F384187
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 281 | 171 | 281 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10015368|Ga0081455_100153687 |
| Length | 266 |
| Sequence | MIRLDTRARASALVLLLFSCVTPKEAPMAAQTAKLYLLEDLDDASKTRQLANSDFAALRTVADWIKSFVTKPHKDLGRDGPVCPFVPEAMQRKTLWLASEHIAGRSVAEVVQLVNGYKAQLLQQPFHGEGVNYNSIVVVFTDLSADRAKGLFDDVLKQLAVPSYVEDGLVMGGFYESNEATAIYNRSFRPFTPPVPFLLMRHAVISDWKFFLDNDDWLNRWAHRYGESGVRALAEELRRLPWRAGATNPTTNELRSGISRQMTLPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 28 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 29 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 30 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 31 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 32 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 33 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 34 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 35 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 36 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 43 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 44 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 45 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 46 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 47 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 104 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 105 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 106 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 107 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 108 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 109 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 110 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 111 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 112 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 113 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 114 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 115 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 116 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 117 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 118 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 119 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 147 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 148 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 149 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 150 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 151 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 152 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 154 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 155 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 156 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 157 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.47 |
| Rhizosphere | 92.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10007947 | 3300003203 | Bacteria | 4826 |
| 2 | JGI25407J50210_10006893 | 3300003373 | Bacteria | 2840 |
| 3 | JGI25407J50210_10016591 | 3300003373 | Bacteria | 1908 |
| 4 | Ga0065715_10197424 | 3300005293 | Bacteria | 1380 |
| 5 | Ga0070670_100313798 | 3300005331 | Bacteria | 1373 |
| 6 | Ga0070682_100078322 | 3300005337 | Unclassified | 2132 |
| 7 | Ga0068868_100045562 | 3300005338 | Bacteria | 3432 |
| 8 | Ga0068868_100477204 | 3300005338 | Unclassified | 1089 |
| 9 | Ga0070660_100345911 | 3300005339 | Unclassified | 1224 |
| 10 | Ga0070689_100141685 | 3300005340 | Unclassified | 1934 |
| 11 | Ga0070687_100352002 | 3300005343 | Unclassified | 951 |
| 12 | Ga0070668_100056837 | 3300005347 | Bacteria | 3022 |
| 13 | Ga0070673_100348006 | 3300005364 | Bacteria | 1315 |
| 14 | Ga0070659_100002973 | 3300005366 | Bacteria | 12077 |
| 15 | Ga0070659_100518912 | 3300005366 | Unclassified | 1017 |
| 16 | Ga0070709_10073522 | 3300005434 | Unclassified | 2213 |
| 17 | Ga0070709_10076233 | 3300005434 | Bacteria | 2177 |
| 18 | Ga0070714_100110427 | 3300005435 | Bacteria | 2434 |
| 19 | Ga0070713_100134782 | 3300005436 | Bacteria | 2181 |
| 20 | Ga0070713_100142509 | 3300005436 | Bacteria | 2124 |
| 21 | Ga0070713_100303388 | 3300005436 | Unclassified | 1470 |
| 22 | Ga0070713_100334640 | 3300005436 | Bacteria | 1401 |
| 23 | Ga0070710_10000696 | 3300005437 | Bacteria | 16002 |
| 24 | Ga0070711_100066310 | 3300005439 | Bacteria | 2528 |
| 25 | Ga0070711_100266769 | 3300005439 | Bacteria | 1349 |
| 26 | Ga0070708_100661763 | 3300005445 | Unclassified | 984 |
| 27 | Ga0070662_100144123 | 3300005457 | Unclassified | 1849 |
| 28 | Ga0068853_100070716 | 3300005539 | Bacteria | 3038 |
| 29 | Ga0070695_100310611 | 3300005545 | Unclassified | 1169 |
| 30 | Ga0070696_100523237 | 3300005546 | Bacteria | 947 |
| 31 | Ga0070704_100327520 | 3300005549 | Bacteria | 1286 |
| 32 | Ga0068855_100088459 | 3300005563 | Bacteria | 3578 |
| 33 | Ga0068857_100202925 | 3300005577 | Bacteria | 1808 |
| 34 | Ga0070702_100068360 | 3300005615 | Unclassified | 2090 |
| 35 | Ga0068859_100052753 | 3300005617 | Unclassified | 4089 |
| 36 | Ga0068859_100116750 | 3300005617 | Bacteria | 2733 |
| 37 | Ga0068859_100540532 | 3300005617 | Unclassified | 1260 |
| 38 | Ga0068864_100053321 | 3300005618 | Bacteria | 3488 |
| 39 | Ga0068864_100100087 | 3300005618 | Unclassified | 2569 |
| 40 | Ga0068864_100464950 | 3300005618 | Unclassified | 1212 |
| 41 | Ga0068861_100041015 | 3300005719 | Bacteria | 3465 |
| 42 | Ga0068863_100080646 | 3300005841 | Bacteria | 3082 |
| 43 | Ga0068863_100113972 | 3300005841 | Bacteria | 2575 |
| 44 | Ga0068863_100601200 | 3300005841 | Unclassified | 1089 |
| 45 | Ga0068858_100030728 | 3300005842 | Bacteria | 4989 |
| 46 | Ga0068858_100477843 | 3300005842 | Unclassified | 1203 |
| 47 | Ga0068860_100198856 | 3300005843 | Unclassified | 1942 |
| 48 | Ga0081455_10015368 | 3300005937 | Bacteria | 7441 |
| 49 | Ga0081455_10084646 | 3300005937 | Plasmid | 2587 |
| 50 | Ga0081455_10156816 | 3300005937 | Bacteria | 1749 |
| 51 | Ga0081538_10000786 | 3300005981 | Bacteria | 34645 |
| 52 | Ga0081538_10002513 | 3300005981 | Bacteria | 17861 |
| 53 | Ga0081538_10005866 | 3300005981 | Bacteria | 10944 |
| 54 | Ga0081538_10028340 | 3300005981 | Bacteria | 3854 |
| 55 | Ga0081538_10031333 | 3300005981 | Bacteria | 3589 |
| 56 | Ga0081538_10033346 | 3300005981 | Bacteria | 3430 |
| 57 | Ga0081538_10036463 | 3300005981 | Bacteria | 3207 |
| 58 | Ga0081538_10039430 | 3300005981 | Plasmid | 3030 |
| 59 | Ga0081538_10050309 | 3300005981 | Bacteria | 2518 |
| 60 | Ga0081538_10050934 | 3300005981 | Bacteria | 2493 |
| 61 | Ga0081538_10052951 | 3300005981 | Bacteria | 2419 |
| 62 | Ga0081538_10104152 | 3300005981 | Bacteria | 1417 |
| 63 | Ga0081540_1025343 | 3300005983 | Bacteria | 3415 |
| 64 | Ga0081539_10001162 | 3300005985 | Bacteria | 47608 |
| 65 | Ga0070717_10054993 | 3300006028 | Bacteria | 3283 |
| 66 | Ga0070717_10165324 | 3300006028 | Unclassified | 1922 |
| 67 | Ga0070716_100013049 | 3300006173 | Bacteria | 4225 |
| 68 | Ga0070716_100123722 | 3300006173 | Bacteria | 1623 |
| 69 | Ga0070712_100071328 | 3300006175 | Bacteria | 2485 |
| 70 | Ga0070712_100185193 | 3300006175 | Bacteria | 1625 |
| 71 | Ga0070712_100257427 | 3300006175 | Unclassified | 1397 |
| 72 | Ga0070712_100721807 | 3300006175 | Bacteria | 851 |
| 73 | Ga0075427_10001049 | 3300006194 | Plasmid | 3458 |
| 74 | Ga0068871_100496090 | 3300006358 | Unclassified | 1100 |
| 75 | Ga0075428_100123983 | 3300006844 | Bacteria | 2812 |
| 76 | Ga0075428_100135565 | 3300006844 | Plasmid | 2677 |
| 77 | Ga0075428_100400400 | 3300006844 | Bacteria | 1471 |
| 78 | Ga0075430_100025078 | 3300006846 | Bacteria | 5073 |
| 79 | Ga0075430_100086416 | 3300006846 | Plasmid | 2625 |
| 80 | Ga0075430_100152013 | 3300006846 | Bacteria | 1927 |
| 81 | Ga0075431_100007321 | 3300006847 | Bacteria | 10990 |
| 82 | Ga0075431_100064002 | 3300006847 | Bacteria | 3797 |
| 83 | Ga0075431_100183859 | 3300006847 | Unclassified | 2144 |
| 84 | Ga0075431_100186490 | 3300006847 | Bacteria | 2127 |
| 85 | Ga0075431_100421685 | 3300006847 | Bacteria | 1334 |
| 86 | Ga0075431_100458049 | 3300006847 | Bacteria | 1270 |
| 87 | Ga0075433_10004396 | 3300006852 | Bacteria | 10965 |
| 88 | Ga0075433_10029223 | 3300006852 | Bacteria | 4694 |
| 89 | Ga0075433_10032083 | 3300006852 | Bacteria | 4496 |
| 90 | Ga0075433_10197342 | 3300006852 | Bacteria | 1790 |
| 91 | Ga0075433_10347137 | 3300006852 | Unclassified | 1312 |
| 92 | Ga0075434_100006817 | 3300006871 | Bacteria | 10507 |
| 93 | Ga0075434_100068155 | 3300006871 | Bacteria | 3544 |
| 94 | Ga0075434_100071459 | 3300006871 | Plasmid | 3462 |
| 95 | Ga0075434_100149622 | 3300006871 | Bacteria | 2355 |
| 96 | Ga0075429_100016742 | 3300006880 | Bacteria | 6349 |
| 97 | Ga0075429_100123103 | 3300006880 | Bacteria | 2267 |
| 98 | Ga0068865_100211180 | 3300006881 | Bacteria | 1513 |
| 99 | Ga0075436_100184090 | 3300006914 | Bacteria | 1477 |
| 100 | Ga0097620_100052754 | 3300006931 | Unclassified | 4089 |
| 101 | Ga0097620_100116752 | 3300006931 | Bacteria | 2733 |
| 102 | Ga0097620_100540550 | 3300006931 | Unclassified | 1260 |
| 103 | Ga0075435_100029290 | 3300007076 | Bacteria | 4320 |
| 104 | Ga0075435_100049246 | 3300007076 | Bacteria | 3388 |
| 105 | Ga0075435_100071716 | 3300007076 | Bacteria | 2829 |
| 106 | Ga0075435_100279162 | 3300007076 | Bacteria | 1426 |
| 107 | Ga0105240_10608617 | 3300009093 | Unclassified | 1202 |
| 108 | Ga0111539_10007370 | 3300009094 | Bacteria | 14093 |
| 109 | Ga0111539_10017073 | 3300009094 | Bacteria | 8985 |
| 110 | Ga0111539_10080483 | 3300009094 | Bacteria | 3832 |
| 111 | Ga0111539_10298350 | 3300009094 | Bacteria | 1876 |
| 112 | Ga0111539_11132403 | 3300009094 | Unclassified | 909 |
| 113 | Ga0105245_10011934 | 3300009098 | Bacteria | 7554 |
| 114 | Ga0105245_10060819 | 3300009098 | Bacteria | 3403 |
| 115 | Ga0105245_10671949 | 3300009098 | Bacteria | 1067 |
| 116 | Ga0105247_10114994 | 3300009101 | Bacteria | 1736 |
| 117 | Ga0114129_10443160 | 3300009147 | Bacteria | 1704 |
| 118 | Ga0105243_10714850 | 3300009148 | Bacteria | 978 |
| 119 | Ga0105241_10274490 | 3300009174 | Bacteria | 1437 |
| 120 | Ga0105241_10345817 | 3300009174 | Unclassified | 1290 |
| 121 | Ga0105241_10655002 | 3300009174 | Unclassified | 954 |
| 122 | Ga0105248_10223618 | 3300009177 | Bacteria | 2119 |
| 123 | Ga0105248_10535013 | 3300009177 | Bacteria | 1322 |
| 124 | Ga0105237_10046897 | 3300009545 | Bacteria | 4344 |
| 125 | Ga0105238_10026466 | 3300009551 | Bacteria | 5915 |
| 126 | Ga0105238_10541579 | 3300009551 | Bacteria | 1168 |
| 127 | Ga0105238_10723761 | 3300009551 | Bacteria | 1008 |
| 128 | Ga0105249_10083344 | 3300009553 | Bacteria | 2976 |
| 129 | Ga0105239_10257044 | 3300010375 | Unclassified | 1963 |
| 130 | Ga0105246_10017433 | 3300011119 | Bacteria | 4564 |
| 131 | Ga0105246_10020363 | 3300011119 | Bacteria | 4253 |
| 132 | Ga0157371_10436855 | 3300013102 | Bacteria | 961 |
| 133 | Ga0157369_10043949 | 3300013105 | Bacteria | 4866 |
| 134 | Ga0157378_10396169 | 3300013297 | Bacteria | 1359 |
| 135 | Ga0163162_10192801 | 3300013306 | Unclassified | 2165 |
| 136 | Ga0163162_10835189 | 3300013306 | Bacteria | 1037 |
| 137 | Ga0163162_11425566 | 3300013306 | Unclassified | 788 |
| 138 | Ga0157372_10125756 | 3300013307 | Bacteria | 2948 |
| 139 | Ga0157375_10167878 | 3300013308 | Unclassified | 2340 |
| 140 | Ga0157376_10091464 | 3300014969 | Bacteria | 2636 |
| 141 | Ga0207653_10066263 | 3300025885 | Bacteria | 1227 |
| 142 | Ga0207692_10029166 | 3300025898 | Bacteria | 2619 |
| 143 | Ga0207692_10047823 | 3300025898 | Unclassified | 2150 |
| 144 | Ga0207710_10180039 | 3300025900 | Unclassified | 1037 |
| 145 | Ga0207688_10044371 | 3300025901 | Bacteria | 2478 |
| 146 | Ga0207680_10471193 | 3300025903 | Unclassified | 892 |
| 147 | Ga0207699_10010259 | 3300025906 | Bacteria | 4694 |
| 148 | Ga0207699_10020516 | 3300025906 | Bacteria | 3544 |
| 149 | Ga0207699_10151507 | 3300025906 | Bacteria | 1535 |
| 150 | Ga0207654_10225001 | 3300025911 | Bacteria | 1246 |
| 151 | Ga0207654_10226541 | 3300025911 | Unclassified | 1243 |
| 152 | Ga0207671_10050064 | 3300025914 | Bacteria | 3093 |
| 153 | Ga0207693_10038239 | 3300025915 | Bacteria | 3780 |
| 154 | Ga0207663_10213798 | 3300025916 | Unclassified | 1399 |
| 155 | Ga0207662_10115680 | 3300025918 | Bacteria | 1676 |
| 156 | Ga0207657_10058755 | 3300025919 | Bacteria | 3308 |
| 157 | Ga0207650_10224909 | 3300025925 | Bacteria | 1512 |
| 158 | Ga0207687_10066548 | 3300025927 | Bacteria | 2561 |
| 159 | Ga0207700_10003863 | 3300025928 | Bacteria | 8754 |
| 160 | Ga0207700_10134788 | 3300025928 | Bacteria | 2021 |
| 161 | Ga0207664_10059130 | 3300025929 | Bacteria | 3051 |
| 162 | Ga0207664_10206657 | 3300025929 | Unclassified | 1697 |
| 163 | Ga0207690_10452451 | 3300025932 | Bacteria | 1032 |
| 164 | Ga0207670_10133485 | 3300025936 | Unclassified | 1822 |
| 165 | Ga0207670_10811267 | 3300025936 | Bacteria | 780 |
| 166 | Ga0207669_10642962 | 3300025937 | Unclassified | 867 |
| 167 | Ga0207665_10060731 | 3300025939 | Bacteria | 2560 |
| 168 | Ga0207711_10348492 | 3300025941 | Unclassified | 1371 |
| 169 | Ga0207711_10490221 | 3300025941 | Bacteria | 1145 |
| 170 | Ga0207689_10269253 | 3300025942 | Unclassified | 1410 |
| 171 | Ga0207667_10170471 | 3300025949 | Bacteria | 2237 |
| 172 | Ga0207712_10794100 | 3300025961 | Bacteria | 832 |
| 173 | Ga0207668_10055518 | 3300025972 | Bacteria | 2754 |
| 174 | Ga0207677_10180876 | 3300026023 | Bacteria | 1659 |
| 175 | Ga0207641_10143232 | 3300026088 | Bacteria | 2159 |
| 176 | Ga0207641_10186183 | 3300026088 | Bacteria | 1905 |
| 177 | Ga0207648_10707339 | 3300026089 | Bacteria | 934 |
| 178 | Ga0207676_10112668 | 3300026095 | Bacteria | 2279 |
| 179 | Ga0207674_10023433 | 3300026116 | Bacteria | 6613 |
| 180 | Ga0207675_100062492 | 3300026118 | Bacteria | 3478 |
| 181 | Ga0207675_101323503 | 3300026118 | Bacteria | 741 |
| 182 | Ga0207428_10014169 | 3300027907 | Bacteria | 6940 |
| 183 | Ga0207428_10043243 | 3300027907 | Plasmid | 3640 |
| 184 | Ga0207428_10116374 | 3300027907 | Bacteria | 2053 |
| 185 | Ga0207428_10224778 | 3300027907 | Bacteria | 1406 |
| 186 | Ga0307412_10114769 | 3300031911 | Bacteria | 1929 |
| 187 | Ga0373940_0066311 | 3300035088 | Bacteria | 1043 |
| 188 | Ga0373949_0039869 | 3300035090 | Unclassified | 1151 |
| 189 | Ga0373943_0027324 | 3300035170 | Bacteria | 2680 |
| 190 | Ga0373946_0015940 | 3300035171 | Bacteria | 2857 |
| 191 | Ga0373931_0065554 | 3300035691 | Bacteria | 1968 |
| 192 | Ga0373935_0016849 | 3300035692 | Bacteria | 4424 |
| 193 | Ga0373937_0146032 | 3300036401 | Bacteria | 2214 |
| 194 | Ga0373925_0035403 | 3300037068 | Bacteria | 3683 |
| 195 | Ga0395899_0038686 | 3300037312 | Bacteria | 3572 |
| 196 | Ga0395900_0020901 | 3300037418 | Bacteria | 6688 |
| 197 | Ga0395898_0430372 | 3300037466 | Bacteria | 1257 |
| 198 | Ga0395905_0025487 | 3300037471 | Bacteria | 5577 |
| 199 | Ga0395901_0027019 | 3300038443 | Bacteria | 5894 |
| 200 | Ga0439440_0005145 | 3300042993 | Bacteria | 2585 |
| 201 | Ga0495629_0005123 | 3300046459 | Bacteria | 9798 |
| 202 | Ga0495651_0056155 | 3300046462 | Bacteria | 3025 |
| 203 | Ga0495653_0029614 | 3300046463 | Bacteria | 4368 |
| 204 | Ga0495582_0012789 | 3300046473 | Bacteria | 4624 |
| 205 | Ga0495639_0002453 | 3300046475 | Bacteria | 8103 |
| 206 | Ga0495662_0013057 | 3300046476 | Bacteria | 4046 |
| 207 | Ga0495594_0036390 | 3300046499 | Bacteria | 2684 |
| 208 | Ga0495608_0027797 | 3300046511 | Bacteria | 3847 |
| 209 | Ga0495618_0008815 | 3300046514 | Bacteria | 6090 |
| 210 | Ga0495630_0009265 | 3300046517 | Bacteria | 7078 |
| 211 | Ga0495652_0027079 | 3300046529 | Bacteria | 5054 |
| 212 | Ga0495665_0056956 | 3300046531 | Bacteria | 2063 |
| 213 | Ga0495640_0010795 | 3300046533 | Bacteria | 7046 |
| 214 | Ga0495667_0005702 | 3300046559 | Bacteria | 8430 |
| 215 | Ga0495634_0012727 | 3300046642 | Bacteria | 6090 |
| 216 | Ga0495635_0003847 | 3300046663 | Bacteria | 10429 |
| 217 | Ga0495646_0133388 | 3300046680 | Bacteria | 1396 |
| 218 | Ga0495647_0008816 | 3300046681 | Bacteria | 3398 |
| 219 | Ga0495658_0011399 | 3300046683 | Bacteria | 4470 |
| 220 | Ga0495600_0005670 | 3300046809 | Bacteria | 7541 |
| 221 | Ga0495581_0017178 | 3300047315 | Bacteria | 4205 |
| 222 | Ga0495604_0005670 | 3300047317 | Bacteria | 9902 |
| 223 | Ga0495674_0028628 | 3300047319 | Bacteria | 5076 |
| 224 | Ga0495680_0008920 | 3300047322 | Bacteria | 9067 |
| 225 | Ga0495684_0002154 | 3300047471 | Bacteria | 15772 |
| 226 | Ga0495593_0036978 | 3300047673 | Bacteria | 2644 |
| 227 | Ga0496101_0360039 | 3300048904 | Bacteria | 1144 |
| 228 | Ga0496102_0186141 | 3300048905 | Bacteria | 1957 |
| 229 | Ga0496102_0845897 | 3300048905 | Unclassified | 837 |
| 230 | Ga0496104_0015962 | 3300048907 | Bacteria | 6817 |
| 231 | Ga0496105_0003161 | 3300048908 | Bacteria | 12131 |
| 232 | Ga0496105_0015965 | 3300048908 | Bacteria | 5990 |
| 233 | Ga0496105_0040576 | 3300048908 | Bacteria | 3838 |
| 234 | Ga0496106_0013581 | 3300048909 | Bacteria | 6012 |
| 235 | Ga0496107_0283810 | 3300048910 | Bacteria | 1232 |
| 236 | Ga0496108_0097728 | 3300048911 | Bacteria | 2502 |
| 237 | Ga0496108_0382594 | 3300048911 | Unclassified | 1229 |
| 238 | Ga0496109_0079036 | 3300048912 | Bacteria | 3030 |
| 239 | Ga0496109_0225511 | 3300048912 | Bacteria | 1763 |
| 240 | Ga0496109_0463749 | 3300048912 | Bacteria | 1196 |
| 241 | Ga0496110_0041962 | 3300048913 | Bacteria | 3993 |
| 242 | Ga0496110_0888914 | 3300048913 | Unclassified | 797 |
| 243 | Ga0496112_0008749 | 3300048915 | Bacteria | 9081 |
| 244 | Ga0496112_0031877 | 3300048915 | Bacteria | 5115 |
| 245 | Ga0496112_0040620 | 3300048915 | Bacteria | 4549 |
| 246 | Ga0496114_0785083 | 3300048917 | Bacteria | 831 |
| 247 | Ga0496115_0480706 | 3300048918 | Bacteria | 1000 |
| 248 | Ga0501072_0200585 | 3300049588 | Unclassified | 1591 |
| 249 | Ga0501081_0167387 | 3300049743 | Unclassified | 1586 |
| 250 | nmdc:mga05p37_237018_c1 | 3300050507 | Bacteria | 2196 |
| 251 | nmdc:mga05p37_365441_c1 | 3300050507 | Bacteria | 1695 |
| 252 | nmdc:mga05p37_91806_c1 | 3300050507 | Plasmid | 3742 |
| 253 | nmdc:mga09592_33693_c1 | 3300050508 | Bacteria | 4278 |
| 254 | nmdc:mga09592_3531_c1 | 3300050508 | Bacteria | 12624 |
| 255 | nmdc:mga09592_427937_c1 | 3300050508 | Bacteria | 1143 |
| 256 | nmdc:mga0qj67_13019_c1 | 3300050509 | Bacteria | 6279 |
| 257 | nmdc:mga06r32_200419_c1 | 3300050510 | Bacteria | 1984 |
| 258 | nmdc:mga06r32_27346_c1 | 3300050510 | Bacteria | 5328 |
| 259 | nmdc:mga06r32_4258_c1 | 3300050510 | Bacteria | 12812 |
| 260 | nmdc:mga08y16_1312_c1 | 3300050511 | Bacteria | 24699 |
| 261 | nmdc:mga08y16_264064_c1 | 3300050511 | Bacteria | 1778 |
| 262 | nmdc:mga08y16_476985_c1 | 3300050511 | Bacteria | 1270 |
| 263 | nmdc:mga08y16_572115_c1 | 3300050511 | Unclassified | 1142 |
| 264 | nmdc:mga0n895_161648_c1 | 3300050512 | Bacteria | 2271 |
| 265 | nmdc:mga0n895_200085_c1 | 3300050512 | Bacteria | 2029 |
| 266 | nmdc:mga0n895_36554_c1 | 3300050512 | Bacteria | 4743 |
| 267 | nmdc:mga0n895_865451_c1 | 3300050512 | Unclassified | 891 |
| 268 | nmdc:mga0rr50_248364_c1 | 3300050513 | Unclassified | 1477 |
| 269 | nmdc:mga0rr50_249247_c1 | 3300050513 | Bacteria | 1474 |
| 270 | nmdc:mga0rr50_37338_c1 | 3300050513 | Plasmid | 3506 |
| 271 | nmdc:mga0rr50_55147_c1 | 3300050513 | Plasmid | 2964 |
| 272 | nmdc:mga08x19_430644_c1 | 3300050514 | Bacteria | 927 |
| 273 | nmdc:mga0a205_193745_c1 | 3300050515 | Bacteria | 1924 |
| 274 | nmdc:mga0a205_334512_c1 | 3300050515 | Unclassified | 1384 |
| 275 | nmdc:mga0a205_36955_c1 | 3300050515 | Bacteria | 4695 |
| 276 | nmdc:mga0a205_5850_c1 | 3300050515 | Bacteria | 11077 |
| 277 | nmdc:mga0a205_60537_c1 | 3300050515 | Bacteria | 3656 |
| 278 | Ga0495601_0017027 | 3300053077 | Bacteria | 4409 |
| 279 | Ga0495595_0000365 | 3300053084 | Bacteria | 17161 |
| 280 | Ga0495619_0001344 | 3300053085 | Bacteria | 16121 |
| 281 | Ga0530510_0109241 | 3300061734 | Unclassified | 2025 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005983 | Ga0081540_1025343 | Ga0081540_10253434 | 214 |
| 2 | 3300006852 | Ga0075433_10197342 | Ga0075433_101973422 | 214 |
| 3 | 3300006871 | Ga0075434_100149622 | Ga0075434_1001496222 | 214 |
| 4 | 3300007076 | Ga0075435_100279162 | Ga0075435_1002791621 | 214 |
| 5 | 3300009094 | Ga0111539_10080483 | Ga0111539_100804835 | 214 |
| 6 | 3300027907 | Ga0207428_10224778 | Ga0207428_102247781 | 214 |
| 7 | 3300050511 | nmdc:mga08y16_476985_c1 | nmdc:mga08y16_476985_c1_259_1014 | 214 |
| 8 | 3300050515 | nmdc:mga0a205_193745_c1 | nmdc:mga0a205_193745_c1_390_1145 | 214 |
| 9 | 3300009093 | Ga0105240_10608617 | Ga0105240_106086172 | 217 |
| 10 | 3300009098 | Ga0105245_10011934 | Ga0105245_100119345 | 217 |
| 11 | 3300009148 | Ga0105243_10714850 | Ga0105243_107148501 | 217 |
| 12 | 3300009174 | Ga0105241_10345817 | Ga0105241_103458172 | 217 |
| 13 | 3300009177 | Ga0105248_10223618 | Ga0105248_102236182 | 217 |
| 14 | 3300009545 | Ga0105237_10046897 | Ga0105237_100468973 | 217 |
| 15 | 3300009551 | Ga0105238_10026466 | Ga0105238_100264663 | 217 |
| 16 | 3300009553 | Ga0105249_10083344 | Ga0105249_100833442 | 217 |
| 17 | 3300010375 | Ga0105239_10257044 | Ga0105239_102570441 | 217 |
| 18 | 3300011119 | Ga0105246_10017433 | Ga0105246_100174334 | 217 |
| 19 | 3300013102 | Ga0157371_10436855 | Ga0157371_104368551 | 217 |
| 20 | 3300013105 | Ga0157369_10043949 | Ga0157369_100439491 | 217 |
| 21 | 3300013306 | Ga0163162_10192801 | Ga0163162_101928012 | 217 |
| 22 | 3300013307 | Ga0157372_10125756 | Ga0157372_101257564 | 217 |
| 23 | 3300013308 | Ga0157375_10167878 | Ga0157375_101678782 | 217 |
| 24 | 3300014969 | Ga0157376_10091464 | Ga0157376_100914641 | 217 |
| 25 | 3300035090 | Ga0373949_0039869 | Ga0373949_0039869_482_1135 | 217 |
| 26 | 3300048905 | Ga0496102_0845897 | Ga0496102_0845897_51_704 | 217 |
| 27 | 3300048912 | Ga0496109_0079036 | Ga0496109_0079036_1215_1868 | 217 |
| 28 | 3300050512 | nmdc:mga0n895_161648_c1 | nmdc:mga0n895_161648_c1_670_1323 | 217 |
| 29 | 3300050513 | nmdc:mga0rr50_55147_c1 | nmdc:mga0rr50_55147_c1_2051_2704 | 217 |
| 30 | 3300037312 | Ga0395899_0038686 | Ga0395899_0038686_2548_3231 | 218 |
| 31 | 3300037466 | Ga0395898_0430372 | Ga0395898_0430372_206_889 | 218 |
| 32 | 3300037471 | Ga0395905_0025487 | Ga0395905_0025487_452_1135 | 218 |
| 33 | 3300048905 | Ga0496102_0186141 | Ga0496102_0186141_562_1221 | 218 |
| 34 | 3300005618 | Ga0068864_100464950 | Ga0068864_1004649502 | 219 |
| 35 | 3300006175 | Ga0070712_100071328 | Ga0070712_1000713283 | 219 |
| 36 | 3300006844 | Ga0075428_100400400 | Ga0075428_1004004002 | 219 |
| 37 | 3300009094 | Ga0111539_10298350 | Ga0111539_102983502 | 219 |
| 38 | 3300013306 | Ga0163162_11425566 | Ga0163162_114255661 | 219 |
| 39 | 3300025898 | Ga0207692_10047823 | Ga0207692_100478231 | 219 |
| 40 | 3300048911 | Ga0496108_0382594 | Ga0496108_0382594_67_744 | 219 |
| 41 | 3300048912 | Ga0496109_0225511 | Ga0496109_0225511_94_756 | 219 |
| 42 | 3300048913 | Ga0496110_0888914 | Ga0496110_0888914_16_693 | 219 |
| 43 | 3300003373 | JGI25407J50210_10006893 | JGI25407J50210_100068932 | 220 |
| 44 | 3300003373 | JGI25407J50210_10016591 | JGI25407J50210_100165912 | 220 |
| 45 | 3300005293 | Ga0065715_10197424 | Ga0065715_101974242 | 220 |
| 46 | 3300005331 | Ga0070670_100313798 | Ga0070670_1003137982 | 220 |
| 47 | 3300005337 | Ga0070682_100078322 | Ga0070682_1000783222 | 220 |
| 48 | 3300005338 | Ga0068868_100045562 | Ga0068868_1000455622 | 220 |
| 49 | 3300005338 | Ga0068868_100477204 | Ga0068868_1004772042 | 220 |
| 50 | 3300005339 | Ga0070660_100345911 | Ga0070660_1003459111 | 220 |
| 51 | 3300005343 | Ga0070687_100352002 | Ga0070687_1003520021 | 220 |
| 52 | 3300005347 | Ga0070668_100056837 | Ga0070668_1000568372 | 220 |
| 53 | 3300005364 | Ga0070673_100348006 | Ga0070673_1003480062 | 220 |
| 54 | 3300005366 | Ga0070659_100002973 | Ga0070659_1000029734 | 220 |
| 55 | 3300005366 | Ga0070659_100518912 | Ga0070659_1005189121 | 220 |
| 56 | 3300005434 | Ga0070709_10073522 | Ga0070709_100735222 | 220 |
| 57 | 3300005434 | Ga0070709_10076233 | Ga0070709_100762333 | 220 |
| 58 | 3300005435 | Ga0070714_100110427 | Ga0070714_1001104272 | 220 |
| 59 | 3300005436 | Ga0070713_100134782 | Ga0070713_1001347822 | 220 |
| 60 | 3300005436 | Ga0070713_100142509 | Ga0070713_1001425092 | 220 |
| 61 | 3300005436 | Ga0070713_100303388 | Ga0070713_1003033882 | 220 |
| 62 | 3300005436 | Ga0070713_100334640 | Ga0070713_1003346402 | 220 |
| 63 | 3300005437 | Ga0070710_10000696 | Ga0070710_1000069617 | 220 |
| 64 | 3300005439 | Ga0070711_100066310 | Ga0070711_1000663104 | 220 |
| 65 | 3300005439 | Ga0070711_100266769 | Ga0070711_1002667692 | 220 |
| 66 | 3300005445 | Ga0070708_100661763 | Ga0070708_1006617632 | 220 |
| 67 | 3300005457 | Ga0070662_100144123 | Ga0070662_1001441232 | 220 |
| 68 | 3300005539 | Ga0068853_100070716 | Ga0068853_1000707162 | 220 |
| 69 | 3300005545 | Ga0070695_100310611 | Ga0070695_1003106111 | 220 |
| 70 | 3300005546 | Ga0070696_100523237 | Ga0070696_1005232371 | 220 |
| 71 | 3300005549 | Ga0070704_100327520 | Ga0070704_1003275201 | 220 |
| 72 | 3300005563 | Ga0068855_100088459 | Ga0068855_1000884594 | 220 |
| 73 | 3300005577 | Ga0068857_100202925 | Ga0068857_1002029252 | 220 |
| 74 | 3300005615 | Ga0070702_100068360 | Ga0070702_1000683601 | 220 |
| 75 | 3300005617 | Ga0068859_100116750 | Ga0068859_1001167502 | 220 |
| 76 | 3300005617 | Ga0068859_100540532 | Ga0068859_1005405322 | 220 |
| 77 | 3300005618 | Ga0068864_100053321 | Ga0068864_1000533212 | 220 |
| 78 | 3300005719 | Ga0068861_100041015 | Ga0068861_1000410152 | 220 |
| 79 | 3300005841 | Ga0068863_100080646 | Ga0068863_1000806464 | 220 |
| 80 | 3300005841 | Ga0068863_100113972 | Ga0068863_1001139722 | 220 |
| 81 | 3300005841 | Ga0068863_100601200 | Ga0068863_1006012001 | 220 |
| 82 | 3300005842 | Ga0068858_100030728 | Ga0068858_1000307282 | 220 |
| 83 | 3300005842 | Ga0068858_100477843 | Ga0068858_1004778431 | 220 |
| 84 | 3300005843 | Ga0068860_100198856 | Ga0068860_1001988561 | 220 |
| 85 | 3300005937 | Ga0081455_10015368 | Ga0081455_100153687 | 220 |
| 86 | 3300005937 | Ga0081455_10084646 | Ga0081455_100846462 | 220 |
| 87 | 3300005937 | Ga0081455_10156816 | Ga0081455_101568162 | 220 |
| 88 | 3300005981 | Ga0081538_10000786 | Ga0081538_1000078618 | 220 |
| 89 | 3300005981 | Ga0081538_10005866 | Ga0081538_100058662 | 220 |
| 90 | 3300005981 | Ga0081538_10028340 | Ga0081538_100283406 | 220 |
| 91 | 3300005981 | Ga0081538_10031333 | Ga0081538_100313333 | 220 |
| 92 | 3300005981 | Ga0081538_10033346 | Ga0081538_100333465 | 220 |
| 93 | 3300005981 | Ga0081538_10036463 | Ga0081538_100364634 | 220 |
| 94 | 3300005981 | Ga0081538_10039430 | Ga0081538_100394302 | 220 |
| 95 | 3300005981 | Ga0081538_10050309 | Ga0081538_100503093 | 220 |
| 96 | 3300005981 | Ga0081538_10050934 | Ga0081538_100509341 | 220 |
| 97 | 3300005981 | Ga0081538_10052951 | Ga0081538_100529512 | 220 |
| 98 | 3300005981 | Ga0081538_10104152 | Ga0081538_101041522 | 220 |
| 99 | 3300006028 | Ga0070717_10054993 | Ga0070717_100549933 | 220 |
| 100 | 3300006028 | Ga0070717_10165324 | Ga0070717_101653242 | 220 |
| 101 | 3300006173 | Ga0070716_100123722 | Ga0070716_1001237221 | 220 |
| 102 | 3300006175 | Ga0070712_100185193 | Ga0070712_1001851932 | 220 |
| 103 | 3300006175 | Ga0070712_100257427 | Ga0070712_1002574271 | 220 |
| 104 | 3300006175 | Ga0070712_100721807 | Ga0070712_1007218072 | 220 |
| 105 | 3300006194 | Ga0075427_10001049 | Ga0075427_100010494 | 220 |
| 106 | 3300006358 | Ga0068871_100496090 | Ga0068871_1004960901 | 220 |
| 107 | 3300006844 | Ga0075428_100123983 | Ga0075428_1001239832 | 220 |
| 108 | 3300006844 | Ga0075428_100135565 | Ga0075428_1001355651 | 220 |
| 109 | 3300006846 | Ga0075430_100025078 | Ga0075430_1000250784 | 220 |
| 110 | 3300006846 | Ga0075430_100086416 | Ga0075430_1000864163 | 220 |
| 111 | 3300006846 | Ga0075430_100152013 | Ga0075430_1001520131 | 220 |
| 112 | 3300006847 | Ga0075431_100007321 | Ga0075431_1000073217 | 220 |
| 113 | 3300006847 | Ga0075431_100064002 | Ga0075431_1000640022 | 220 |
| 114 | 3300006847 | Ga0075431_100183859 | Ga0075431_1001838591 | 220 |
| 115 | 3300006847 | Ga0075431_100186490 | Ga0075431_1001864903 | 220 |
| 116 | 3300006847 | Ga0075431_100421685 | Ga0075431_1004216852 | 220 |
| 117 | 3300006847 | Ga0075431_100458049 | Ga0075431_1004580492 | 220 |
| 118 | 3300006852 | Ga0075433_10004396 | Ga0075433_100043968 | 220 |
| 119 | 3300006852 | Ga0075433_10029223 | Ga0075433_100292234 | 220 |
| 120 | 3300006852 | Ga0075433_10032083 | Ga0075433_100320833 | 220 |
| 121 | 3300006852 | Ga0075433_10347137 | Ga0075433_103471372 | 220 |
| 122 | 3300006871 | Ga0075434_100006817 | Ga0075434_1000068176 | 220 |
| 123 | 3300006871 | Ga0075434_100068155 | Ga0075434_1000681552 | 220 |
| 124 | 3300006871 | Ga0075434_100071459 | Ga0075434_1000714592 | 220 |
| 125 | 3300006880 | Ga0075429_100016742 | Ga0075429_1000167424 | 220 |
| 126 | 3300006880 | Ga0075429_100123103 | Ga0075429_1001231032 | 220 |
| 127 | 3300006881 | Ga0068865_100211180 | Ga0068865_1002111802 | 220 |
| 128 | 3300006914 | Ga0075436_100184090 | Ga0075436_1001840903 | 220 |
| 129 | 3300006931 | Ga0097620_100116752 | Ga0097620_1001167522 | 220 |
| 130 | 3300006931 | Ga0097620_100540550 | Ga0097620_1005405502 | 220 |
| 131 | 3300007076 | Ga0075435_100029290 | Ga0075435_1000292904 | 220 |
| 132 | 3300007076 | Ga0075435_100049246 | Ga0075435_1000492462 | 220 |
| 133 | 3300007076 | Ga0075435_100071716 | Ga0075435_1000717162 | 220 |
| 134 | 3300009094 | Ga0111539_10007370 | Ga0111539_100073703 | 220 |
| 135 | 3300009094 | Ga0111539_10017073 | Ga0111539_100170732 | 220 |
| 136 | 3300009094 | Ga0111539_11132403 | Ga0111539_111324032 | 220 |
| 137 | 3300009098 | Ga0105245_10060819 | Ga0105245_100608192 | 220 |
| 138 | 3300009098 | Ga0105245_10671949 | Ga0105245_106719491 | 220 |
| 139 | 3300009101 | Ga0105247_10114994 | Ga0105247_101149941 | 220 |
| 140 | 3300009147 | Ga0114129_10443160 | Ga0114129_104431603 | 220 |
| 141 | 3300009174 | Ga0105241_10274490 | Ga0105241_102744902 | 220 |
| 142 | 3300009174 | Ga0105241_10655002 | Ga0105241_106550021 | 220 |
| 143 | 3300009177 | Ga0105248_10535013 | Ga0105248_105350132 | 220 |
| 144 | 3300009551 | Ga0105238_10541579 | Ga0105238_105415791 | 220 |
| 145 | 3300009551 | Ga0105238_10723761 | Ga0105238_107237611 | 220 |
| 146 | 3300011119 | Ga0105246_10020363 | Ga0105246_100203632 | 220 |
| 147 | 3300013297 | Ga0157378_10396169 | Ga0157378_103961692 | 220 |
| 148 | 3300013306 | Ga0163162_10835189 | Ga0163162_108351891 | 220 |
| 149 | 3300025885 | Ga0207653_10066263 | Ga0207653_100662631 | 220 |
| 150 | 3300025898 | Ga0207692_10029166 | Ga0207692_100291661 | 220 |
| 151 | 3300025900 | Ga0207710_10180039 | Ga0207710_101800391 | 220 |
| 152 | 3300025901 | Ga0207688_10044371 | Ga0207688_100443713 | 220 |
| 153 | 3300025903 | Ga0207680_10471193 | Ga0207680_104711931 | 220 |
| 154 | 3300025906 | Ga0207699_10010259 | Ga0207699_100102592 | 220 |
| 155 | 3300025906 | Ga0207699_10020516 | Ga0207699_100205162 | 220 |
| 156 | 3300025906 | Ga0207699_10151507 | Ga0207699_101515073 | 220 |
| 157 | 3300025911 | Ga0207654_10225001 | Ga0207654_102250011 | 220 |
| 158 | 3300025911 | Ga0207654_10226541 | Ga0207654_102265412 | 220 |
| 159 | 3300025914 | Ga0207671_10050064 | Ga0207671_100500642 | 220 |
| 160 | 3300025915 | Ga0207693_10038239 | Ga0207693_100382392 | 220 |
| 161 | 3300025916 | Ga0207663_10213798 | Ga0207663_102137981 | 220 |
| 162 | 3300025918 | Ga0207662_10115680 | Ga0207662_101156802 | 220 |
| 163 | 3300025919 | Ga0207657_10058755 | Ga0207657_100587553 | 220 |
| 164 | 3300025925 | Ga0207650_10224909 | Ga0207650_102249092 | 220 |
| 165 | 3300025927 | Ga0207687_10066548 | Ga0207687_100665482 | 220 |
| 166 | 3300025928 | Ga0207700_10003863 | Ga0207700_100038639 | 220 |
| 167 | 3300025928 | Ga0207700_10134788 | Ga0207700_101347882 | 220 |
| 168 | 3300025929 | Ga0207664_10059130 | Ga0207664_100591302 | 220 |
| 169 | 3300025929 | Ga0207664_10206657 | Ga0207664_102066571 | 220 |
| 170 | 3300025932 | Ga0207690_10452451 | Ga0207690_104524511 | 220 |
| 171 | 3300025936 | Ga0207670_10811267 | Ga0207670_108112671 | 220 |
| 172 | 3300025937 | Ga0207669_10642962 | Ga0207669_106429621 | 220 |
| 173 | 3300025939 | Ga0207665_10060731 | Ga0207665_100607314 | 220 |
| 174 | 3300025941 | Ga0207711_10348492 | Ga0207711_103484921 | 220 |
| 175 | 3300025941 | Ga0207711_10490221 | Ga0207711_104902212 | 220 |
| 176 | 3300025942 | Ga0207689_10269253 | Ga0207689_102692532 | 220 |
| 177 | 3300025949 | Ga0207667_10170471 | Ga0207667_101704712 | 220 |
| 178 | 3300025961 | Ga0207712_10794100 | Ga0207712_107941002 | 220 |
| 179 | 3300025972 | Ga0207668_10055518 | Ga0207668_100555185 | 220 |
| 180 | 3300026023 | Ga0207677_10180876 | Ga0207677_101808762 | 220 |
| 181 | 3300026088 | Ga0207641_10143232 | Ga0207641_101432322 | 220 |
| 182 | 3300026088 | Ga0207641_10186183 | Ga0207641_101861832 | 220 |
| 183 | 3300026089 | Ga0207648_10707339 | Ga0207648_107073392 | 220 |
| 184 | 3300026095 | Ga0207676_10112668 | Ga0207676_101126682 | 220 |
| 185 | 3300026116 | Ga0207674_10023433 | Ga0207674_100234336 | 220 |
| 186 | 3300026118 | Ga0207675_100062492 | Ga0207675_1000624922 | 220 |
| 187 | 3300026118 | Ga0207675_101323503 | Ga0207675_1013235031 | 220 |
| 188 | 3300027907 | Ga0207428_10014169 | Ga0207428_100141698 | 220 |
| 189 | 3300027907 | Ga0207428_10043243 | Ga0207428_100432431 | 220 |
| 190 | 3300027907 | Ga0207428_10116374 | Ga0207428_101163742 | 220 |
| 191 | 3300031911 | Ga0307412_10114769 | Ga0307412_101147693 | 220 |
| 192 | 3300035088 | Ga0373940_0066311 | Ga0373940_0066311_110_859 | 220 |
| 193 | 3300035170 | Ga0373943_0027324 | Ga0373943_0027324_622_1287 | 220 |
| 194 | 3300035171 | Ga0373946_0015940 | Ga0373946_0015940_595_1260 | 220 |
| 195 | 3300035691 | Ga0373931_0065554 | Ga0373931_0065554_1032_1694 | 220 |
| 196 | 3300035692 | Ga0373935_0016849 | Ga0373935_0016849_1693_2358 | 220 |
| 197 | 3300036401 | Ga0373937_0146032 | Ga0373937_0146032_505_1170 | 220 |
| 198 | 3300037068 | Ga0373925_0035403 | Ga0373925_0035403_498_1163 | 220 |
| 199 | 3300037418 | Ga0395900_0020901 | Ga0395900_0020901_4947_5636 | 220 |
| 200 | 3300038443 | Ga0395901_0027019 | Ga0395901_0027019_206_895 | 220 |
| 201 | 3300042993 | Ga0439440_0005145 | Ga0439440_0005145_1771_2436 | 220 |
| 202 | 3300046459 | Ga0495629_0005123 | Ga0495629_0005123_5425_6090 | 220 |
| 203 | 3300046462 | Ga0495651_0056155 | Ga0495651_0056155_867_1532 | 220 |
| 204 | 3300046463 | Ga0495653_0029614 | Ga0495653_0029614_2398_3063 | 220 |
| 205 | 3300046473 | Ga0495582_0012789 | Ga0495582_0012789_1676_2341 | 220 |
| 206 | 3300046475 | Ga0495639_0002453 | Ga0495639_0002453_6845_7510 | 220 |
| 207 | 3300046476 | Ga0495662_0013057 | Ga0495662_0013057_3138_3803 | 220 |
| 208 | 3300046499 | Ga0495594_0036390 | Ga0495594_0036390_613_1278 | 220 |
| 209 | 3300046511 | Ga0495608_0027797 | Ga0495608_0027797_2750_3415 | 220 |
| 210 | 3300046514 | Ga0495618_0008815 | Ga0495618_0008815_1697_2362 | 220 |
| 211 | 3300046517 | Ga0495630_0009265 | Ga0495630_0009265_5207_5872 | 220 |
| 212 | 3300046529 | Ga0495652_0027079 | Ga0495652_0027079_1862_2527 | 220 |
| 213 | 3300046531 | Ga0495665_0056956 | Ga0495665_0056956_1135_1800 | 220 |
| 214 | 3300046533 | Ga0495640_0010795 | Ga0495640_0010795_5169_5834 | 220 |
| 215 | 3300046559 | Ga0495667_0005702 | Ga0495667_0005702_1643_2308 | 220 |
| 216 | 3300046642 | Ga0495634_0012727 | Ga0495634_0012727_1697_2362 | 220 |
| 217 | 3300046663 | Ga0495635_0003847 | Ga0495635_0003847_3043_3708 | 220 |
| 218 | 3300046680 | Ga0495646_0133388 | Ga0495646_0133388_20_685 | 220 |
| 219 | 3300046681 | Ga0495647_0008816 | Ga0495647_0008816_1210_1875 | 220 |
| 220 | 3300046683 | Ga0495658_0011399 | Ga0495658_0011399_2399_3064 | 220 |
| 221 | 3300046809 | Ga0495600_0005670 | Ga0495600_0005670_199_864 | 220 |
| 222 | 3300047315 | Ga0495581_0017178 | Ga0495581_0017178_3056_3721 | 220 |
| 223 | 3300047317 | Ga0495604_0005670 | Ga0495604_0005670_4828_5493 | 220 |
| 224 | 3300047319 | Ga0495674_0028628 | Ga0495674_0028628_1804_2469 | 220 |
| 225 | 3300047322 | Ga0495680_0008920 | Ga0495680_0008920_6527_7192 | 220 |
| 226 | 3300047471 | Ga0495684_0002154 | Ga0495684_0002154_8244_8909 | 220 |
| 227 | 3300047673 | Ga0495593_0036978 | Ga0495593_0036978_616_1281 | 220 |
| 228 | 3300048904 | Ga0496101_0360039 | Ga0496101_0360039_367_1029 | 220 |
| 229 | 3300048907 | Ga0496104_0015962 | Ga0496104_0015962_254_916 | 220 |
| 230 | 3300048908 | Ga0496105_0003161 | Ga0496105_0003161_3546_4208 | 220 |
| 231 | 3300048908 | Ga0496105_0015965 | Ga0496105_0015965_4826_5488 | 220 |
| 232 | 3300048908 | Ga0496105_0040576 | Ga0496105_0040576_821_1483 | 220 |
| 233 | 3300048909 | Ga0496106_0013581 | Ga0496106_0013581_4974_5642 | 220 |
| 234 | 3300048910 | Ga0496107_0283810 | Ga0496107_0283810_552_1217 | 220 |
| 235 | 3300048911 | Ga0496108_0097728 | Ga0496108_0097728_923_1588 | 220 |
| 236 | 3300048912 | Ga0496109_0463749 | Ga0496109_0463749_392_1057 | 220 |
| 237 | 3300048913 | Ga0496110_0041962 | Ga0496110_0041962_528_1193 | 220 |
| 238 | 3300048915 | Ga0496112_0008749 | Ga0496112_0008749_357_1019 | 220 |
| 239 | 3300048915 | Ga0496112_0031877 | Ga0496112_0031877_3816_4481 | 220 |
| 240 | 3300048915 | Ga0496112_0040620 | Ga0496112_0040620_1627_2292 | 220 |
| 241 | 3300048917 | Ga0496114_0785083 | Ga0496114_0785083_17_679 | 220 |
| 242 | 3300048918 | Ga0496115_0480706 | Ga0496115_0480706_101_763 | 220 |
| 243 | 3300049588 | Ga0501072_0200585 | Ga0501072_0200585_912_1577 | 220 |
| 244 | 3300049743 | Ga0501081_0167387 | Ga0501081_0167387_273_938 | 220 |
| 245 | 3300050507 | nmdc:mga05p37_237018_c1 | nmdc:mga05p37_237018_c1_1205_1870 | 220 |
| 246 | 3300050507 | nmdc:mga05p37_365441_c1 | nmdc:mga05p37_365441_c1_893_1558 | 220 |
| 247 | 3300050507 | nmdc:mga05p37_91806_c1 | nmdc:mga05p37_91806_c1_51_716 | 220 |
| 248 | 3300050508 | nmdc:mga09592_33693_c1 | nmdc:mga09592_33693_c1_299_964 | 220 |
| 249 | 3300050508 | nmdc:mga09592_3531_c1 | nmdc:mga09592_3531_c1_8933_9598 | 220 |
| 250 | 3300050508 | nmdc:mga09592_427937_c1 | nmdc:mga09592_427937_c1_411_1076 | 220 |
| 251 | 3300050509 | nmdc:mga0qj67_13019_c1 | nmdc:mga0qj67_13019_c1_5000_5665 | 220 |
| 252 | 3300050510 | nmdc:mga06r32_200419_c1 | nmdc:mga06r32_200419_c1_287_952 | 220 |
| 253 | 3300050510 | nmdc:mga06r32_27346_c1 | nmdc:mga06r32_27346_c1_4605_5270 | 220 |
| 254 | 3300050510 | nmdc:mga06r32_4258_c1 | nmdc:mga06r32_4258_c1_559_1278 | 220 |
| 255 | 3300050511 | nmdc:mga08y16_1312_c1 | nmdc:mga08y16_1312_c1_10780_11460 | 220 |
| 256 | 3300050511 | nmdc:mga08y16_264064_c1 | nmdc:mga08y16_264064_c1_218_883 | 220 |
| 257 | 3300050511 | nmdc:mga08y16_572115_c1 | nmdc:mga08y16_572115_c1_353_1018 | 220 |
| 258 | 3300050512 | nmdc:mga0n895_200085_c1 | nmdc:mga0n895_200085_c1_452_1207 | 220 |
| 259 | 3300050512 | nmdc:mga0n895_36554_c1 | nmdc:mga0n895_36554_c1_1475_2140 | 220 |
| 260 | 3300050512 | nmdc:mga0n895_865451_c1 | nmdc:mga0n895_865451_c1_151_831 | 220 |
| 261 | 3300050513 | nmdc:mga0rr50_248364_c1 | nmdc:mga0rr50_248364_c1_429_1109 | 220 |
| 262 | 3300050513 | nmdc:mga0rr50_249247_c1 | nmdc:mga0rr50_249247_c1_360_1115 | 220 |
| 263 | 3300050513 | nmdc:mga0rr50_37338_c1 | nmdc:mga0rr50_37338_c1_194_859 | 220 |
| 264 | 3300050514 | nmdc:mga08x19_430644_c1 | nmdc:mga08x19_430644_c1_64_729 | 220 |
| 265 | 3300050515 | nmdc:mga0a205_334512_c1 | nmdc:mga0a205_334512_c1_190_870 | 220 |
| 266 | 3300050515 | nmdc:mga0a205_36955_c1 | nmdc:mga0a205_36955_c1_1309_1974 | 220 |
| 267 | 3300050515 | nmdc:mga0a205_5850_c1 | nmdc:mga0a205_5850_c1_2596_3261 | 220 |
| 268 | 3300050515 | nmdc:mga0a205_60537_c1 | nmdc:mga0a205_60537_c1_1168_1923 | 220 |
| 269 | 3300053077 | Ga0495601_0017027 | Ga0495601_0017027_1678_2343 | 220 |
| 270 | 3300053084 | Ga0495595_0000365 | Ga0495595_0000365_6113_6778 | 220 |
| 271 | 3300053085 | Ga0495619_0001344 | Ga0495619_0001344_8283_8948 | 220 |
| 272 | 3300061734 | Ga0530510_0109241 | Ga0530510_0109241_859_1524 | 220 |
| 273 | 3300005340 | Ga0070689_100141685 | Ga0070689_1001416852 | 221 |
| 274 | 3300005617 | Ga0068859_100052753 | Ga0068859_1000527533 | 221 |
| 275 | 3300005618 | Ga0068864_100100087 | Ga0068864_1001000873 | 221 |
| 276 | 3300005981 | Ga0081538_10002513 | Ga0081538_1000251317 | 221 |
| 277 | 3300006173 | Ga0070716_100013049 | Ga0070716_1000130495 | 221 |
| 278 | 3300006931 | Ga0097620_100052754 | Ga0097620_1000527543 | 221 |
| 279 | 3300025936 | Ga0207670_10133485 | Ga0207670_101334851 | 221 |
| 280 | 3300003203 | JGI25406J46586_10007947 | JGI25406J46586_100079476 | 222 |
| 281 | 3300005985 | Ga0081539_10001162 | Ga0081539_1000116235 | 222 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2f2f-assembly2.cif.gz_E | crystal structure of cytolethal distending toxin (cdt) from actinobacillus actinomycetemcomitans | 0.5226 | 67 | 177 |
| 7v0e-assembly1.cif.gz_E | crystal structure of the macro-oligomeric form of dnmt3b methyltransferase domain. | 0.4709 | 67 | 176 |
| 1f9c-assembly1.cif.gz_A | crystal structure of mle d178n variant | 0.4681 | 60 | 138 |
| 8tiv-assembly1.cif.gz_C | isoreticular, interpenetrating co-crystal of replication initiator protein repe54 and symmetrical expanded duplex (31mer) containing the cognate repe54 sequence and an additional g-c rich sequence with blunt ends and 5' terminal phosphates and crosslinked with edc. | 0.4675 | 87 | 179 |
| 7uog-assembly1.cif.gz_C | isoreticular, interpenetrating co-crystal of replication initiator protein repe54 and asymmetrical expanded duplex (31mer) containing the cognate repe54 sequence and an additional g-c rich sequence. | 0.4675 | 87 | 179 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8BQJ6_142_311_2.40.50.1070 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.6639 | 68 | 114 | 2.40.50.1070 |
| af_A0A0R4IIN8_64_149_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.5991 | 65 | 179 | 3.40.630.30 |
| af_A0A0R4IIN8_64_149_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.5443 | 65 | 179 | 3.40.630.30 |
| 4k6lF00 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.5386 | 67 | 182 | 3.60.10.10 |
| af_Q7XIY9_12_116_1.10.10.1200 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;MAGE homology domain, winged helix WH1 motif | 0.531 | 131 | 179 | 1.10.10.1200 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7L8W0U3-F1-model_v4 | deleted | 0.9347 | 7 | 133 |
|
| AF-A0A370KHQ7-F1-model_v4 | DUF6875 domain-containing protein | 0.9162 | 1 | 176 |
|
| AF-A0A4Q0R032-F1-model_v4 | deleted | 0.9063 | 1 | 218 |
|
| AF-A0A1C5KBF5-F1-model_v4 | DUF6875 domain-containing protein | 0.8982 | 1 | 217 |
|
| AF-A0A853BV61-F1-model_v4 | DUF6875 domain-containing protein | 0.8888 | 27 | 201 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar