_1284 | 179 |
| 247 | 3300037068 | Ga0373925_0802741 | Ga0373925_0802741_25_564 | 179 |
| 248 | 3300045051 | Ga0451576_0235516 | Ga0451576_0235516_777_1340 | 179 |
| 249 | 3300046539 | Ga0495621_0087474 | Ga0495621_0087474_290_835 | 179 |
| 250 | 3300046664 | Ga0495659_0030730 | Ga0495659_0030730_1074_1637 | 179 |
| 251 | 3300046684 | Ga0495669_0088228 | Ga0495669_0088228_651_1196 | 179 |
| 252 | 3300047445 | Ga0495677_0337026 | Ga0495677_0337026_17_562 | 179 |
| 253 | 3300049583 | Ga0501067_0195337 | Ga0501067_0195337_138_683 | 179 |
| 254 | 3300049592 | Ga0501076_0169767 | Ga0501076_0169767_1182_1730 | 179 |
| 255 | 3300049824 | Ga0501045_0758342 | Ga0501045_0758342_134_679 | 179 |
| 256 | 3300050507 | nmdc:mga05p37_885895_c1 | nmdc:mga05p37_885895_c1_162_725 | 179 |
| 257 | 3300050509 | nmdc:mga0qj67_2300_c1 | nmdc:mga0qj67_2300_c1_2113_2658 | 179 |
| 258 | 3300050511 | nmdc:mga08y16_212446_c1 | nmdc:mga08y16_212446_c1_139_684 | 179 |
| 259 | 3300050511 | nmdc:mga08y16_48515_c1 | nmdc:mga08y16_48515_c1_3889_4434 | 179 |
| 260 | 3300050512 | nmdc:mga0n895_1714_c1 | nmdc:mga0n895_1714_c1_15580_16119 | 179 |
| 261 | 3300050512 | nmdc:mga0n895_274516_c1 | nmdc:mga0n895_274516_c1_179_742 | 179 |
| 262 | 3300050512 | nmdc:mga0n895_51389_c1 | nmdc:mga0n895_51389_c1_2589_3152 | 179 |
| 263 | 3300050513 | nmdc:mga0rr50_148540_c1 | nmdc:mga0rr50_148540_c1_971_1534 | 179 |
| 264 | 3300050513 | nmdc:mga0rr50_40585_c1 | nmdc:mga0rr50_40585_c1_1059_1598 | 179 |
| 265 | 3300050513 | nmdc:mga0rr50_518920_c1 | nmdc:mga0rr50_518920_c1_175_738 | 179 |
| 266 | 3300050514 | nmdc:mga08x19_17437_c1 | nmdc:mga08x19_17437_c1_2549_3088 | 179 |
| 267 | 3300050514 | nmdc:mga08x19_1750_c1 | nmdc:mga08x19_1750_c1_8174_8713 | 179 |
| 268 | 3300050514 | nmdc:mga08x19_7149_c1 | nmdc:mga08x19_7149_c1_2272_2811 | 179 |
| 269 | 3300050515 | nmdc:mga0a205_7705_c1 | nmdc:mga0a205_7705_c1_4599_5162 | 179 |
| 270 | 3300003203 | JGI25406J46586_10045929 | JGI25406J46586_100459293 | 183 |
| 271 | 3300005518 | Ga0070699_100005634 | Ga0070699_1000056346 | 183 |
| 272 | 3300005536 | Ga0070697_100012545 | Ga0070697_1000125454 | 183 |
| 273 | 3300005545 | Ga0070695_100005735 | Ga0070695_1000057352 | 183 |
| 274 | 3300005549 | Ga0070704_100100661 | Ga0070704_1001006612 | 183 |
| 275 | 3300005985 | Ga0081539_10000332 | Ga0081539_1000033217 | 183 |
| 276 | 3300006914 | Ga0075436_100001164 | Ga0075436_10000116411 | 183 |
| 277 | 3300006914 | Ga0075436_100014023 | Ga0075436_1000140233 | 183 |
| 278 | 3300025905 | Ga0207685_10224066 | Ga0207685_102240662 | 183 |
| 279 | 3300025922 | Ga0207646_11042421 | Ga0207646_110424211 | 183 |
| 280 | 3300025939 | Ga0207665_10147189 | Ga0207665_101471894 | 183 |
| 281 | 3300046528 | Ga0495642_0022061 | Ga0495642_0022061_1304_1879 | 183 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hob-assembly1.cif.gz_A | the crystal structure of the zalpha domain from cyprinid herpes virus 3 | 0.9926 | 62 | 103 |
| 4hob-assembly2.cif.gz_C | the crystal structure of the zalpha domain from cyprinid herpes virus 3 | 0.9838 | 62 | 103 |
| 4awx-assembly1.cif.gz_B | moonlighting functions of feoc in the regulation of ferrous iron transport in feo | 0.955 | 63 | 121 |
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9545 | 62 | 122 |
| 4kmf-assembly1.cif.gz_A-2 | crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna | 0.9416 | 62 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4hobA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9926 | 62 | 103 | 1.10.10.10 |
| 4hobC00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9838 | 62 | 103 | 1.10.10.10 |
| af_Q58793_322_389_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9809 | 63 | 121 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9768 | 59 | 120 | 1.10.10.10 |
| 3tgnA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9618 | 59 | 106 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W6GFI6-F1-model_v4 | DNA-binding MarR family transcriptional regulator | 0.9662 | 13 | 174 |
GO:0003677
GO:0003700 GO:0006950 |
| AF-A0A177QZV8-F1-model_v4 | HTH marR-type domain-containing protein | 0.9659 | 12 | 180 |
GO:0003677
GO:0003700 GO:0006950 |
| AF-A0A2D8PS90-F1-model_v4 | MarR family transcriptional regulator | 0.9552 | 10 | 170 |
GO:0003677
GO:0003700 GO:0006950 |
| AF-A0A2W6XWU0-F1-model_v4 | deleted | 0.9402 | 6 | 173 |
|
| AF-A0A177QZV8-F1-model_v4 | HTH marR-type domain-containing protein | 0.9391 | 12 | 180 |
GO:0003677
GO:0003700 GO:0006950 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar