F384187

General Info

Members Datasets Scaffolds Average Seq Length
281 171 281 226

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10015368|Ga0081455_100153687
Length 266
Sequence MIRLDTRARASALVLLLFSCVTPKEAPMAAQTAKLYLLEDLDDASKTRQLANSDFAALRTVADWIKSFVTKPHKDLGRDGPVCPFVPEAMQRKTLWLASEHIAGRSVAEVVQLVNGYKAQLLQQPFHGEGVNYNSIVVVFTDLSADRAKGLFDDVLKQLAVPSYVEDGLVMGGFYESNEATAIYNRSFRPFTPPVPFLLMRHAVISDWKFFLDNDDWLNRWAHRYGESGVRALAEELRRLPWRAGATNPTTNELRSGISRQMTLPS

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
106 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
136 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.47
Rhizosphere 92.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10007947 3300003203 Bacteria 4826
2 JGI25407J50210_10006893 3300003373 Bacteria 2840
3 JGI25407J50210_10016591 3300003373 Bacteria 1908
4 Ga0065715_10197424 3300005293 Bacteria 1380
5 Ga0070670_100313798 3300005331 Bacteria 1373
6 Ga0070682_100078322 3300005337 Unclassified 2132
7 Ga0068868_100045562 3300005338 Bacteria 3432
8 Ga0068868_100477204 3300005338 Unclassified 1089
9 Ga0070660_100345911 3300005339 Unclassified 1224
10 Ga0070689_100141685 3300005340 Unclassified 1934
11 Ga0070687_100352002 3300005343 Unclassified 951
12 Ga0070668_100056837 3300005347 Bacteria 3022
13 Ga0070673_100348006 3300005364 Bacteria 1315
14 Ga0070659_100002973 3300005366 Bacteria 12077
15 Ga0070659_100518912 3300005366 Unclassified 1017
16 Ga0070709_10073522 3300005434 Unclassified 2213
17 Ga0070709_10076233 3300005434 Bacteria 2177
18 Ga0070714_100110427 3300005435 Bacteria 2434
19 Ga0070713_100134782 3300005436 Bacteria 2181
20 Ga0070713_100142509 3300005436 Bacteria 2124
21 Ga0070713_100303388 3300005436 Unclassified 1470
22 Ga0070713_100334640 3300005436 Bacteria 1401
23 Ga0070710_10000696 3300005437 Bacteria 16002
24 Ga0070711_100066310 3300005439 Bacteria 2528
25 Ga0070711_100266769 3300005439 Bacteria 1349
26 Ga0070708_100661763 3300005445 Unclassified 984
27 Ga0070662_100144123 3300005457 Unclassified 1849
28 Ga0068853_100070716 3300005539 Bacteria 3038
29 Ga0070695_100310611 3300005545 Unclassified 1169
30 Ga0070696_100523237 3300005546 Bacteria 947
31 Ga0070704_100327520 3300005549 Bacteria 1286
32 Ga0068855_100088459 3300005563 Bacteria 3578
33 Ga0068857_100202925 3300005577 Bacteria 1808
34 Ga0070702_100068360 3300005615 Unclassified 2090
35 Ga0068859_100052753 3300005617 Unclassified 4089
36 Ga0068859_100116750 3300005617 Bacteria 2733
37 Ga0068859_100540532 3300005617 Unclassified 1260
38 Ga0068864_100053321 3300005618 Bacteria 3488
39 Ga0068864_100100087 3300005618 Unclassified 2569
40 Ga0068864_100464950 3300005618 Unclassified 1212
41 Ga0068861_100041015 3300005719 Bacteria 3465
42 Ga0068863_100080646 3300005841 Bacteria 3082
43 Ga0068863_100113972 3300005841 Bacteria 2575
44 Ga0068863_100601200 3300005841 Unclassified 1089
45 Ga0068858_100030728 3300005842 Bacteria 4989
46 Ga0068858_100477843 3300005842 Unclassified 1203
47 Ga0068860_100198856 3300005843 Unclassified 1942
48 Ga0081455_10015368 3300005937 Bacteria 7441
49 Ga0081455_10084646 3300005937 Plasmid 2587
50 Ga0081455_10156816 3300005937 Bacteria 1749
51 Ga0081538_10000786 3300005981 Bacteria 34645
52 Ga0081538_10002513 3300005981 Bacteria 17861
53 Ga0081538_10005866 3300005981 Bacteria 10944
54 Ga0081538_10028340 3300005981 Bacteria 3854
55 Ga0081538_10031333 3300005981 Bacteria 3589
56 Ga0081538_10033346 3300005981 Bacteria 3430
57 Ga0081538_10036463 3300005981 Bacteria 3207
58 Ga0081538_10039430 3300005981 Plasmid 3030
59 Ga0081538_10050309 3300005981 Bacteria 2518
60 Ga0081538_10050934 3300005981 Bacteria 2493
61 Ga0081538_10052951 3300005981 Bacteria 2419
62 Ga0081538_10104152 3300005981 Bacteria 1417
63 Ga0081540_1025343 3300005983 Bacteria 3415
64 Ga0081539_10001162 3300005985 Bacteria 47608
65 Ga0070717_10054993 3300006028 Bacteria 3283
66 Ga0070717_10165324 3300006028 Unclassified 1922
67 Ga0070716_100013049 3300006173 Bacteria 4225
68 Ga0070716_100123722 3300006173 Bacteria 1623
69 Ga0070712_100071328 3300006175 Bacteria 2485
70 Ga0070712_100185193 3300006175 Bacteria 1625
71 Ga0070712_100257427 3300006175 Unclassified 1397
72 Ga0070712_100721807 3300006175 Bacteria 851
73 Ga0075427_10001049 3300006194 Plasmid 3458
74 Ga0068871_100496090 3300006358 Unclassified 1100
75 Ga0075428_100123983 3300006844 Bacteria 2812
76 Ga0075428_100135565 3300006844 Plasmid 2677
77 Ga0075428_100400400 3300006844 Bacteria 1471
78 Ga0075430_100025078 3300006846 Bacteria 5073
79 Ga0075430_100086416 3300006846 Plasmid 2625
80 Ga0075430_100152013 3300006846 Bacteria 1927
81 Ga0075431_100007321 3300006847 Bacteria 10990
82 Ga0075431_100064002 3300006847 Bacteria 3797
83 Ga0075431_100183859 3300006847 Unclassified 2144
84 Ga0075431_100186490 3300006847 Bacteria 2127
85 Ga0075431_100421685 3300006847 Bacteria 1334
86 Ga0075431_100458049 3300006847 Bacteria 1270
87 Ga0075433_10004396 3300006852 Bacteria 10965
88 Ga0075433_10029223 3300006852 Bacteria 4694
89 Ga0075433_10032083 3300006852 Bacteria 4496
90 Ga0075433_10197342 3300006852 Bacteria 1790
91 Ga0075433_10347137 3300006852 Unclassified 1312
92 Ga0075434_100006817 3300006871 Bacteria 10507
93 Ga0075434_100068155 3300006871 Bacteria 3544
94 Ga0075434_100071459 3300006871 Plasmid 3462
95 Ga0075434_100149622 3300006871 Bacteria 2355
96 Ga0075429_100016742 3300006880 Bacteria 6349
97 Ga0075429_100123103 3300006880 Bacteria 2267
98 Ga0068865_100211180 3300006881 Bacteria 1513
99 Ga0075436_100184090 3300006914 Bacteria 1477
100 Ga0097620_100052754 3300006931 Unclassified 4089
101 Ga0097620_100116752 3300006931 Bacteria 2733
102 Ga0097620_100540550 3300006931 Unclassified 1260
103 Ga0075435_100029290 3300007076 Bacteria 4320
104 Ga0075435_100049246 3300007076 Bacteria 3388
105 Ga0075435_100071716 3300007076 Bacteria 2829
106 Ga0075435_100279162 3300007076 Bacteria 1426
107 Ga0105240_10608617 3300009093 Unclassified 1202
108 Ga0111539_10007370 3300009094 Bacteria 14093
109 Ga0111539_10017073 3300009094 Bacteria 8985
110 Ga0111539_10080483 3300009094 Bacteria 3832
111 Ga0111539_10298350 3300009094 Bacteria 1876
112 Ga0111539_11132403 3300009094 Unclassified 909
113 Ga0105245_10011934 3300009098 Bacteria 7554
114 Ga0105245_10060819 3300009098 Bacteria 3403
115 Ga0105245_10671949 3300009098 Bacteria 1067
116 Ga0105247_10114994 3300009101 Bacteria 1736
117 Ga0114129_10443160 3300009147 Bacteria 1704
118 Ga0105243_10714850 3300009148 Bacteria 978
119 Ga0105241_10274490 3300009174 Bacteria 1437
120 Ga0105241_10345817 3300009174 Unclassified 1290
121 Ga0105241_10655002 3300009174 Unclassified 954
122 Ga0105248_10223618 3300009177 Bacteria 2119
123 Ga0105248_10535013 3300009177 Bacteria 1322
124 Ga0105237_10046897 3300009545 Bacteria 4344
125 Ga0105238_10026466 3300009551 Bacteria 5915
126 Ga0105238_10541579 3300009551 Bacteria 1168
127 Ga0105238_10723761 3300009551 Bacteria 1008
128 Ga0105249_10083344 3300009553 Bacteria 2976
129 Ga0105239_10257044 3300010375 Unclassified 1963
130 Ga0105246_10017433 3300011119 Bacteria 4564
131 Ga0105246_10020363 3300011119 Bacteria 4253
132 Ga0157371_10436855 3300013102 Bacteria 961
133 Ga0157369_10043949 3300013105 Bacteria 4866
134 Ga0157378_10396169 3300013297 Bacteria 1359
135 Ga0163162_10192801 3300013306 Unclassified 2165
136 Ga0163162_10835189 3300013306 Bacteria 1037
137 Ga0163162_11425566 3300013306 Unclassified 788
138 Ga0157372_10125756 3300013307 Bacteria 2948
139 Ga0157375_10167878 3300013308 Unclassified 2340
140 Ga0157376_10091464 3300014969 Bacteria 2636
141 Ga0207653_10066263 3300025885 Bacteria 1227
142 Ga0207692_10029166 3300025898 Bacteria 2619
143 Ga0207692_10047823 3300025898 Unclassified 2150
144 Ga0207710_10180039 3300025900 Unclassified 1037
145 Ga0207688_10044371 3300025901 Bacteria 2478
146 Ga0207680_10471193 3300025903 Unclassified 892
147 Ga0207699_10010259 3300025906 Bacteria 4694
148 Ga0207699_10020516 3300025906 Bacteria 3544
149 Ga0207699_10151507 3300025906 Bacteria 1535
150 Ga0207654_10225001 3300025911 Bacteria 1246
151 Ga0207654_10226541 3300025911 Unclassified 1243
152 Ga0207671_10050064 3300025914 Bacteria 3093
153 Ga0207693_10038239 3300025915 Bacteria 3780
154 Ga0207663_10213798 3300025916 Unclassified 1399
155 Ga0207662_10115680 3300025918 Bacteria 1676
156 Ga0207657_10058755 3300025919 Bacteria 3308
157 Ga0207650_10224909 3300025925 Bacteria 1512
158 Ga0207687_10066548 3300025927 Bacteria 2561
159 Ga0207700_10003863 3300025928 Bacteria 8754
160 Ga0207700_10134788 3300025928 Bacteria 2021
161 Ga0207664_10059130 3300025929 Bacteria 3051
162 Ga0207664_10206657 3300025929 Unclassified 1697
163 Ga0207690_10452451 3300025932 Bacteria 1032
164 Ga0207670_10133485 3300025936 Unclassified 1822
165 Ga0207670_10811267 3300025936 Bacteria 780
166 Ga0207669_10642962 3300025937 Unclassified 867
167 Ga0207665_10060731 3300025939 Bacteria 2560
168 Ga0207711_10348492 3300025941 Unclassified 1371
169 Ga0207711_10490221 3300025941 Bacteria 1145
170 Ga0207689_10269253 3300025942 Unclassified 1410
171 Ga0207667_10170471 3300025949 Bacteria 2237
172 Ga0207712_10794100 3300025961 Bacteria 832
173 Ga0207668_10055518 3300025972 Bacteria 2754
174 Ga0207677_10180876 3300026023 Bacteria 1659
175 Ga0207641_10143232 3300026088 Bacteria 2159
176 Ga0207641_10186183 3300026088 Bacteria 1905
177 Ga0207648_10707339 3300026089 Bacteria 934
178 Ga0207676_10112668 3300026095 Bacteria 2279
179 Ga0207674_10023433 3300026116 Bacteria 6613
180 Ga0207675_100062492 3300026118 Bacteria 3478
181 Ga0207675_101323503 3300026118 Bacteria 741
182 Ga0207428_10014169 3300027907 Bacteria 6940
183 Ga0207428_10043243 3300027907 Plasmid 3640
184 Ga0207428_10116374 3300027907 Bacteria 2053
185 Ga0207428_10224778 3300027907 Bacteria 1406
186 Ga0307412_10114769 3300031911 Bacteria 1929
187 Ga0373940_0066311 3300035088 Bacteria 1043
188 Ga0373949_0039869 3300035090 Unclassified 1151
189 Ga0373943_0027324 3300035170 Bacteria 2680
190 Ga0373946_0015940 3300035171 Bacteria 2857
191 Ga0373931_0065554 3300035691 Bacteria 1968
192 Ga0373935_0016849 3300035692 Bacteria 4424
193 Ga0373937_0146032 3300036401 Bacteria 2214
194 Ga0373925_0035403 3300037068 Bacteria 3683
195 Ga0395899_0038686 3300037312 Bacteria 3572
196 Ga0395900_0020901 3300037418 Bacteria 6688
197 Ga0395898_0430372 3300037466 Bacteria 1257
198 Ga0395905_0025487 3300037471 Bacteria 5577
199 Ga0395901_0027019 3300038443 Bacteria 5894
200 Ga0439440_0005145 3300042993 Bacteria 2585
201 Ga0495629_0005123 3300046459 Bacteria 9798
202 Ga0495651_0056155 3300046462 Bacteria 3025
203 Ga0495653_0029614 3300046463 Bacteria 4368
204 Ga0495582_0012789 3300046473 Bacteria 4624
205 Ga0495639_0002453 3300046475 Bacteria 8103
206 Ga0495662_0013057 3300046476 Bacteria 4046
207 Ga0495594_0036390 3300046499 Bacteria 2684
208 Ga0495608_0027797 3300046511 Bacteria 3847
209 Ga0495618_0008815 3300046514 Bacteria 6090
210 Ga0495630_0009265 3300046517 Bacteria 7078
211 Ga0495652_0027079 3300046529 Bacteria 5054
212 Ga0495665_0056956 3300046531 Bacteria 2063
213 Ga0495640_0010795 3300046533 Bacteria 7046
214 Ga0495667_0005702 3300046559 Bacteria 8430
215 Ga0495634_0012727 3300046642 Bacteria 6090
216 Ga0495635_0003847 3300046663 Bacteria 10429
217 Ga0495646_0133388 3300046680 Bacteria 1396
218 Ga0495647_0008816 3300046681 Bacteria 3398
219 Ga0495658_0011399 3300046683 Bacteria 4470
220 Ga0495600_0005670 3300046809 Bacteria 7541
221 Ga0495581_0017178 3300047315 Bacteria 4205
222 Ga0495604_0005670 3300047317 Bacteria 9902
223 Ga0495674_0028628 3300047319 Bacteria 5076
224 Ga0495680_0008920 3300047322 Bacteria 9067
225 Ga0495684_0002154 3300047471 Bacteria 15772
226 Ga0495593_0036978 3300047673 Bacteria 2644
227 Ga0496101_0360039 3300048904 Bacteria 1144
228 Ga0496102_0186141 3300048905 Bacteria 1957
229 Ga0496102_0845897 3300048905 Unclassified 837
230 Ga0496104_0015962 3300048907 Bacteria 6817
231 Ga0496105_0003161 3300048908 Bacteria 12131
232 Ga0496105_0015965 3300048908 Bacteria 5990
233 Ga0496105_0040576 3300048908 Bacteria 3838
234 Ga0496106_0013581 3300048909 Bacteria 6012
235 Ga0496107_0283810 3300048910 Bacteria 1232
236 Ga0496108_0097728 3300048911 Bacteria 2502
237 Ga0496108_0382594 3300048911 Unclassified 1229
238 Ga0496109_0079036 3300048912 Bacteria 3030
239 Ga0496109_0225511 3300048912 Bacteria 1763
240 Ga0496109_0463749 3300048912 Bacteria 1196
241 Ga0496110_0041962 3300048913 Bacteria 3993
242 Ga0496110_0888914 3300048913 Unclassified 797
243 Ga0496112_0008749 3300048915 Bacteria 9081
244 Ga0496112_0031877 3300048915 Bacteria 5115
245 Ga0496112_0040620 3300048915 Bacteria 4549
246 Ga0496114_0785083 3300048917 Bacteria 831
247 Ga0496115_0480706 3300048918 Bacteria 1000
248 Ga0501072_0200585 3300049588 Unclassified 1591
249 Ga0501081_0167387 3300049743 Unclassified 1586
250 nmdc:mga05p37_237018_c1 3300050507 Bacteria 2196
251 nmdc:mga05p37_365441_c1 3300050507 Bacteria 1695
252 nmdc:mga05p37_91806_c1 3300050507 Plasmid 3742
253 nmdc:mga09592_33693_c1 3300050508 Bacteria 4278
254 nmdc:mga09592_3531_c1 3300050508 Bacteria 12624
255 nmdc:mga09592_427937_c1 3300050508 Bacteria 1143
256 nmdc:mga0qj67_13019_c1 3300050509 Bacteria 6279
257 nmdc:mga06r32_200419_c1 3300050510 Bacteria 1984
258 nmdc:mga06r32_27346_c1 3300050510 Bacteria 5328
259 nmdc:mga06r32_4258_c1 3300050510 Bacteria 12812
260 nmdc:mga08y16_1312_c1 3300050511 Bacteria 24699
261 nmdc:mga08y16_264064_c1 3300050511 Bacteria 1778
262 nmdc:mga08y16_476985_c1 3300050511 Bacteria 1270
263 nmdc:mga08y16_572115_c1 3300050511 Unclassified 1142
264 nmdc:mga0n895_161648_c1 3300050512 Bacteria 2271
265 nmdc:mga0n895_200085_c1 3300050512 Bacteria 2029
266 nmdc:mga0n895_36554_c1 3300050512 Bacteria 4743
267 nmdc:mga0n895_865451_c1 3300050512 Unclassified 891
268 nmdc:mga0rr50_248364_c1 3300050513 Unclassified 1477
269 nmdc:mga0rr50_249247_c1 3300050513 Bacteria 1474
270 nmdc:mga0rr50_37338_c1 3300050513 Plasmid 3506
271 nmdc:mga0rr50_55147_c1 3300050513 Plasmid 2964
272 nmdc:mga08x19_430644_c1 3300050514 Bacteria 927
273 nmdc:mga0a205_193745_c1 3300050515 Bacteria 1924
274 nmdc:mga0a205_334512_c1 3300050515 Unclassified 1384
275 nmdc:mga0a205_36955_c1 3300050515 Bacteria 4695
276 nmdc:mga0a205_5850_c1 3300050515 Bacteria 11077
277 nmdc:mga0a205_60537_c1 3300050515 Bacteria 3656
278 Ga0495601_0017027 3300053077 Bacteria 4409
279 Ga0495595_0000365 3300053084 Bacteria 17161
280 Ga0495619_0001344 3300053085 Bacteria 16121
281 Ga0530510_0109241 3300061734 Unclassified 2025

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005983 Ga0081540_1025343 Ga0081540_10253434 214
2 3300006852 Ga0075433_10197342 Ga0075433_101973422 214
3 3300006871 Ga0075434_100149622 Ga0075434_1001496222 214
4 3300007076 Ga0075435_100279162 Ga0075435_1002791621 214
5 3300009094 Ga0111539_10080483 Ga0111539_100804835 214
6 3300027907 Ga0207428_10224778 Ga0207428_102247781 214
7 3300050511 nmdc:mga08y16_476985_c1 nmdc:mga08y16_476985_c1_259_1014 214
8 3300050515 nmdc:mga0a205_193745_c1 nmdc:mga0a205_193745_c1_390_1145 214
9 3300009093 Ga0105240_10608617 Ga0105240_106086172 217
10 3300009098 Ga0105245_10011934 Ga0105245_100119345 217
11 3300009148 Ga0105243_10714850 Ga0105243_107148501 217
12 3300009174 Ga0105241_10345817 Ga0105241_103458172 217
13 3300009177 Ga0105248_10223618 Ga0105248_102236182 217
14 3300009545 Ga0105237_10046897 Ga0105237_100468973 217
15 3300009551 Ga0105238_10026466 Ga0105238_100264663 217
16 3300009553 Ga0105249_10083344 Ga0105249_100833442 217
17 3300010375 Ga0105239_10257044 Ga0105239_102570441 217
18 3300011119 Ga0105246_10017433 Ga0105246_100174334 217
19 3300013102 Ga0157371_10436855 Ga0157371_104368551 217
20 3300013105 Ga0157369_10043949 Ga0157369_100439491 217
21 3300013306 Ga0163162_10192801 Ga0163162_101928012 217
22 3300013307 Ga0157372_10125756 Ga0157372_101257564 217
23 3300013308 Ga0157375_10167878 Ga0157375_101678782 217
24 3300014969 Ga0157376_10091464 Ga0157376_100914641 217
25 3300035090 Ga0373949_0039869 Ga0373949_0039869_482_1135 217
26 3300048905 Ga0496102_0845897 Ga0496102_0845897_51_704 217
27 3300048912 Ga0496109_0079036 Ga0496109_0079036_1215_1868 217
28 3300050512 nmdc:mga0n895_161648_c1 nmdc:mga0n895_161648_c1_670_1323 217
29 3300050513 nmdc:mga0rr50_55147_c1 nmdc:mga0rr50_55147_c1_2051_2704 217
30 3300037312 Ga0395899_0038686 Ga0395899_0038686_2548_3231 218
31 3300037466 Ga0395898_0430372 Ga0395898_0430372_206_889 218
32 3300037471 Ga0395905_0025487 Ga0395905_0025487_452_1135 218
33 3300048905 Ga0496102_0186141 Ga0496102_0186141_562_1221 218
34 3300005618 Ga0068864_100464950 Ga0068864_1004649502 219
35 3300006175 Ga0070712_100071328 Ga0070712_1000713283 219
36 3300006844 Ga0075428_100400400 Ga0075428_1004004002 219
37 3300009094 Ga0111539_10298350 Ga0111539_102983502 219
38 3300013306 Ga0163162_11425566 Ga0163162_114255661 219
39 3300025898 Ga0207692_10047823 Ga0207692_100478231 219
40 3300048911 Ga0496108_0382594 Ga0496108_0382594_67_744 219
41 3300048912 Ga0496109_0225511 Ga0496109_0225511_94_756 219
42 3300048913 Ga0496110_0888914 Ga0496110_0888914_16_693 219
43 3300003373 JGI25407J50210_10006893 JGI25407J50210_100068932 220
44 3300003373 JGI25407J50210_10016591 JGI25407J50210_100165912 220
45 3300005293 Ga0065715_10197424 Ga0065715_101974242 220
46 3300005331 Ga0070670_100313798 Ga0070670_1003137982 220
47 3300005337 Ga0070682_100078322 Ga0070682_1000783222 220
48 3300005338 Ga0068868_100045562 Ga0068868_1000455622 220
49 3300005338 Ga0068868_100477204 Ga0068868_1004772042 220
50 3300005339 Ga0070660_100345911 Ga0070660_1003459111 220
51 3300005343 Ga0070687_100352002 Ga0070687_1003520021 220
52 3300005347 Ga0070668_100056837 Ga0070668_1000568372 220
53 3300005364 Ga0070673_100348006 Ga0070673_1003480062 220
54 3300005366 Ga0070659_100002973 Ga0070659_1000029734 220
55 3300005366 Ga0070659_100518912 Ga0070659_1005189121 220
56 3300005434 Ga0070709_10073522 Ga0070709_100735222 220
57 3300005434 Ga0070709_10076233 Ga0070709_100762333 220
58 3300005435 Ga0070714_100110427 Ga0070714_1001104272 220
59 3300005436 Ga0070713_100134782 Ga0070713_1001347822 220
60 3300005436 Ga0070713_100142509 Ga0070713_1001425092 220
61 3300005436 Ga0070713_100303388 Ga0070713_1003033882 220
62 3300005436 Ga0070713_100334640 Ga0070713_1003346402 220
63 3300005437 Ga0070710_10000696 Ga0070710_1000069617 220
64 3300005439 Ga0070711_100066310 Ga0070711_1000663104 220
65 3300005439 Ga0070711_100266769 Ga0070711_1002667692 220
66 3300005445 Ga0070708_100661763 Ga0070708_1006617632 220
67 3300005457 Ga0070662_100144123 Ga0070662_1001441232 220
68 3300005539 Ga0068853_100070716 Ga0068853_1000707162 220
69 3300005545 Ga0070695_100310611 Ga0070695_1003106111 220
70 3300005546 Ga0070696_100523237 Ga0070696_1005232371 220
71 3300005549 Ga0070704_100327520 Ga0070704_1003275201 220
72 3300005563 Ga0068855_100088459 Ga0068855_1000884594 220
73 3300005577 Ga0068857_100202925 Ga0068857_1002029252 220
74 3300005615 Ga0070702_100068360 Ga0070702_1000683601 220
75 3300005617 Ga0068859_100116750 Ga0068859_1001167502 220
76 3300005617 Ga0068859_100540532 Ga0068859_1005405322 220
77 3300005618 Ga0068864_100053321 Ga0068864_1000533212 220
78 3300005719 Ga0068861_100041015 Ga0068861_1000410152 220
79 3300005841 Ga0068863_100080646 Ga0068863_1000806464 220
80 3300005841 Ga0068863_100113972 Ga0068863_1001139722 220
81 3300005841 Ga0068863_100601200 Ga0068863_1006012001 220
82 3300005842 Ga0068858_100030728 Ga0068858_1000307282 220
83 3300005842 Ga0068858_100477843 Ga0068858_1004778431 220
84 3300005843 Ga0068860_100198856 Ga0068860_1001988561 220
85 3300005937 Ga0081455_10015368 Ga0081455_100153687 220
86 3300005937 Ga0081455_10084646 Ga0081455_100846462 220
87 3300005937 Ga0081455_10156816 Ga0081455_101568162 220
88 3300005981 Ga0081538_10000786 Ga0081538_1000078618 220
89 3300005981 Ga0081538_10005866 Ga0081538_100058662 220
90 3300005981 Ga0081538_10028340 Ga0081538_100283406 220
91 3300005981 Ga0081538_10031333 Ga0081538_100313333 220
92 3300005981 Ga0081538_10033346 Ga0081538_100333465 220
93 3300005981 Ga0081538_10036463 Ga0081538_100364634 220
94 3300005981 Ga0081538_10039430 Ga0081538_100394302 220
95 3300005981 Ga0081538_10050309 Ga0081538_100503093 220
96 3300005981 Ga0081538_10050934 Ga0081538_100509341 220
97 3300005981 Ga0081538_10052951 Ga0081538_100529512 220
98 3300005981 Ga0081538_10104152 Ga0081538_101041522 220
99 3300006028 Ga0070717_10054993 Ga0070717_100549933 220
100 3300006028 Ga0070717_10165324 Ga0070717_101653242 220
101 3300006173 Ga0070716_100123722 Ga0070716_1001237221 220
102 3300006175 Ga0070712_100185193 Ga0070712_1001851932 220
103 3300006175 Ga0070712_100257427 Ga0070712_1002574271 220
104 3300006175 Ga0070712_100721807 Ga0070712_1007218072 220
105 3300006194 Ga0075427_10001049 Ga0075427_100010494 220
106 3300006358 Ga0068871_100496090 Ga0068871_1004960901 220
107 3300006844 Ga0075428_100123983 Ga0075428_1001239832 220
108 3300006844 Ga0075428_100135565 Ga0075428_1001355651 220
109 3300006846 Ga0075430_100025078 Ga0075430_1000250784 220
110 3300006846 Ga0075430_100086416 Ga0075430_1000864163 220
111 3300006846 Ga0075430_100152013 Ga0075430_1001520131 220
112 3300006847 Ga0075431_100007321 Ga0075431_1000073217 220
113 3300006847 Ga0075431_100064002 Ga0075431_1000640022 220
114 3300006847 Ga0075431_100183859 Ga0075431_1001838591 220
115 3300006847 Ga0075431_100186490 Ga0075431_1001864903 220
116 3300006847 Ga0075431_100421685 Ga0075431_1004216852 220
117 3300006847 Ga0075431_100458049 Ga0075431_1004580492 220
118 3300006852 Ga0075433_10004396 Ga0075433_100043968 220
119 3300006852 Ga0075433_10029223 Ga0075433_100292234 220
120 3300006852 Ga0075433_10032083 Ga0075433_100320833 220
121 3300006852 Ga0075433_10347137 Ga0075433_103471372 220
122 3300006871 Ga0075434_100006817 Ga0075434_1000068176 220
123 3300006871 Ga0075434_100068155 Ga0075434_1000681552 220
124 3300006871 Ga0075434_100071459 Ga0075434_1000714592 220
125 3300006880 Ga0075429_100016742 Ga0075429_1000167424 220
126 3300006880 Ga0075429_100123103 Ga0075429_1001231032 220
127 3300006881 Ga0068865_100211180 Ga0068865_1002111802 220
128 3300006914 Ga0075436_100184090 Ga0075436_1001840903 220
129 3300006931 Ga0097620_100116752 Ga0097620_1001167522 220
130 3300006931 Ga0097620_100540550 Ga0097620_1005405502 220
131 3300007076 Ga0075435_100029290 Ga0075435_1000292904 220
132 3300007076 Ga0075435_100049246 Ga0075435_1000492462 220
133 3300007076 Ga0075435_100071716 Ga0075435_1000717162 220
134 3300009094 Ga0111539_10007370 Ga0111539_100073703 220
135 3300009094 Ga0111539_10017073 Ga0111539_100170732 220
136 3300009094 Ga0111539_11132403 Ga0111539_111324032 220
137 3300009098 Ga0105245_10060819 Ga0105245_100608192 220
138 3300009098 Ga0105245_10671949 Ga0105245_106719491 220
139 3300009101 Ga0105247_10114994 Ga0105247_101149941 220
140 3300009147 Ga0114129_10443160 Ga0114129_104431603 220
141 3300009174 Ga0105241_10274490 Ga0105241_102744902 220
142 3300009174 Ga0105241_10655002 Ga0105241_106550021 220
143 3300009177 Ga0105248_10535013 Ga0105248_105350132 220
144 3300009551 Ga0105238_10541579 Ga0105238_105415791 220
145 3300009551 Ga0105238_10723761 Ga0105238_107237611 220
146 3300011119 Ga0105246_10020363 Ga0105246_100203632 220
147 3300013297 Ga0157378_10396169 Ga0157378_103961692 220
148 3300013306 Ga0163162_10835189 Ga0163162_108351891 220
149 3300025885 Ga0207653_10066263 Ga0207653_100662631 220
150 3300025898 Ga0207692_10029166 Ga0207692_100291661 220
151 3300025900 Ga0207710_10180039 Ga0207710_101800391 220
152 3300025901 Ga0207688_10044371 Ga0207688_100443713 220
153 3300025903 Ga0207680_10471193 Ga0207680_104711931 220
154 3300025906 Ga0207699_10010259 Ga0207699_100102592 220
155 3300025906 Ga0207699_10020516 Ga0207699_100205162 220
156 3300025906 Ga0207699_10151507 Ga0207699_101515073 220
157 3300025911 Ga0207654_10225001 Ga0207654_102250011 220
158 3300025911 Ga0207654_10226541 Ga0207654_102265412 220
159 3300025914 Ga0207671_10050064 Ga0207671_100500642 220
160 3300025915 Ga0207693_10038239 Ga0207693_100382392 220
161 3300025916 Ga0207663_10213798 Ga0207663_102137981 220
162 3300025918 Ga0207662_10115680 Ga0207662_101156802 220
163 3300025919 Ga0207657_10058755 Ga0207657_100587553 220
164 3300025925 Ga0207650_10224909 Ga0207650_102249092 220
165 3300025927 Ga0207687_10066548 Ga0207687_100665482 220
166 3300025928 Ga0207700_10003863 Ga0207700_100038639 220
167 3300025928 Ga0207700_10134788 Ga0207700_101347882 220
168 3300025929 Ga0207664_10059130 Ga0207664_100591302 220
169 3300025929 Ga0207664_10206657 Ga0207664_102066571 220
170 3300025932 Ga0207690_10452451 Ga0207690_104524511 220
171 3300025936 Ga0207670_10811267 Ga0207670_108112671 220
172 3300025937 Ga0207669_10642962 Ga0207669_106429621 220
173 3300025939 Ga0207665_10060731 Ga0207665_100607314 220
174 3300025941 Ga0207711_10348492 Ga0207711_103484921 220
175 3300025941 Ga0207711_10490221 Ga0207711_104902212 220
176 3300025942 Ga0207689_10269253 Ga0207689_102692532 220
177 3300025949 Ga0207667_10170471 Ga0207667_101704712 220
178 3300025961 Ga0207712_10794100 Ga0207712_107941002 220
179 3300025972 Ga0207668_10055518 Ga0207668_100555185 220
180 3300026023 Ga0207677_10180876 Ga0207677_101808762 220
181 3300026088 Ga0207641_10143232 Ga0207641_101432322 220
182 3300026088 Ga0207641_10186183 Ga0207641_101861832 220
183 3300026089 Ga0207648_10707339 Ga0207648_107073392 220
184 3300026095 Ga0207676_10112668 Ga0207676_101126682 220
185 3300026116 Ga0207674_10023433 Ga0207674_100234336 220
186 3300026118 Ga0207675_100062492 Ga0207675_1000624922 220
187 3300026118 Ga0207675_101323503 Ga0207675_1013235031 220
188 3300027907 Ga0207428_10014169 Ga0207428_100141698 220
189 3300027907 Ga0207428_10043243 Ga0207428_100432431 220
190 3300027907 Ga0207428_10116374 Ga0207428_101163742 220
191 3300031911 Ga0307412_10114769 Ga0307412_101147693 220
192 3300035088 Ga0373940_0066311 Ga0373940_0066311_110_859 220
193 3300035170 Ga0373943_0027324 Ga0373943_0027324_622_1287 220
194 3300035171 Ga0373946_0015940 Ga0373946_0015940_595_1260 220
195 3300035691 Ga0373931_0065554 Ga0373931_0065554_1032_1694 220
196 3300035692 Ga0373935_0016849 Ga0373935_0016849_1693_2358 220
197 3300036401 Ga0373937_0146032 Ga0373937_0146032_505_1170 220
198 3300037068 Ga0373925_0035403 Ga0373925_0035403_498_1163 220
199 3300037418 Ga0395900_0020901 Ga0395900_0020901_4947_5636 220
200 3300038443 Ga0395901_0027019 Ga0395901_0027019_206_895 220
201 3300042993 Ga0439440_0005145 Ga0439440_0005145_1771_2436 220
202 3300046459 Ga0495629_0005123 Ga0495629_0005123_5425_6090 220
203 3300046462 Ga0495651_0056155 Ga0495651_0056155_867_1532 220
204 3300046463 Ga0495653_0029614 Ga0495653_0029614_2398_3063 220
205 3300046473 Ga0495582_0012789 Ga0495582_0012789_1676_2341 220
206 3300046475 Ga0495639_0002453 Ga0495639_0002453_6845_7510 220
207 3300046476 Ga0495662_0013057 Ga0495662_0013057_3138_3803 220
208 3300046499 Ga0495594_0036390 Ga0495594_0036390_613_1278 220
209 3300046511 Ga0495608_0027797 Ga0495608_0027797_2750_3415 220
210 3300046514 Ga0495618_0008815 Ga0495618_0008815_1697_2362 220
211 3300046517 Ga0495630_0009265 Ga0495630_0009265_5207_5872 220
212 3300046529 Ga0495652_0027079 Ga0495652_0027079_1862_2527 220
213 3300046531 Ga0495665_0056956 Ga0495665_0056956_1135_1800 220
214 3300046533 Ga0495640_0010795 Ga0495640_0010795_5169_5834 220
215 3300046559 Ga0495667_0005702 Ga0495667_0005702_1643_2308 220
216 3300046642 Ga0495634_0012727 Ga0495634_0012727_1697_2362 220
217 3300046663 Ga0495635_0003847 Ga0495635_0003847_3043_3708 220
218 3300046680 Ga0495646_0133388 Ga0495646_0133388_20_685 220
219 3300046681 Ga0495647_0008816 Ga0495647_0008816_1210_1875 220
220 3300046683 Ga0495658_0011399 Ga0495658_0011399_2399_3064 220
221 3300046809 Ga0495600_0005670 Ga0495600_0005670_199_864 220
222 3300047315 Ga0495581_0017178 Ga0495581_0017178_3056_3721 220
223 3300047317 Ga0495604_0005670 Ga0495604_0005670_4828_5493 220
224 3300047319 Ga0495674_0028628 Ga0495674_0028628_1804_2469 220
225 3300047322 Ga0495680_0008920 Ga0495680_0008920_6527_7192 220
226 3300047471 Ga0495684_0002154 Ga0495684_0002154_8244_8909 220
227 3300047673 Ga0495593_0036978 Ga0495593_0036978_616_1281 220
228 3300048904 Ga0496101_0360039 Ga0496101_0360039_367_1029 220
229 3300048907 Ga0496104_0015962 Ga0496104_0015962_254_916 220
230 3300048908 Ga0496105_0003161 Ga0496105_0003161_3546_4208 220
231 3300048908 Ga0496105_0015965 Ga0496105_0015965_4826_5488 220
232 3300048908 Ga0496105_0040576 Ga0496105_0040576_821_1483 220
233 3300048909 Ga0496106_0013581 Ga0496106_0013581_4974_5642 220
234 3300048910 Ga0496107_0283810 Ga0496107_0283810_552_1217 220
235 3300048911 Ga0496108_0097728 Ga0496108_0097728_923_1588 220
236 3300048912 Ga0496109_0463749 Ga0496109_0463749_392_1057 220
237 3300048913 Ga0496110_0041962 Ga0496110_0041962_528_1193 220
238 3300048915 Ga0496112_0008749 Ga0496112_0008749_357_1019 220
239 3300048915 Ga0496112_0031877 Ga0496112_0031877_3816_4481 220
240 3300048915 Ga0496112_0040620 Ga0496112_0040620_1627_2292 220
241 3300048917 Ga0496114_0785083 Ga0496114_0785083_17_679 220
242 3300048918 Ga0496115_0480706 Ga0496115_0480706_101_763 220
243 3300049588 Ga0501072_0200585 Ga0501072_0200585_912_1577 220
244 3300049743 Ga0501081_0167387 Ga0501081_0167387_273_938 220
245 3300050507 nmdc:mga05p37_237018_c1 nmdc:mga05p37_237018_c1_1205_1870 220
246 3300050507 nmdc:mga05p37_365441_c1 nmdc:mga05p37_365441_c1_893_1558 220
247 3300050507 nmdc:mga05p37_91806_c1 nmdc:mga05p37_91806_c1_51_716 220
248 3300050508 nmdc:mga09592_33693_c1 nmdc:mga09592_33693_c1_299_964 220
249 3300050508 nmdc:mga09592_3531_c1 nmdc:mga09592_3531_c1_8933_9598 220
250 3300050508 nmdc:mga09592_427937_c1 nmdc:mga09592_427937_c1_411_1076 220
251 3300050509 nmdc:mga0qj67_13019_c1 nmdc:mga0qj67_13019_c1_5000_5665 220
252 3300050510 nmdc:mga06r32_200419_c1 nmdc:mga06r32_200419_c1_287_952 220
253 3300050510 nmdc:mga06r32_27346_c1 nmdc:mga06r32_27346_c1_4605_5270 220
254 3300050510 nmdc:mga06r32_4258_c1 nmdc:mga06r32_4258_c1_559_1278 220
255 3300050511 nmdc:mga08y16_1312_c1 nmdc:mga08y16_1312_c1_10780_11460 220
256 3300050511 nmdc:mga08y16_264064_c1 nmdc:mga08y16_264064_c1_218_883 220
257 3300050511 nmdc:mga08y16_572115_c1 nmdc:mga08y16_572115_c1_353_1018 220
258 3300050512 nmdc:mga0n895_200085_c1 nmdc:mga0n895_200085_c1_452_1207 220
259 3300050512 nmdc:mga0n895_36554_c1 nmdc:mga0n895_36554_c1_1475_2140 220
260 3300050512 nmdc:mga0n895_865451_c1 nmdc:mga0n895_865451_c1_151_831 220
261 3300050513 nmdc:mga0rr50_248364_c1 nmdc:mga0rr50_248364_c1_429_1109 220
262 3300050513 nmdc:mga0rr50_249247_c1 nmdc:mga0rr50_249247_c1_360_1115 220
263 3300050513 nmdc:mga0rr50_37338_c1 nmdc:mga0rr50_37338_c1_194_859 220
264 3300050514 nmdc:mga08x19_430644_c1 nmdc:mga08x19_430644_c1_64_729 220
265 3300050515 nmdc:mga0a205_334512_c1 nmdc:mga0a205_334512_c1_190_870 220
266 3300050515 nmdc:mga0a205_36955_c1 nmdc:mga0a205_36955_c1_1309_1974 220
267 3300050515 nmdc:mga0a205_5850_c1 nmdc:mga0a205_5850_c1_2596_3261 220
268 3300050515 nmdc:mga0a205_60537_c1 nmdc:mga0a205_60537_c1_1168_1923 220
269 3300053077 Ga0495601_0017027 Ga0495601_0017027_1678_2343 220
270 3300053084 Ga0495595_0000365 Ga0495595_0000365_6113_6778 220
271 3300053085 Ga0495619_0001344 Ga0495619_0001344_8283_8948 220
272 3300061734 Ga0530510_0109241 Ga0530510_0109241_859_1524 220
273 3300005340 Ga0070689_100141685 Ga0070689_1001416852 221
274 3300005617 Ga0068859_100052753 Ga0068859_1000527533 221
275 3300005618 Ga0068864_100100087 Ga0068864_1001000873 221
276 3300005981 Ga0081538_10002513 Ga0081538_1000251317 221
277 3300006173 Ga0070716_100013049 Ga0070716_1000130495 221
278 3300006931 Ga0097620_100052754 Ga0097620_1000527543 221
279 3300025936 Ga0207670_10133485 Ga0207670_101334851 221
280 3300003203 JGI25406J46586_10007947 JGI25406J46586_100079476 222
281 3300005985 Ga0081539_10001162 Ga0081539_1000116235 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21780

DUF6875

Domain of unknown function (DUF6875)

58

236

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f2f-assembly2.cif.gz_E crystal structure of cytolethal distending toxin (cdt) from actinobacillus actinomycetemcomitans 0.5226 67 177
7v0e-assembly1.cif.gz_E crystal structure of the macro-oligomeric form of dnmt3b methyltransferase domain. 0.4709 67 176
1f9c-assembly1.cif.gz_A crystal structure of mle d178n variant 0.4681 60 138
8tiv-assembly1.cif.gz_C isoreticular, interpenetrating co-crystal of replication initiator protein repe54 and symmetrical expanded duplex (31mer) containing the cognate repe54 sequence and an additional g-c rich sequence with blunt ends and 5' terminal phosphates and crosslinked with edc. 0.4675 87 179
7uog-assembly1.cif.gz_C isoreticular, interpenetrating co-crystal of replication initiator protein repe54 and asymmetrical expanded duplex (31mer) containing the cognate repe54 sequence and an additional g-c rich sequence. 0.4675 87 179
ID Description Score Start End Superfamily
af_Q8BQJ6_142_311_2.40.50.1070 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.6639 68 114 2.40.50.1070
af_A0A0R4IIN8_64_149_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.5991 65 179 3.40.630.30
af_A0A0R4IIN8_64_149_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.5443 65 179 3.40.630.30
4k6lF00 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.5386 67 182 3.60.10.10
af_Q7XIY9_12_116_1.10.10.1200 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;MAGE homology domain, winged helix WH1 motif 0.531 131 179 1.10.10.1200
ID Description Score Start End GO Terms
AF-A0A7L8W0U3-F1-model_v4 deleted 0.9347 7 133
AF-A0A370KHQ7-F1-model_v4 DUF6875 domain-containing protein 0.9162 1 176
AF-A0A4Q0R032-F1-model_v4 deleted 0.9063 1 218
AF-A0A1C5KBF5-F1-model_v4 DUF6875 domain-containing protein 0.8982 1 217
AF-A0A853BV61-F1-model_v4 DUF6875 domain-containing protein 0.8888 27 201

Feature Viewer

pLDDT pTM Quality
87.13 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map