F384333

General Info

Members Datasets Scaffolds Average Seq Length
281 175 281 178

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_11042421|Ga0207646_110424211
Length 191
Sequence MLATMARPRRRKAAPVFNATAPATVSRSALLVEGSDAEFRGLIHDLIAYGHRLDTCRDAFAAIVGISGAQYEILMLVSRAAGLLSVGEVATRLHRSGAFITIEANKLVASGTLEKVGDPSDGRRVLLRANQRSRELLERLAPFQRRVNDQLFERLDAKRFRQLRALARDLVESGDRAVAMLEFMLHDSKAA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
112 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
113 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
116 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
117 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
118 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
126 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
127 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
128 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
129 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
133 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
174 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.64
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10045929 3300003203 Bacteria 1500
2 Ga0070683_100042288 3300005329 Bacteria 4196
3 Ga0070690_100167034 3300005330 Unclassified 1512
4 Ga0070690_100534461 3300005330 Bacteria 882
5 Ga0070670_100461826 3300005331 Bacteria 1126
6 Ga0070677_10280855 3300005333 Bacteria 839
7 Ga0068869_100367271 3300005334 Bacteria 1176
8 Ga0070680_100055213 3300005336 Bacteria 3246
9 Ga0070680_100258838 3300005336 Bacteria 1472
10 Ga0070689_100201714 3300005340 Bacteria 1625
11 Ga0070689_101085623 3300005340 Bacteria 715
12 Ga0070691_10151974 3300005341 Bacteria 1188
13 Ga0070691_10368484 3300005341 Unclassified 802
14 Ga0070687_100025005 3300005343 Bacteria 2859
15 Ga0070692_10032296 3300005345 Bacteria 2631
16 Ga0070692_10060092 3300005345 Bacteria 2000
17 Ga0070668_100071747 3300005347 Bacteria 2698
18 Ga0070669_100014122 3300005353 Bacteria 5682
19 Ga0070675_100020836 3300005354 Bacteria 5233
20 Ga0070674_100253450 3300005356 Bacteria 1383
21 Ga0070703_10179962 3300005406 Unclassified 816
22 Ga0070701_10274061 3300005438 Bacteria 1028
23 Ga0070705_100041801 3300005440 Bacteria 2616
24 Ga0070705_100050414 3300005440 Bacteria 2422
25 Ga0070700_100101004 3300005441 Bacteria 1900
26 Ga0070700_100270384 3300005441 Bacteria 1228
27 Ga0070694_100012277 3300005444 Bacteria 5322
28 Ga0070694_100049141 3300005444 Bacteria 2840
29 Ga0070694_100100831 3300005444 Bacteria 2042
30 Ga0070694_100101031 3300005444 Bacteria 2040
31 Ga0070694_100248932 3300005444 Bacteria 1343
32 Ga0070694_100789038 3300005444 Bacteria 778
33 Ga0070662_100421599 3300005457 Bacteria 1104
34 Ga0070681_10019103 3300005458 Bacteria 6859
35 Ga0068867_100142893 3300005459 Bacteria 1872
36 Ga0068867_100755594 3300005459 Bacteria 863
37 Ga0070685_10115682 3300005466 Unclassified 1659
38 Ga0070706_100240357 3300005467 Bacteria 1691
39 Ga0070699_100005634 3300005518 Bacteria 10978
40 Ga0070699_100142047 3300005518 Bacteria 2121
41 Ga0070679_100076603 3300005530 Bacteria 3334
42 Ga0070684_100055636 3300005535 Bacteria 3450
43 Ga0070697_100012545 3300005536 Bacteria 6638
44 Ga0070697_100251771 3300005536 Bacteria 1511
45 Ga0070672_100688331 3300005543 Bacteria 895
46 Ga0070686_100087056 3300005544 Unclassified 2081
47 Ga0070686_100106534 3300005544 Bacteria 1903
48 Ga0070686_100213855 3300005544 Bacteria 1389
49 Ga0070695_100005735 3300005545 Bacteria 7314
50 Ga0070695_100076917 3300005545 Bacteria 2198
51 Ga0070695_100192649 3300005545 Bacteria 1452
52 Ga0070696_100038920 3300005546 Bacteria 3284
53 Ga0070696_100083734 3300005546 Bacteria 2262
54 Ga0070696_101002793 3300005546 Unclassified 698
55 Ga0070693_100403141 3300005547 Unclassified 949
56 Ga0070704_100100661 3300005549 Bacteria 2176
57 Ga0070704_100159136 3300005549 Bacteria 1784
58 Ga0070704_100699805 3300005549 Unclassified 898
59 Ga0070704_100949114 3300005549 Bacteria 776
60 Ga0068857_100201243 3300005577 Unclassified 1816
61 Ga0070702_100054392 3300005615 Bacteria 2303
62 Ga0070702_100117477 3300005615 Bacteria 1659
63 Ga0070702_100357339 3300005615 Unclassified 1031
64 Ga0068859_100563051 3300005617 Bacteria 1234
65 Ga0068859_100924200 3300005617 Bacteria 956
66 Ga0068866_10045921 3300005718 Bacteria 2194
67 Ga0068861_100012712 3300005719 Bacteria 5874
68 Ga0068870_10094799 3300005840 Bacteria 1676
69 Ga0068863_101253486 3300005841 Bacteria 748
70 Ga0068862_100003371 3300005844 Bacteria 13778
71 Ga0068862_100484244 3300005844 Unclassified 1171
72 Ga0081538_10202990 3300005981 Unclassified 811
73 Ga0081539_10000332 3300005985 Bacteria 104677
74 Ga0070715_10126359 3300006163 Bacteria 1225
75 Ga0070716_100719227 3300006173 Bacteria 765
76 Ga0097621_100006938 3300006237 Bacteria 8063
77 Ga0068871_100003199 3300006358 Bacteria 11236
78 Ga0075428_100006591 3300006844 Bacteria 12915
79 Ga0075428_100064509 3300006844 Bacteria 4011
80 Ga0075430_100002769 3300006846 Bacteria 14650
81 Ga0075430_100040813 3300006846 Bacteria 3927
82 Ga0075431_100045926 3300006847 Bacteria 4503
83 Ga0075431_100095401 3300006847 Bacteria 3070
84 Ga0075431_101145860 3300006847 Unclassified 741
85 Ga0075433_10124583 3300006852 Unclassified 2289
86 Ga0075433_11107018 3300006852 Unclassified 689
87 Ga0075433_11158084 3300006852 Bacteria 672
88 Ga0075434_100000283 3300006871 Bacteria 36124
89 Ga0075434_100070720 3300006871 Bacteria 3480
90 Ga0075434_100261838 3300006871 Unclassified 1748
91 Ga0075429_100025168 3300006880 Bacteria 5166
92 Ga0075429_100329758 3300006880 Bacteria 1335
93 Ga0068865_100014208 3300006881 Bacteria 5054
94 Ga0075436_100001164 3300006914 Bacteria 17802
95 Ga0075436_100014023 3300006914 Bacteria 5485
96 Ga0075436_100071099 3300006914 Bacteria 2406
97 Ga0075436_100080027 3300006914 Unclassified 2264
98 Ga0097620_100563102 3300006931 Bacteria 1234
99 Ga0097620_100924173 3300006931 Bacteria 956
100 Ga0075435_100063066 3300007076 Bacteria 3010
101 Ga0075435_100202236 3300007076 Bacteria 1683
102 Ga0075435_100395081 3300007076 Bacteria 1189
103 Ga0111539_10012682 3300009094 Bacteria 10557
104 Ga0111539_10206496 3300009094 Bacteria 2289
105 Ga0114129_10056966 3300009147 Bacteria 5471
106 Ga0114129_10351377 3300009147 Bacteria 1953
107 Ga0114129_11036222 3300009147 Unclassified 1031
108 Ga0105243_10046102 3300009148 Bacteria 3427
109 Ga0105249_10238672 3300009553 Bacteria 1796
110 Ga0157369_10222230 3300013105 Bacteria 1977
111 Ga0157380_10047659 3300014326 Bacteria 3372
112 Ga0157376_10081689 3300014969 Unclassified 2775
113 Ga0207682_10031294 3300025893 Bacteria 2135
114 Ga0207642_10031384 3300025899 Bacteria 2225
115 Ga0207688_10059509 3300025901 Bacteria 2152
116 Ga0207680_10216031 3300025903 Unclassified 1313
117 Ga0207685_10224066 3300025905 Unclassified 896
118 Ga0207685_10266761 3300025905 Bacteria 834
119 Ga0207643_10010297 3300025908 Bacteria 5031
120 Ga0207684_10150012 3300025910 Bacteria 2006
121 Ga0207707_10116744 3300025912 Bacteria 2332
122 Ga0207660_10029306 3300025917 Bacteria 3774
123 Ga0207660_10070682 3300025917 Bacteria 2538
124 Ga0207660_10373134 3300025917 Bacteria 1146
125 Ga0207660_10895251 3300025917 Bacteria 724
126 Ga0207662_10585898 3300025918 Unclassified 775
127 Ga0207662_10610326 3300025918 Bacteria 760
128 Ga0207652_10288608 3300025921 Bacteria 1480
129 Ga0207652_11287215 3300025921 Bacteria 634
130 Ga0207646_11042421 3300025922 Bacteria 721
131 Ga0207681_10002576 3300025923 Bacteria 11497
132 Ga0207681_10249953 3300025923 Bacteria 1384
133 Ga0207650_10466465 3300025925 Bacteria 1052
134 Ga0207659_10040969 3300025926 Bacteria 3242
135 Ga0207709_10029611 3300025935 Bacteria 3178
136 Ga0207670_10073521 3300025936 Bacteria 2371
137 Ga0207670_10185168 3300025936 Bacteria 1571
138 Ga0207670_10808440 3300025936 Bacteria 781
139 Ga0207669_10144239 3300025937 Bacteria 1658
140 Ga0207669_10189982 3300025937 Bacteria 1481
141 Ga0207704_10011437 3300025938 Bacteria 4370
142 Ga0207665_10147189 3300025939 Bacteria 1684
143 Ga0207691_10217754 3300025940 Bacteria 1656
144 Ga0207689_10047407 3300025942 Bacteria 3548
145 Ga0207661_10091921 3300025944 Bacteria 2529
146 Ga0207651_10151008 3300025960 Unclassified 1808
147 Ga0207712_10035229 3300025961 Bacteria 3398
148 Ga0207668_10183497 3300025972 Bacteria 1652
149 Ga0207703_10231505 3300026035 Unclassified 1657
150 Ga0207708_10012792 3300026075 Bacteria 6259
151 Ga0207708_10158350 3300026075 Bacteria 1787
152 Ga0207708_10489309 3300026075 Bacteria 1030
153 Ga0207648_10024176 3300026089 Bacteria 5428
154 Ga0207674_10400911 3300026116 Bacteria 1326
155 Ga0207675_100025078 3300026118 Bacteria 5549
156 Ga0207683_10370452 3300026121 Bacteria 1316
157 Ga0209969_1048028 3300027360 Unclassified 668
158 Ga0210000_1010816 3300027462 Bacteria 1350
159 Ga0209970_1009461 3300027614 Bacteria 1592
160 Ga0209971_1005499 3300027682 Bacteria 3007
161 Ga0207428_10088584 3300027907 Bacteria 2407
162 Ga0268265_10001655 3300028380 Bacteria 18241
163 Ga0268265_10081790 3300028380 Bacteria 2551
164 Ga0307408_100235902 3300031548 Bacteria 1501
165 Ga0307408_100251959 3300031548 Bacteria 1457
166 Ga0307405_10610662 3300031731 Bacteria 891
167 Ga0307406_10532579 3300031901 Bacteria 958
168 Ga0307416_100028157 3300032002 Bacteria 4175
169 Ga0307416_100463209 3300032002 Bacteria 1323
170 Ga0307416_100747014 3300032002 Bacteria 1071
171 Ga0307416_100919968 3300032002 Bacteria 975
172 Ga0307411_10419432 3300032005 Bacteria 1111
173 Ga0307415_100213033 3300032126 Bacteria 1543
174 Ga0373930_0049354 3300034816 Unclassified 915
175 Ga0373934_0118189 3300035086 Bacteria 1077
176 Ga0373941_0006559 3300035115 Bacteria 2811
177 Ga0373954_0000071 3300035118 Bacteria 36140
178 Ga0373956_0080109 3300035119 Bacteria 1498
179 Ga0373960_0063211 3300035121 Bacteria 1128
180 Ga0373960_0164557 3300035121 Unclassified 766
181 Ga0373942_0026790 3300035207 Bacteria 1495
182 Ga0373961_0140413 3300035241 Unclassified 816
183 Ga0373961_0155915 3300035241 Unclassified 781
184 Ga0373931_0074490 3300035691 Bacteria 1860
185 Ga0373933_0005400 3300035724 Bacteria 6954
186 Ga0373937_0000282 3300036401 Bacteria 48656
187 Ga0373925_0802741 3300037068 Unclassified 776
188 Ga0439453_0002655 3300041408 Bacteria 2489
189 Ga0451853_3178932 3300041512 Archaea 752
190 Ga0439446_0097808 3300042156 Bacteria 925
191 Ga0439435_0000449 3300042436 Bacteria 6473
192 Ga0439444_0003317 3300042437 Bacteria 2268
193 Ga0439460_0001182 3300042461 Bacteria 6135
194 Ga0466968_0537664 3300044735 Bacteria 585
195 Ga0451576_0235516 3300045051 Bacteria 1912
196 Ga0495592_0252527 3300046454 Bacteria 1165
197 Ga0495642_0022061 3300046528 Bacteria 2507
198 Ga0495621_0087474 3300046539 Bacteria 1170
199 Ga0495667_0079091 3300046559 Bacteria 2138
200 Ga0495659_0030730 3300046664 Bacteria 1871
201 Ga0495669_0088228 3300046684 Bacteria 1430
202 Ga0495604_0211833 3300047317 Bacteria 1339
203 Ga0495636_0022184 3300047318 Bacteria 2565
204 Ga0495675_0719969 3300047444 Bacteria 558
205 Ga0495677_0337026 3300047445 Unclassified 595
206 Ga0495602_0281783 3300048088 Bacteria 1224
207 Ga0501300_056930 3300049523 Bacteria 613
208 Ga0501033_0354573 3300049570 Bacteria 1027
209 Ga0501036_0273362 3300049572 Bacteria 1414
210 Ga0501036_0481887 3300049572 Bacteria 1033
211 Ga0501039_0052841 3300049575 Bacteria 3143
212 Ga0501039_0104231 3300049575 Bacteria 2214
213 Ga0501040_0059121 3300049576 Bacteria 2633
214 Ga0501040_0137878 3300049576 Bacteria 1718
215 Ga0501040_0253854 3300049576 Unclassified 1254
216 Ga0501040_0322459 3300049576 Bacteria 1105
217 Ga0501041_0026338 3300049577 Bacteria 3497
218 Ga0501041_0056813 3300049577 Bacteria 2392
219 Ga0501041_0070304 3300049577 Bacteria 2148
220 Ga0501042_0012409 3300049578 Bacteria 5772
221 Ga0501042_0167971 3300049578 Unclassified 1583
222 Ga0501042_0239126 3300049578 Bacteria 1310
223 Ga0501042_0503765 3300049578 Bacteria 879
224 Ga0501043_0170924 3300049579 Bacteria 1696
225 Ga0501048_0431214 3300049582 Unclassified 943
226 Ga0501048_0727326 3300049582 Unclassified 713
227 Ga0501048_1203212 3300049582 Bacteria 545
228 Ga0501067_0195337 3300049583 Bacteria 1127
229 Ga0501071_0039634 3300049587 Bacteria 3370
230 Ga0501072_0131172 3300049588 Bacteria 1997
231 Ga0501072_0891107 3300049588 Unclassified 695
232 Ga0501072_1239474 3300049588 Unclassified 579
233 Ga0501075_0066715 3300049591 Bacteria 2715
234 Ga0501076_0169767 3300049592 Bacteria 1778
235 Ga0501077_0171877 3300049593 Unclassified 1377
236 Ga0501077_0462791 3300049593 Bacteria 812
237 Ga0501079_0005830 3300049741 Bacteria 9210
238 Ga0501079_0548500 3300049741 Unclassified 909
239 Ga0501079_0635635 3300049741 Unclassified 840
240 Ga0501080_0550063 3300049742 Bacteria 1028
241 Ga0501080_0691306 3300049742 Bacteria 900
242 Ga0501081_0025257 3300049743 Bacteria 3995
243 Ga0501081_0044699 3300049743 Bacteria 3041
244 Ga0501035_0377527 3300049822 Bacteria 1183
245 Ga0501035_0957179 3300049822 Unclassified 675
246 Ga0501045_0191056 3300049824 Bacteria 1526
247 Ga0501045_0758342 3300049824 Unclassified 715
248 nmdc:mga05p37_885895_c1 3300050507 Bacteria 964
249 nmdc:mga09592_750976_c1 3300050508 Bacteria 828
250 nmdc:mga0qj67_206695_c1 3300050509 Bacteria 1595
251 nmdc:mga0qj67_2300_c1 3300050509 Bacteria 13583
252 nmdc:mga0qj67_2525_c1 3300050509 Bacteria 13071
253 nmdc:mga0qj67_397856_c1 3300050509 Bacteria 1112
254 nmdc:mga06r32_1036438_c1 3300050510 Bacteria 772
255 nmdc:mga06r32_117280_c1 3300050510 Bacteria 2624
256 nmdc:mga06r32_54138_c1 3300050510 Bacteria 3847
257 nmdc:mga08y16_206648_c1 3300050511 Unclassified 2034
258 nmdc:mga08y16_212446_c1 3300050511 Bacteria 2004
259 nmdc:mga08y16_43153_c1 3300050511 Bacteria 4725
260 nmdc:mga08y16_48515_c1 3300050511 Bacteria 4444
261 nmdc:mga0n895_1714_c1 3300050512 Bacteria 16563
262 nmdc:mga0n895_274516_c1 3300050512 Unclassified 1710
263 nmdc:mga0n895_51389_c1 3300050512 Bacteria 4044
264 nmdc:mga0rr50_148540_c1 3300050513 Unclassified 1892
265 nmdc:mga0rr50_40585_c1 3300050513 Bacteria 3385
266 nmdc:mga0rr50_518920_c1 3300050513 Unclassified 1014
267 nmdc:mga08x19_17437_c1 3300050514 Bacteria 4392
268 nmdc:mga08x19_1750_c1 3300050514 Bacteria 13388
269 nmdc:mga08x19_17858_c1 3300050514 Bacteria 4343
270 nmdc:mga08x19_7149_c1 3300050514 Bacteria 6629
271 nmdc:mga0a205_136695_c1 3300050515 Bacteria 2351
272 nmdc:mga0a205_7705_c1 3300050515 Bacteria 9768
273 nmdc:mga0a205_987315_c1 3300050515 Unclassified 689
274 Ga0501084_0050524 3300054114 Bacteria 3480
275 Ga0590071_005901 3300059421 Bacteria 2936
276 Ga0590074_032481 3300059423 Bacteria 925
277 Ga0590077_043249 3300059426 Bacteria 1004
278 Ga0590077_097168 3300059426 Unclassified 687
279 Ga0590077_106111 3300059426 Bacteria 659
280 Ga0530510_0028411 3300061734 Bacteria 4010
281 Ga0530510_1126013 3300061734 Bacteria 601

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049593 Ga0501077_0171877 Ga0501077_0171877_11_478 155
2 3300050515 nmdc:mga0a205_136695_c1 nmdc:mga0a205_136695_c1_1507_2040 159
3 3300049576 Ga0501040_0322459 Ga0501040_0322459_46_528 160
4 3300049822 Ga0501035_0957179 Ga0501035_0957179_152_634 160
5 3300006852 Ga0075433_10124583 Ga0075433_101245834 161
6 3300006914 Ga0075436_100080027 Ga0075436_1000800272 161
7 3300044735 Ga0466968_0537664 Ga0466968_0537664_25_510 161
8 3300050514 nmdc:mga08x19_17858_c1 nmdc:mga08x19_17858_c1_1731_2270 161
9 3300047444 Ga0495675_0719969 Ga0495675_0719969_29_532 166
10 3300049523 Ga0501300_056930 Ga0501300_056930_100_600 166
11 3300049582 Ga0501048_1203212 Ga0501048_1203212_30_533 166
12 3300049588 Ga0501072_1239474 Ga0501072_1239474_62_565 166
13 3300059421 Ga0590071_005901 Ga0590071_005901_1504_2013 168
14 3300059423 Ga0590074_032481 Ga0590074_032481_166_675 168
15 3300059426 Ga0590077_043249 Ga0590077_043249_198_707 168
16 3300005459 Ga0068867_100755594 Ga0068867_1007555942 170
17 3300035121 Ga0373960_0063211 Ga0373960_0063211_12_530 170
18 3300032002 Ga0307416_100463209 Ga0307416_1004632092 172
19 3300049741 Ga0501079_0548500 Ga0501079_0548500_155_673 172
20 3300006163 Ga0070715_10126359 Ga0070715_101263592 173
21 3300025905 Ga0207685_10266761 Ga0207685_102667612 173
22 3300005341 Ga0070691_10151974 Ga0070691_101519742 174
23 3300005438 Ga0070701_10274061 Ga0070701_102740611 174
24 3300005440 Ga0070705_100050414 Ga0070705_1000504142 174
25 3300005444 Ga0070694_100100831 Ga0070694_1001008314 174
26 3300005444 Ga0070694_100101031 Ga0070694_1001010314 174
27 3300005544 Ga0070686_100213855 Ga0070686_1002138552 174
28 3300005545 Ga0070695_100076917 Ga0070695_1000769174 174
29 3300005546 Ga0070696_100038920 Ga0070696_1000389202 174
30 3300005546 Ga0070696_100083734 Ga0070696_1000837341 174
31 3300005615 Ga0070702_100054392 Ga0070702_1000543922 174
32 3300005841 Ga0068863_101253486 Ga0068863_1012534862 174
33 3300006852 Ga0075433_11107018 Ga0075433_111070182 174
34 3300007076 Ga0075435_100395081 Ga0075435_1003950812 174
35 3300009094 Ga0111539_10012682 Ga0111539_100126824 174
36 3300041512 Ga0451853_3178932 Ga0451853_3178932_159_683 174
37 3300050508 nmdc:mga09592_750976_c1 nmdc:mga09592_750976_c1_84_608 174
38 3300050511 nmdc:mga08y16_43153_c1 nmdc:mga08y16_43153_c1_54_578 174
39 3300050515 nmdc:mga0a205_987315_c1 nmdc:mga0a205_987315_c1_105_629 174
40 3300027360 Ga0209969_1048028 Ga0209969_10480281 175
41 3300005340 Ga0070689_100201714 Ga0070689_1002017141 176
42 3300005356 Ga0070674_100253450 Ga0070674_1002534502 176
43 3300005406 Ga0070703_10179962 Ga0070703_101799622 176
44 3300005440 Ga0070705_100041801 Ga0070705_1000418013 176
45 3300005444 Ga0070694_100012277 Ga0070694_1000122773 176
46 3300005544 Ga0070686_100106534 Ga0070686_1001065342 176
47 3300005549 Ga0070704_100159136 Ga0070704_1001591361 176
48 3300005617 Ga0068859_100563051 Ga0068859_1005630512 176
49 3300006931 Ga0097620_100563102 Ga0097620_1005631022 176
50 3300025917 Ga0207660_10070682 Ga0207660_100706823 176
51 3300025917 Ga0207660_10895251 Ga0207660_108952511 176
52 3300025936 Ga0207670_10185168 Ga0207670_101851681 176
53 3300025937 Ga0207669_10189982 Ga0207669_101899823 176
54 3300047318 Ga0495636_0022184 Ga0495636_0022184_1638_2171 176
55 3300049582 Ga0501048_0727326 Ga0501048_0727326_17_553 176
56 3300059426 Ga0590077_097168 Ga0590077_097168_113_649 176
57 3300059426 Ga0590077_106111 Ga0590077_106111_107_637 176
58 3300005329 Ga0070683_100042288 Ga0070683_1000422882 177
59 3300005330 Ga0070690_100167034 Ga0070690_1001670342 177
60 3300005330 Ga0070690_100534461 Ga0070690_1005344611 177
61 3300005331 Ga0070670_100461826 Ga0070670_1004618261 177
62 3300005333 Ga0070677_10280855 Ga0070677_102808551 177
63 3300005341 Ga0070691_10368484 Ga0070691_103684841 177
64 3300005343 Ga0070687_100025005 Ga0070687_1000250051 177
65 3300005354 Ga0070675_100020836 Ga0070675_1000208367 177
66 3300005466 Ga0070685_10115682 Ga0070685_101156823 177
67 3300005535 Ga0070684_100055636 Ga0070684_1000556362 177
68 3300005544 Ga0070686_100087056 Ga0070686_1000870563 177
69 3300005546 Ga0070696_101002793 Ga0070696_1010027931 177
70 3300005547 Ga0070693_100403141 Ga0070693_1004031411 177
71 3300005549 Ga0070704_100699805 Ga0070704_1006998052 177
72 3300005577 Ga0068857_100201243 Ga0068857_1002012432 177
73 3300005615 Ga0070702_100117477 Ga0070702_1001174773 177
74 3300005617 Ga0068859_100924200 Ga0068859_1009242002 177
75 3300005840 Ga0068870_10094799 Ga0068870_100947992 177
76 3300005981 Ga0081538_10202990 Ga0081538_102029901 177
77 3300006237 Ga0097621_100006938 Ga0097621_1000069383 177
78 3300006358 Ga0068871_100003199 Ga0068871_1000031999 177
79 3300006844 Ga0075428_100006591 Ga0075428_1000065913 177
80 3300006844 Ga0075428_100064509 Ga0075428_1000645093 177
81 3300006846 Ga0075430_100002769 Ga0075430_10000276910 177
82 3300006847 Ga0075431_100045926 Ga0075431_1000459264 177
83 3300006847 Ga0075431_100095401 Ga0075431_1000954013 177
84 3300006847 Ga0075431_101145860 Ga0075431_1011458601 177
85 3300006852 Ga0075433_11158084 Ga0075433_111580841 177
86 3300006880 Ga0075429_100025168 Ga0075429_1000251683 177
87 3300006880 Ga0075429_100329758 Ga0075429_1003297582 177
88 3300006931 Ga0097620_100924173 Ga0097620_1009241732 177
89 3300009147 Ga0114129_10056966 Ga0114129_100569663 177
90 3300009147 Ga0114129_11036222 Ga0114129_110362222 177
91 3300014969 Ga0157376_10081689 Ga0157376_100816893 177
92 3300025901 Ga0207688_10059509 Ga0207688_100595093 177
93 3300025903 Ga0207680_10216031 Ga0207680_102160312 177
94 3300025908 Ga0207643_10010297 Ga0207643_100102973 177
95 3300025918 Ga0207662_10585898 Ga0207662_105858982 177
96 3300025918 Ga0207662_10610326 Ga0207662_106103262 177
97 3300025923 Ga0207681_10249953 Ga0207681_102499533 177
98 3300025925 Ga0207650_10466465 Ga0207650_104664652 177
99 3300025926 Ga0207659_10040969 Ga0207659_100409694 177
100 3300025936 Ga0207670_10073521 Ga0207670_100735213 177
101 3300025940 Ga0207691_10217754 Ga0207691_102177542 177
102 3300025942 Ga0207689_10047407 Ga0207689_100474074 177
103 3300025944 Ga0207661_10091921 Ga0207661_100919214 177
104 3300025960 Ga0207651_10151008 Ga0207651_101510084 177
105 3300026035 Ga0207703_10231505 Ga0207703_102315052 177
106 3300026075 Ga0207708_10158350 Ga0207708_101583503 177
107 3300026075 Ga0207708_10489309 Ga0207708_104893093 177
108 3300026116 Ga0207674_10400911 Ga0207674_104009111 177
109 3300026121 Ga0207683_10370452 Ga0207683_103704523 177
110 3300027462 Ga0210000_1010816 Ga0210000_10108161 177
111 3300027614 Ga0209970_1009461 Ga0209970_10094613 177
112 3300027682 Ga0209971_1005499 Ga0209971_10054993 177
113 3300031548 Ga0307408_100235902 Ga0307408_1002359023 177
114 3300031548 Ga0307408_100251959 Ga0307408_1002519592 177
115 3300031731 Ga0307405_10610662 Ga0307405_106106622 177
116 3300031901 Ga0307406_10532579 Ga0307406_105325792 177
117 3300032002 Ga0307416_100028157 Ga0307416_1000281573 177
118 3300032002 Ga0307416_100919968 Ga0307416_1009199682 177
119 3300032005 Ga0307411_10419432 Ga0307411_104194321 177
120 3300032126 Ga0307415_100213033 Ga0307415_1002130334 177
121 3300034816 Ga0373930_0049354 Ga0373930_0049354_29_562 177
122 3300035086 Ga0373934_0118189 Ga0373934_0118189_315_851 177
123 3300035118 Ga0373954_0000071 Ga0373954_0000071_29416_29952 177
124 3300035119 Ga0373956_0080109 Ga0373956_0080109_668_1204 177
125 3300035241 Ga0373961_0155915 Ga0373961_0155915_28_561 177
126 3300035724 Ga0373933_0005400 Ga0373933_0005400_2267_2803 177
127 3300036401 Ga0373937_0000282 Ga0373937_0000282_20104_20640 177
128 3300041408 Ga0439453_0002655 Ga0439453_0002655_1884_2420 177
129 3300042156 Ga0439446_0097808 Ga0439446_0097808_74_610 177
130 3300042436 Ga0439435_0000449 Ga0439435_0000449_3440_3976 177
131 3300042437 Ga0439444_0003317 Ga0439444_0003317_1071_1607 177
132 3300042461 Ga0439460_0001182 Ga0439460_0001182_349_885 177
133 3300046454 Ga0495592_0252527 Ga0495592_0252527_566_1102 177
134 3300046559 Ga0495667_0079091 Ga0495667_0079091_1205_1741 177
135 3300047317 Ga0495604_0211833 Ga0495604_0211833_393_929 177
136 3300048088 Ga0495602_0281783 Ga0495602_0281783_610_1146 177
137 3300049570 Ga0501033_0354573 Ga0501033_0354573_215_751 177
138 3300049572 Ga0501036_0273362 Ga0501036_0273362_128_664 177
139 3300049572 Ga0501036_0481887 Ga0501036_0481887_379_912 177
140 3300049575 Ga0501039_0052841 Ga0501039_0052841_682_1218 177
141 3300049575 Ga0501039_0104231 Ga0501039_0104231_1487_2023 177
142 3300049576 Ga0501040_0059121 Ga0501040_0059121_2037_2573 177
143 3300049576 Ga0501040_0137878 Ga0501040_0137878_395_931 177
144 3300049576 Ga0501040_0253854 Ga0501040_0253854_377_913 177
145 3300049577 Ga0501041_0026338 Ga0501041_0026338_1578_2114 177
146 3300049577 Ga0501041_0056813 Ga0501041_0056813_1187_1723 177
147 3300049577 Ga0501041_0070304 Ga0501041_0070304_1553_2089 177
148 3300049578 Ga0501042_0012409 Ga0501042_0012409_3049_3585 177
149 3300049578 Ga0501042_0167971 Ga0501042_0167971_841_1377 177
150 3300049578 Ga0501042_0239126 Ga0501042_0239126_415_951 177
151 3300049578 Ga0501042_0503765 Ga0501042_0503765_182_721 177
152 3300049579 Ga0501043_0170924 Ga0501043_0170924_256_792 177
153 3300049582 Ga0501048_0431214 Ga0501048_0431214_365_901 177
154 3300049587 Ga0501071_0039634 Ga0501071_0039634_810_1346 177
155 3300049588 Ga0501072_0131172 Ga0501072_0131172_1050_1586 177
156 3300049588 Ga0501072_0891107 Ga0501072_0891107_77_613 177
157 3300049591 Ga0501075_0066715 Ga0501075_0066715_1531_2067 177
158 3300049593 Ga0501077_0462791 Ga0501077_0462791_79_615 177
159 3300049741 Ga0501079_0005830 Ga0501079_0005830_47_583 177
160 3300049741 Ga0501079_0635635 Ga0501079_0635635_60_596 177
161 3300049742 Ga0501080_0550063 Ga0501080_0550063_56_592 177
162 3300049742 Ga0501080_0691306 Ga0501080_0691306_305_841 177
163 3300049743 Ga0501081_0025257 Ga0501081_0025257_606_1142 177
164 3300049743 Ga0501081_0044699 Ga0501081_0044699_948_1484 177
165 3300049822 Ga0501035_0377527 Ga0501035_0377527_67_621 177
166 3300049824 Ga0501045_0191056 Ga0501045_0191056_762_1298 177
167 3300050509 nmdc:mga0qj67_206695_c1 nmdc:mga0qj67_206695_c1_837_1370 177
168 3300050509 nmdc:mga0qj67_2525_c1 nmdc:mga0qj67_2525_c1_4592_5128 177
169 3300050509 nmdc:mga0qj67_397856_c1 nmdc:mga0qj67_397856_c1_332_865 177
170 3300050510 nmdc:mga06r32_1036438_c1 nmdc:mga06r32_1036438_c1_218_751 177
171 3300050510 nmdc:mga06r32_117280_c1 nmdc:mga06r32_117280_c1_924_1457 177
172 3300050510 nmdc:mga06r32_54138_c1 nmdc:mga06r32_54138_c1_841_1377 177
173 3300050511 nmdc:mga08y16_206648_c1 nmdc:mga08y16_206648_c1_34_567 177
174 3300054114 Ga0501084_0050524 Ga0501084_0050524_63_599 177
175 3300061734 Ga0530510_0028411 Ga0530510_0028411_207_743 177
176 3300061734 Ga0530510_1126013 Ga0530510_1126013_52_585 177
177 3300032002 Ga0307416_100747014 Ga0307416_1007470142 178
178 3300005334 Ga0068869_100367271 Ga0068869_1003672712 179
179 3300005336 Ga0070680_100055213 Ga0070680_1000552135 179
180 3300005336 Ga0070680_100258838 Ga0070680_1002588382 179
181 3300005340 Ga0070689_101085623 Ga0070689_1010856232 179
182 3300005345 Ga0070692_10032296 Ga0070692_100322962 179
183 3300005345 Ga0070692_10060092 Ga0070692_100600923 179
184 3300005347 Ga0070668_100071747 Ga0070668_1000717472 179
185 3300005353 Ga0070669_100014122 Ga0070669_1000141226 179
186 3300005441 Ga0070700_100101004 Ga0070700_1001010043 179
187 3300005441 Ga0070700_100270384 Ga0070700_1002703842 179
188 3300005444 Ga0070694_100049141 Ga0070694_1000491413 179
189 3300005444 Ga0070694_100248932 Ga0070694_1002489322 179
190 3300005444 Ga0070694_100789038 Ga0070694_1007890382 179
191 3300005457 Ga0070662_100421599 Ga0070662_1004215992 179
192 3300005458 Ga0070681_10019103 Ga0070681_100191036 179
193 3300005459 Ga0068867_100142893 Ga0068867_1001428933 179
194 3300005467 Ga0070706_100240357 Ga0070706_1002403573 179
195 3300005518 Ga0070699_100142047 Ga0070699_1001420474 179
196 3300005530 Ga0070679_100076603 Ga0070679_1000766034 179
197 3300005536 Ga0070697_100251771 Ga0070697_1002517713 179
198 3300005543 Ga0070672_100688331 Ga0070672_1006883312 179
199 3300005545 Ga0070695_100192649 Ga0070695_1001926493 179
200 3300005549 Ga0070704_100949114 Ga0070704_1009491141 179
201 3300005615 Ga0070702_100357339 Ga0070702_1003573391 179
202 3300005718 Ga0068866_10045921 Ga0068866_100459213 179
203 3300005719 Ga0068861_100012712 Ga0068861_1000127126 179
204 3300005844 Ga0068862_100003371 Ga0068862_10000337117 179
205 3300005844 Ga0068862_100484244 Ga0068862_1004842443 179
206 3300006173 Ga0070716_100719227 Ga0070716_1007192272 179
207 3300006846 Ga0075430_100040813 Ga0075430_1000408134 179
208 3300006871 Ga0075434_100000283 Ga0075434_10000028319 179
209 3300006871 Ga0075434_100070720 Ga0075434_1000707205 179
210 3300006871 Ga0075434_100261838 Ga0075434_1002618382 179
211 3300006881 Ga0068865_100014208 Ga0068865_1000142084 179
212 3300006914 Ga0075436_100071099 Ga0075436_1000710994 179
213 3300007076 Ga0075435_100063066 Ga0075435_1000630664 179
214 3300007076 Ga0075435_100202236 Ga0075435_1002022363 179
215 3300009094 Ga0111539_10206496 Ga0111539_102064964 179
216 3300009147 Ga0114129_10351377 Ga0114129_103513774 179
217 3300009148 Ga0105243_10046102 Ga0105243_100461024 179
218 3300009553 Ga0105249_10238672 Ga0105249_102386723 179
219 3300013105 Ga0157369_10222230 Ga0157369_102222302 179
220 3300014326 Ga0157380_10047659 Ga0157380_100476593 179
221 3300025893 Ga0207682_10031294 Ga0207682_100312944 179
222 3300025899 Ga0207642_10031384 Ga0207642_100313843 179
223 3300025910 Ga0207684_10150012 Ga0207684_101500122 179
224 3300025912 Ga0207707_10116744 Ga0207707_101167441 179
225 3300025917 Ga0207660_10029306 Ga0207660_100293065 179
226 3300025917 Ga0207660_10373134 Ga0207660_103731343 179
227 3300025921 Ga0207652_10288608 Ga0207652_102886081 179
228 3300025921 Ga0207652_11287215 Ga0207652_112872151 179
229 3300025923 Ga0207681_10002576 Ga0207681_1000257612 179
230 3300025935 Ga0207709_10029611 Ga0207709_100296114 179
231 3300025936 Ga0207670_10808440 Ga0207670_108084401 179
232 3300025937 Ga0207669_10144239 Ga0207669_101442392 179
233 3300025938 Ga0207704_10011437 Ga0207704_100114376 179
234 3300025961 Ga0207712_10035229 Ga0207712_100352295 179
235 3300025972 Ga0207668_10183497 Ga0207668_101834973 179
236 3300026075 Ga0207708_10012792 Ga0207708_100127924 179
237 3300026089 Ga0207648_10024176 Ga0207648_100241766 179
238 3300026118 Ga0207675_100025078 Ga0207675_1000250783 179
239 3300027907 Ga0207428_10088584 Ga0207428_100885844 179
240 3300028380 Ga0268265_10001655 Ga0268265_100016555 179
241 3300028380 Ga0268265_10081790 Ga0268265_100817903 179
242 3300035115 Ga0373941_0006559 Ga0373941_0006559_1693_2238 179
243 3300035121 Ga0373960_0164557 Ga0373960_0164557_113_652 179
244 3300035207 Ga0373942_0026790 Ga0373942_0026790_889_1455 179
245 3300035241 Ga0373961_0140413 Ga0373961_0140413_230_775 179
246 3300035691 Ga0373931_0074490 Ga0373931_0074490_721_1284 179
247 3300037068 Ga0373925_0802741 Ga0373925_0802741_25_564 179
248 3300045051 Ga0451576_0235516 Ga0451576_0235516_777_1340 179
249 3300046539 Ga0495621_0087474 Ga0495621_0087474_290_835 179
250 3300046664 Ga0495659_0030730 Ga0495659_0030730_1074_1637 179
251 3300046684 Ga0495669_0088228 Ga0495669_0088228_651_1196 179
252 3300047445 Ga0495677_0337026 Ga0495677_0337026_17_562 179
253 3300049583 Ga0501067_0195337 Ga0501067_0195337_138_683 179
254 3300049592 Ga0501076_0169767 Ga0501076_0169767_1182_1730 179
255 3300049824 Ga0501045_0758342 Ga0501045_0758342_134_679 179
256 3300050507 nmdc:mga05p37_885895_c1 nmdc:mga05p37_885895_c1_162_725 179
257 3300050509 nmdc:mga0qj67_2300_c1 nmdc:mga0qj67_2300_c1_2113_2658 179
258 3300050511 nmdc:mga08y16_212446_c1 nmdc:mga08y16_212446_c1_139_684 179
259 3300050511 nmdc:mga08y16_48515_c1 nmdc:mga08y16_48515_c1_3889_4434 179
260 3300050512 nmdc:mga0n895_1714_c1 nmdc:mga0n895_1714_c1_15580_16119 179
261 3300050512 nmdc:mga0n895_274516_c1 nmdc:mga0n895_274516_c1_179_742 179
262 3300050512 nmdc:mga0n895_51389_c1 nmdc:mga0n895_51389_c1_2589_3152 179
263 3300050513 nmdc:mga0rr50_148540_c1 nmdc:mga0rr50_148540_c1_971_1534 179
264 3300050513 nmdc:mga0rr50_40585_c1 nmdc:mga0rr50_40585_c1_1059_1598 179
265 3300050513 nmdc:mga0rr50_518920_c1 nmdc:mga0rr50_518920_c1_175_738 179
266 3300050514 nmdc:mga08x19_17437_c1 nmdc:mga08x19_17437_c1_2549_3088 179
267 3300050514 nmdc:mga08x19_1750_c1 nmdc:mga08x19_1750_c1_8174_8713 179
268 3300050514 nmdc:mga08x19_7149_c1 nmdc:mga08x19_7149_c1_2272_2811 179
269 3300050515 nmdc:mga0a205_7705_c1 nmdc:mga0a205_7705_c1_4599_5162 179
270 3300003203 JGI25406J46586_10045929 JGI25406J46586_100459293 183
271 3300005518 Ga0070699_100005634 Ga0070699_1000056346 183
272 3300005536 Ga0070697_100012545 Ga0070697_1000125454 183
273 3300005545 Ga0070695_100005735 Ga0070695_1000057352 183
274 3300005549 Ga0070704_100100661 Ga0070704_1001006612 183
275 3300005985 Ga0081539_10000332 Ga0081539_1000033217 183
276 3300006914 Ga0075436_100001164 Ga0075436_10000116411 183
277 3300006914 Ga0075436_100014023 Ga0075436_1000140233 183
278 3300025905 Ga0207685_10224066 Ga0207685_102240662 183
279 3300025922 Ga0207646_11042421 Ga0207646_110424211 183
280 3300025939 Ga0207665_10147189 Ga0207665_101471894 183
281 3300046528 Ga0495642_0022061 Ga0495642_0022061_1304_1879 183

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

64

124

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hob-assembly1.cif.gz_A the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.9926 62 103
4hob-assembly2.cif.gz_C the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.9838 62 103
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.955 63 121
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9545 62 122
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9416 62 122
ID Description Score Start End Superfamily
4hobA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9926 62 103 1.10.10.10
4hobC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9838 62 103 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9809 63 121 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9768 59 120 1.10.10.10
3tgnA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9618 59 106 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W6GFI6-F1-model_v4 DNA-binding MarR family transcriptional regulator 0.9662 13 174 GO:0003677
GO:0003700
GO:0006950
AF-A0A177QZV8-F1-model_v4 HTH marR-type domain-containing protein 0.9659 12 180 GO:0003677
GO:0003700
GO:0006950
AF-A0A2D8PS90-F1-model_v4 MarR family transcriptional regulator 0.9552 10 170 GO:0003677
GO:0003700
GO:0006950
AF-A0A2W6XWU0-F1-model_v4 deleted 0.9402 6 173
AF-A0A177QZV8-F1-model_v4 HTH marR-type domain-containing protein 0.9391 12 180 GO:0003677
GO:0003700
GO:0006950

Feature Viewer

pLDDT pTM Quality
92.74 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map