F384264

General Info

Members Datasets Scaffolds Average Seq Length
281 152 562 298

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10014849|Ga0105241_100148495
Length 323
Sequence LPSSNLRLRRELVLLQHHSPRGKWARLRLPRGFTLMKARLVWLLLCGIWGSTWLFIKLGLADLPPITFAGIRFVIACAIIFLLIRFRRISLPRRGRAWLLLAVTGVLSFTLNYGLIFWAEQYISSGLAALLQATTPAFGLVIAHIHLPSERMTWAKIFGVVLGICGVGVVFSNQLSLAGGLALAGCVAVVLSSIFVAYSNVLIKAHGKNLEPAILAAGQMFFGLIPLLLIGIPLEGNPVHYHWTTMAIVSLFYLAIVGSVIAFLLYYWLVHHMDVTKTMMISLVTPVVAVILGLIVLHENLDWRTIAGGAMIMSGIALARRIF

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
127 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
128 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
129 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
130 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
131 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
132 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
133 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
134 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
135 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
136 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
137 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
138 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
139 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
140 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
143 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
144 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.71
Rhizosphere 98.93
Stem 0
Stem Tuber 0
Unclassified 20.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10014849 3300009174 Bacteria 5702
2 JGI25406J46586_10010885 3300003203 Bacteria 4010
3 JGI25406J46586_10031235 3300003203 Unclassified 1995
4 rootL2_10207277 3300003322 Bacteria 3449
5 Ga0065712_10074757 3300005290 Bacteria 4018
6 Ga0065715_10123839 3300005293 Bacteria 2168
7 Ga0065715_10127232 3300005293 Bacteria 2091
8 Ga0065715_10178709 3300005293 Bacteria 1492
9 Ga0065707_10126720 3300005295 Bacteria 1997
10 Ga0065707_10224100 3300005295 Unclassified 1213
11 Ga0070676_10098857 3300005328 Bacteria 1800
12 Ga0070690_100038456 3300005330 Bacteria 3020
13 Ga0070690_100254599 3300005330 Unclassified 1243
14 Ga0070670_100216750 3300005331 Bacteria 1665
15 Ga0068869_100011582 3300005334 Bacteria 5790
16 Ga0068869_100038404 3300005334 Bacteria 3413
17 Ga0068869_100041116 3300005334 Bacteria 3309
18 Ga0068869_100237601 3300005334 Bacteria 1450
19 Ga0070680_100490802 3300005336 Bacteria 1050
20 Ga0070682_100064237 3300005337 Bacteria 2330
21 Ga0070691_10050432 3300005341 Bacteria 1986
22 Ga0070692_10013448 3300005345 Unclassified 3815
23 Ga0070692_10051936 3300005345 Bacteria 2134
24 Ga0070692_10176667 3300005345 Bacteria 1235
25 Ga0070671_100207075 3300005355 Unclassified 1663
26 Ga0070671_100231558 3300005355 Bacteria 1568
27 Ga0070673_100082170 3300005364 Bacteria 2614
28 Ga0070667_100045343 3300005367 Unclassified 3696
29 Ga0070703_10000184 3300005406 Bacteria 30635
30 Ga0070703_10004248 3300005406 Unclassified 4032
31 Ga0070709_10084863 3300005434 Bacteria 2075
32 Ga0070701_10122196 3300005438 Bacteria 1469
33 Ga0070705_100002009 3300005440 Bacteria 10405
34 Ga0070705_100015240 3300005440 Bacteria 3969
35 Ga0070705_100222162 3300005440 Unclassified 1309
36 Ga0070700_100018064 3300005441 Bacteria 4048
37 Ga0070700_100106728 3300005441 Bacteria 1854
38 Ga0070694_100004752 3300005444 Bacteria 8181
39 Ga0070694_100020061 3300005444 Bacteria 4257
40 Ga0070694_100056126 3300005444 Bacteria 2674
41 Ga0070694_100098866 3300005444 Bacteria 2061
42 Ga0070708_100535556 3300005445 Bacteria 1105
43 Ga0070662_100323350 3300005457 Unclassified 1258
44 Ga0070706_100017527 3300005467 Bacteria 6610
45 Ga0070706_100233279 3300005467 Bacteria 1718
46 Ga0070706_100322412 3300005467 Bacteria 1441
47 Ga0070707_100005301 3300005468 Bacteria 12069
48 Ga0070707_100024493 3300005468 Bacteria 5717
49 Ga0070707_100081617 3300005468 Bacteria 3122
50 Ga0070707_100090843 3300005468 Bacteria 2956
51 Ga0070698_100010031 3300005471 Bacteria 10117
52 Ga0070698_100015203 3300005471 Bacteria 8138
53 Ga0070698_100015852 3300005471 Bacteria 7960
54 Ga0070698_100098668 3300005471 Bacteria 2895
55 Ga0070698_100117149 3300005471 Bacteria 2626
56 Ga0070699_100028005 3300005518 Bacteria 4859
57 Ga0070699_100319488 3300005518 Bacteria 1395
58 Ga0070679_100000030 3300005530 Bacteria 108148
59 Ga0070697_100001526 3300005536 Bacteria 17609
60 Ga0070697_100029885 3300005536 Bacteria 4374
61 Ga0070697_100394737 3300005536 Unclassified 1200
62 Ga0070697_100493768 3300005536 Unclassified 1070
63 Ga0068853_100218744 3300005539 Unclassified 1739
64 Ga0070695_100030114 3300005545 Bacteria 3377
65 Ga0070695_100155873 3300005545 Bacteria 1598
66 Ga0070696_100075123 3300005546 Bacteria 2384
67 Ga0070696_100096373 3300005546 Bacteria 2114
68 Ga0070696_100233474 3300005546 Bacteria 1385
69 Ga0070696_100313142 3300005546 Bacteria 1206
70 Ga0070693_100015717 3300005547 Bacteria 3902
71 Ga0070693_100120106 3300005547 Bacteria 1629
72 Ga0070693_100205073 3300005547 Unclassified 1283
73 Ga0070693_100211433 3300005547 Unclassified 1266
74 Ga0070693_100341269 3300005547 Unclassified 1022
75 Ga0070704_100006856 3300005549 Bacteria 6746
76 Ga0070704_100013764 3300005549 Bacteria 5034
77 Ga0070704_100064265 3300005549 Bacteria 2637
78 Ga0070704_100152515 3300005549 Bacteria 1818
79 Ga0070704_100165589 3300005549 Bacteria 1752
80 Ga0070704_100175246 3300005549 Unclassified 1710
81 Ga0070704_100324159 3300005549 Bacteria 1292
82 Ga0070664_100082782 3300005564 Bacteria 2768
83 Ga0068859_100009771 3300005617 Bacteria 9690
84 Ga0068859_100010468 3300005617 Bacteria 9331
85 Ga0068859_100014946 3300005617 Bacteria 7791
86 Ga0068859_100023947 3300005617 Bacteria 6127
87 Ga0068859_100130609 3300005617 Bacteria 2583
88 Ga0068859_100137198 3300005617 Bacteria 2519
89 Ga0068864_100010573 3300005618 Bacteria 7631
90 Ga0068866_10135539 3300005718 Unclassified 1406
91 Ga0068861_100001584 3300005719 Bacteria 14476
92 Ga0068870_10178175 3300005840 Bacteria 1274
93 Ga0068863_100440329 3300005841 Archaea 1278
94 Ga0068858_100012721 3300005842 Bacteria 7929
95 Ga0068858_100055551 3300005842 Bacteria 3660
96 Ga0068860_100072684 3300005843 Bacteria 3269
97 Ga0068862_100029174 3300005844 Bacteria 4647
98 Ga0068862_100577102 3300005844 Bacteria 1077
99 Ga0081539_10000481 3300005985 Bacteria 84382
100 Ga0081539_10000631 3300005985 Bacteria 71279
101 Ga0070715_10000013 3300006163 Bacteria 155405
102 Ga0070715_10045016 3300006163 Unclassified 1869
103 Ga0097621_100055053 3300006237 Unclassified 3247
104 Ga0075428_100143007 3300006844 Bacteria 2600
105 Ga0075428_100192977 3300006844 Unclassified 2203
106 Ga0075428_100194808 3300006844 Unclassified 2192
107 Ga0075428_100760287 3300006844 Bacteria 1031
108 Ga0075431_100069877 3300006847 Bacteria 3622
109 Ga0075433_10159442 3300006852 Bacteria 2008
110 Ga0075433_10177731 3300006852 Bacteria 1894
111 Ga0075434_100001690 3300006871 Bacteria 18870
112 Ga0075434_100073577 3300006871 Bacteria 3409
113 Ga0075434_100079280 3300006871 Bacteria 3280
114 Ga0075429_100118344 3300006880 Bacteria 2315
115 Ga0075429_100294001 3300006880 Bacteria 1422
116 Ga0075429_100446835 3300006880 Unclassified 1133
117 Ga0068865_100147111 3300006881 Bacteria 1783
118 Ga0097620_100009771 3300006931 Bacteria 9690
119 Ga0097620_100010468 3300006931 Bacteria 9331
120 Ga0097620_100014946 3300006931 Bacteria 7791
121 Ga0097620_100023949 3300006931 Bacteria 6127
122 Ga0097620_100130601 3300006931 Bacteria 2583
123 Ga0097620_100137196 3300006931 Bacteria 2519
124 Ga0075435_100308295 3300007076 Bacteria 1354
125 Ga0075435_100330352 3300007076 Unclassified 1306
126 Ga0099794_10005687 3300007265 Bacteria 5023
127 Ga0111539_10050313 3300009094 Bacteria 4963
128 Ga0111539_10156132 3300009094 Bacteria 2670
129 Ga0105245_10283735 3300009098 Unclassified 1619
130 Ga0105245_10322257 3300009098 Bacteria 1523
131 Ga0105247_10006554 3300009101 Bacteria 7199
132 Ga0114129_10002642 3300009147 Bacteria 24941
133 Ga0114129_10063371 3300009147 Bacteria 5162
134 Ga0114129_10094180 3300009147 Bacteria 4148
135 Ga0114129_10100292 3300009147 Bacteria 4006
136 Ga0114129_10168000 3300009147 Bacteria 2992
137 Ga0105243_10000039 3300009148 Bacteria 166207
138 Ga0105242_10000140 3300009176 Bacteria 52361
139 Ga0105242_10549545 3300009176 Unclassified 1107
140 Ga0105248_10010259 3300009177 Bacteria 10311
141 Ga0105248_10021454 3300009177 Bacteria 7154
142 Ga0105248_10028986 3300009177 Bacteria 6171
143 Ga0105248_10078877 3300009177 Bacteria 3701
144 Ga0105248_10484286 3300009177 Bacteria 1394
145 Ga0105248_10585370 3300009177 Bacteria 1259
146 Ga0105237_10003354 3300009545 Bacteria 19073
147 Ga0105249_10012334 3300009553 Bacteria 7530
148 Ga0105249_10047029 3300009553 Bacteria 3930
149 Ga0105249_10652168 3300009553 Unclassified 1110
150 Ga0105249_10690714 3300009553 Bacteria 1080
151 Ga0099796_10033911 3300010159 Bacteria 1683
152 Ga0105239_10048354 3300010375 Bacteria 4664
153 Ga0105239_10073457 3300010375 Bacteria 3760
154 Ga0157373_10145166 3300013100 Bacteria 1669
155 Ga0157374_10010491 3300013296 Bacteria 7971
156 Ga0157374_10560733 3300013296 Archaea 1150
157 Ga0157378_10008137 3300013297 Bacteria 9153
158 Ga0157378_10041445 3300013297 Bacteria 4084
159 Ga0157378_10062978 3300013297 Bacteria 3313
160 Ga0157378_10086328 3300013297 Bacteria 2845
161 Ga0157378_10158918 3300013297 Unclassified 2112
162 Ga0163162_10008423 3300013306 Bacteria 10055
163 Ga0163162_10177280 3300013306 Bacteria 2257
164 Ga0157372_10120010 3300013307 Unclassified 3019
165 Ga0157372_10367480 3300013307 Bacteria 1676
166 Ga0157375_10115187 3300013308 Unclassified 2791
167 Ga0157375_10491789 3300013308 Unclassified 1391
168 Ga0163163_10053440 3300014325 Unclassified 3987
169 Ga0163163_10361762 3300014325 Bacteria 1507
170 Ga0163161_10231873 3300017792 Bacteria 1433
171 Ga0163161_10392884 3300017792 Unclassified 1111
172 Ga0207653_10000191 3300025885 Bacteria 42182
173 Ga0207653_10005220 3300025885 Bacteria 4059
174 Ga0207653_10050496 3300025885 Unclassified 1383
175 Ga0207688_10056408 3300025901 Bacteria 2207
176 Ga0207680_10012506 3300025903 Unclassified 4325
177 Ga0207685_10000013 3300025905 Bacteria 186374
178 Ga0207643_10074105 3300025908 Bacteria 1963
179 Ga0207684_10000146 3300025910 Bacteria 125829
180 Ga0207684_10001572 3300025910 Bacteria 24352
181 Ga0207684_10534324 3300025910 Unclassified 1004
182 Ga0207654_10023870 3300025911 Bacteria 3281
183 Ga0207654_10225233 3300025911 Bacteria 1246
184 Ga0207707_10000063 3300025912 Bacteria 108163
185 Ga0207671_10007315 3300025914 Bacteria 9592
186 Ga0207660_10000454 3300025917 Bacteria 26985
187 Ga0207662_10119598 3300025918 Bacteria 1651
188 Ga0207662_10207093 3300025918 Archaea 1272
189 Ga0207652_10000091 3300025921 Bacteria 98787
190 Ga0207652_10068670 3300025921 Bacteria 3076
191 Ga0207646_10000546 3300025922 Bacteria 49508
192 Ga0207646_10002602 3300025922 Bacteria 21242
193 Ga0207646_10050787 3300025922 Bacteria 3711
194 Ga0207646_10082182 3300025922 Bacteria 2881
195 Ga0207646_10082998 3300025922 Bacteria 2866
196 Ga0207650_10200899 3300025925 Bacteria 1597
197 Ga0207659_10054299 3300025926 Unclassified 2861
198 Ga0207644_10081288 3300025931 Unclassified 2394
199 Ga0207706_10244579 3300025933 Bacteria 1568
200 Ga0207686_10000006 3300025934 Bacteria 259583
201 Ga0207709_10000037 3300025935 Bacteria 279771
202 Ga0207709_10480162 3300025935 Unclassified 966
203 Ga0207704_10225423 3300025938 Bacteria 1390
204 Ga0207665_10012840 3300025939 Bacteria 5508
205 Ga0207711_10004857 3300025941 Bacteria 11420
206 Ga0207711_10058983 3300025941 Bacteria 3303
207 Ga0207711_10208913 3300025941 Unclassified 1783
208 Ga0207689_10047877 3300025942 Bacteria 3527
209 Ga0207689_10063580 3300025942 Bacteria 3036
210 Ga0207689_10153582 3300025942 Bacteria 1898
211 Ga0207689_10312172 3300025942 Bacteria 1304
212 Ga0207689_10442190 3300025942 Bacteria 1086
213 Ga0207679_10333023 3300025945 Bacteria 1318
214 Ga0207712_10111967 3300025961 Archaea 2049
215 Ga0207712_10112841 3300025961 Bacteria 2042
216 Ga0207658_10061608 3300025986 Unclassified 2804
217 Ga0207703_10535847 3300026035 Unclassified 1103
218 Ga0207639_10096511 3300026041 Unclassified 2378
219 Ga0207708_10034668 3300026075 Bacteria 3839
220 Ga0207708_10225762 3300026075 Bacteria 1502
221 Ga0207702_10100307 3300026078 Bacteria 2554
222 Ga0207641_10175209 3300026088 Bacteria 1961
223 Ga0207676_10003647 3300026095 Bacteria 10891
224 Ga0207676_10453408 3300026095 Unclassified 1209
225 Ga0207676_10468622 3300026095 Bacteria 1191
226 Ga0207675_100005265 3300026118 Bacteria 12443
227 Ga0207675_100034414 3300026118 Bacteria 4724
228 Ga0207675_100696569 3300026118 Unclassified 1024
229 Ga0209588_1012746 3300027671 Bacteria 2556
230 Ga0207428_10020460 3300027907 Bacteria 5621
231 Ga0268265_10082660 3300028380 Bacteria 2540
232 Ga0268265_10459967 3300028380 Bacteria 1190
233 Ga0268264_10092568 3300028381 Bacteria 2610
234 Ga0307405_10264743 3300031731 Unclassified 1286
235 Ga0307407_10173047 3300031903 Bacteria 1424
236 Ga0307412_10100405 3300031911 Bacteria 2045
237 Ga0307409_100128732 3300031995 Bacteria 2159
238 Ga0307415_100009015 3300032126 Bacteria 5565
239 Ga0373937_0524600 3300036401 Unclassified 1125
240 Ga0395905_0090853 3300037471 Bacteria 2863
241 Ga0436360_1060241 3300039438 Bacteria 2782
242 Ga0495621_0038018 3300046539 Bacteria 1677
243 Ga0496102_0052023 3300048905 Unclassified 3731
244 Ga0496106_0514160 3300048909 Unclassified 962
245 Ga0501292_005484 3300049515 Bacteria 1770
246 Ga0501296_001409 3300049519 Bacteria 2430
247 Ga0501298_000159 3300049521 Bacteria 8226
248 Ga0501299_000839 3300049522 Unclassified 3754
249 Ga0501299_002785 3300049522 Bacteria 2461
250 Ga0501300_002490 3300049523 Bacteria 2754
251 Ga0501303_004511 3300049526 Unclassified 1153
252 Ga0501075_0139258 3300049591 Unclassified 1849
253 Ga0501075_0216721 3300049591 Bacteria 1460
254 Ga0501216_009079 3300049660 Unclassified 1579
255 Ga0501217_013225 3300049661 Bacteria 1850
256 Ga0501217_013603 3300049661 Bacteria 1828
257 Ga0501233_009520 3300049668 Unclassified 1895
258 Ga0501235_012701 3300049669 Bacteria 1853
259 Ga0501243_004842 3300049675 Bacteria 2021
260 Ga0501249_011108 3300049679 Bacteria 1888
261 Ga0501256_003153 3300049685 Unclassified 1353
262 Ga0501261_007247 3300049690 Unclassified 1420
263 Ga0501079_0264705 3300049741 Unclassified 1344
264 Ga0501273_008974 3300049770 Bacteria 1205
265 Ga0501283_001227 3300049779 Bacteria 3381
266 Ga0501212_005244 3300049851 Bacteria 1703
267 Ga0501212_008897 3300049851 Bacteria 1404
268 nmdc:mga05p37_16866_c1 3300050507 Bacteria 8805
269 nmdc:mga05p37_202795_c1 3300050507 Bacteria 2401
270 nmdc:mga05p37_90616_c1 3300050507 Bacteria 3768
271 nmdc:mga09592_275298_c1 3300050508 Bacteria 1460
272 nmdc:mga09592_386220_c1 3300050508 Unclassified 1210
273 nmdc:mga06r32_58250_c2 3300050510 Bacteria 3419
274 nmdc:mga08y16_27544_c1 3300050511 Bacteria 5987
275 nmdc:mga08y16_43861_c1 3300050511 Bacteria 4687
276 nmdc:mga0n895_146512_c1 3300050512 Bacteria 2391
277 nmdc:mga0n895_14872_c1 3300050512 Bacteria 7084
278 nmdc:mga08x19_35957_c1 3300050514 Bacteria 3135
279 nmdc:mga0a205_141940_c1 3300050515 Bacteria 2302
280 nmdc:mga0a205_349359_c1 3300050515 Bacteria 1346
281 Ga0501084_0083154 3300054114 Bacteria 2687
282 Ga0105241_10014849
283 JGI25406J46586_10010885
284 JGI25406J46586_10031235
285 rootL2_10207277
286 Ga0065712_10074757
287 Ga0065715_10123839
288 Ga0065715_10127232
289 Ga0065715_10178709
290 Ga0065707_10126720
291 Ga0065707_10224100
292 Ga0070676_10098857
293 Ga0070690_100038456
294 Ga0070690_100254599
295 Ga0070670_100216750
296 Ga0068869_100011582
297 Ga0068869_100038404
298 Ga0068869_100041116
299 Ga0068869_100237601
300 Ga0070680_100490802
301 Ga0070682_100064237
302 Ga0070691_10050432
303 Ga0070692_10013448
304 Ga0070692_10051936
305 Ga0070692_10176667
306 Ga0070671_100207075
307 Ga0070671_100231558
308 Ga0070673_100082170
309 Ga0070667_100045343
310 Ga0070703_10000184
311 Ga0070703_10004248
312 Ga0070709_10084863
313 Ga0070701_10122196
314 Ga0070705_100002009
315 Ga0070705_100015240
316 Ga0070705_100222162
317 Ga0070700_100018064
318 Ga0070700_100106728
319 Ga0070694_100004752
320 Ga0070694_100020061
321 Ga0070694_100056126
322 Ga0070694_100098866
323 Ga0070708_100535556
324 Ga0070662_100323350
325 Ga0070706_100017527
326 Ga0070706_100233279
327 Ga0070706_100322412
328 Ga0070707_100005301
329 Ga0070707_100024493
330 Ga0070707_100081617
331 Ga0070707_100090843
332 Ga0070698_100010031
333 Ga0070698_100015203
334 Ga0070698_100015852
335 Ga0070698_100098668
336 Ga0070698_100117149
337 Ga0070699_100028005
338 Ga0070699_100319488
339 Ga0070679_100000030
340 Ga0070697_100001526
341 Ga0070697_100029885
342 Ga0070697_100394737
343 Ga0070697_100493768
344 Ga0068853_100218744
345 Ga0070695_100030114
346 Ga0070695_100155873
347 Ga0070696_100075123
348 Ga0070696_100096373
349 Ga0070696_100233474
350 Ga0070696_100313142
351 Ga0070693_100015717
352 Ga0070693_100120106
353 Ga0070693_100205073
354 Ga0070693_100211433
355 Ga0070693_100341269
356 Ga0070704_100006856
357 Ga0070704_100013764
358 Ga0070704_100064265
359 Ga0070704_100152515
360 Ga0070704_100165589
361 Ga0070704_100175246
362 Ga0070704_100324159
363 Ga0070664_100082782
364 Ga0068859_100009771
365 Ga0068859_100010468
366 Ga0068859_100014946
367 Ga0068859_100023947
368 Ga0068859_100130609
369 Ga0068859_100137198
370 Ga0068864_100010573
371 Ga0068866_10135539
372 Ga0068861_100001584
373 Ga0068870_10178175
374 Ga0068863_100440329
375 Ga0068858_100012721
376 Ga0068858_100055551
377 Ga0068860_100072684
378 Ga0068862_100029174
379 Ga0068862_100577102
380 Ga0081539_10000481
381 Ga0081539_10000631
382 Ga0070715_10000013
383 Ga0070715_10045016
384 Ga0097621_100055053
385 Ga0075428_100143007
386 Ga0075428_100192977
387 Ga0075428_100194808
388 Ga0075428_100760287
389 Ga0075431_100069877
390 Ga0075433_10159442
391 Ga0075433_10177731
392 Ga0075434_100001690
393 Ga0075434_100073577
394 Ga0075434_100079280
395 Ga0075429_100118344
396 Ga0075429_100294001
397 Ga0075429_100446835
398 Ga0068865_100147111
399 Ga0097620_100009771
400 Ga0097620_100010468
401 Ga0097620_100014946
402 Ga0097620_100023949
403 Ga0097620_100130601
404 Ga0097620_100137196
405 Ga0075435_100308295
406 Ga0075435_100330352
407 Ga0099794_10005687
408 Ga0111539_10050313
409 Ga0111539_10156132
410 Ga0105245_10283735
411 Ga0105245_10322257
412 Ga0105247_10006554
413 Ga0114129_10002642
414 Ga0114129_10063371
415 Ga0114129_10094180
416 Ga0114129_10100292
417 Ga0114129_10168000
418 Ga0105243_10000039
419 Ga0105242_10000140
420 Ga0105242_10549545
421 Ga0105248_10010259
422 Ga0105248_10021454
423 Ga0105248_10028986
424 Ga0105248_10078877
425 Ga0105248_10484286
426 Ga0105248_10585370
427 Ga0105237_10003354
428 Ga0105249_10012334
429 Ga0105249_10047029
430 Ga0105249_10652168
431 Ga0105249_10690714
432 Ga0099796_10033911
433 Ga0105239_10048354
434 Ga0105239_10073457
435 Ga0157373_10145166
436 Ga0157374_10010491
437 Ga0157374_10560733
438 Ga0157378_10008137
439 Ga0157378_10041445
440 Ga0157378_10062978
441 Ga0157378_10086328
442 Ga0157378_10158918
443 Ga0163162_10008423
444 Ga0163162_10177280
445 Ga0157372_10120010
446 Ga0157372_10367480
447 Ga0157375_10115187
448 Ga0157375_10491789
449 Ga0163163_10053440
450 Ga0163163_10361762
451 Ga0163161_10231873
452 Ga0163161_10392884
453 Ga0207653_10000191
454 Ga0207653_10005220
455 Ga0207653_10050496
456 Ga0207688_10056408
457 Ga0207680_10012506
458 Ga0207685_10000013
459 Ga0207643_10074105
460 Ga0207684_10000146
461 Ga0207684_10001572
462 Ga0207684_10534324
463 Ga0207654_10023870
464 Ga0207654_10225233
465 Ga0207707_10000063
466 Ga0207671_10007315
467 Ga0207660_10000454
468 Ga0207662_10119598
469 Ga0207662_10207093
470 Ga0207652_10000091
471 Ga0207652_10068670
472 Ga0207646_10000546
473 Ga0207646_10002602
474 Ga0207646_10050787
475 Ga0207646_10082182
476 Ga0207646_10082998
477 Ga0207650_10200899
478 Ga0207659_10054299
479 Ga0207644_10081288
480 Ga0207706_10244579
481 Ga0207686_10000006
482 Ga0207709_10000037
483 Ga0207709_10480162
484 Ga0207704_10225423
485 Ga0207665_10012840
486 Ga0207711_10004857
487 Ga0207711_10058983
488 Ga0207711_10208913
489 Ga0207689_10047877
490 Ga0207689_10063580
491 Ga0207689_10153582
492 Ga0207689_10312172
493 Ga0207689_10442190
494 Ga0207679_10333023
495 Ga0207712_10111967
496 Ga0207712_10112841
497 Ga0207658_10061608
498 Ga0207703_10535847
499 Ga0207639_10096511
500 Ga0207708_10034668
501 Ga0207708_10225762
502 Ga0207702_10100307
503 Ga0207641_10175209
504 Ga0207676_10003647
505 Ga0207676_10453408
506 Ga0207676_10468622
507 Ga0207675_100005265
508 Ga0207675_100034414
509 Ga0207675_100696569
510 Ga0209588_1012746
511 Ga0207428_10020460
512 Ga0268265_10082660
513 Ga0268265_10459967
514 Ga0268264_10092568
515 Ga0307405_10264743
516 Ga0307407_10173047
517 Ga0307412_10100405
518 Ga0307409_100128732
519 Ga0307415_100009015
520 Ga0373937_0524600
521 Ga0395905_0090853
522 Ga0436360_1060241
523 Ga0495621_0038018
524 Ga0496102_0052023
525 Ga0496106_0514160
526 Ga0501292_005484
527 Ga0501296_001409
528 Ga0501298_000159
529 Ga0501299_000839
530 Ga0501299_002785
531 Ga0501300_002490
532 Ga0501303_004511
533 Ga0501075_0139258
534 Ga0501075_0216721
535 Ga0501216_009079
536 Ga0501217_013225
537 Ga0501217_013603
538 Ga0501233_009520
539 Ga0501235_012701
540 Ga0501243_004842
541 Ga0501249_011108
542 Ga0501256_003153
543 Ga0501261_007247
544 Ga0501079_0264705
545 Ga0501273_008974
546 Ga0501283_001227
547 Ga0501212_005244
548 Ga0501212_008897
549 nmdc:mga05p37_16866_c1
550 nmdc:mga05p37_202795_c1
551 nmdc:mga05p37_90616_c1
552 nmdc:mga09592_275298_c1
553 nmdc:mga09592_386220_c1
554 nmdc:mga06r32_58250_c2
555 nmdc:mga08y16_27544_c1
556 nmdc:mga08y16_43861_c1
557 nmdc:mga0n895_146512_c1
558 nmdc:mga0n895_14872_c1
559 nmdc:mga08x19_35957_c1
560 nmdc:mga0a205_141940_c1
561 nmdc:mga0a205_349359_c1
562 Ga0501084_0083154

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

183

321

0.97

PF00892

EamA

EamA-like transporter family

36

172

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i20-assembly2.cif.gz_B crystal structure of protein 0.8696 1 290
5i20-assembly3.cif.gz_C crystal structure of protein 0.8617 2 290
5i20-assembly4.cif.gz_D crystal structure of protein 0.8614 1 288
5i20-assembly2.cif.gz_B crystal structure of protein 0.861 1 290
5i20-assembly1.cif.gz_A crystal structure of protein 0.8568 2 291
ID Description Score Start End Superfamily
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7383 1 288 1.20.1740.10
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7376 9 284 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7106 1 288 1.20.1740.10
af_A0A0P0YAS8_28_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7064 3 286 1.20.1740.10
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6844 9 284 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A7Y5K9U6-F1-model_v4 EamA family transporter 0.9864 3 289 GO:0016020
AF-A0A7W1KKL4-F1-model_v4 EamA family transporter 0.9786 3 290 GO:0016020
AF-A0A3M1A2B6-F1-model_v4 EamA domain-containing protein 0.9712 3 285 GO:0016020
AF-T0MPM7-F1-model_v4 DMT superfamily drug/metaboltie permease 0.9633 1 289 GO:0016020
AF-A0A523NBY5-F1-model_v4 EamA domain-containing protein 0.9619 1 293 GO:0016020

Map