F384124

General Info

Members Datasets Scaffolds Average Seq Length
281 144 562 131

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10892006|Ga0070710_108920062
Length 149
Sequence MPRTQPASRQYRWTIDTVLVTRFSGGGFVDGAAELGYEQALEALLALVGRPVLVLFSGADGSPFVCGVLSGRLDRGELDERLQEVLLRADDAAVETLFFHVGSRQTGFVLRPDEFERAFRAAEGHLVLELGSCAVSVLLRGDLGSALER

Samples

Sample ID Description Type Environment
1 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
77 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
82 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
118 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
141 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.44
Metatranscriptomes 3.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.96
Rhizosphere 89.32
Stem 0
Stem Tuber 0
Unclassified 21.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070710_10892006 3300005437 Unclassified 641
2 Ga0070658_10447929 3300005327 Unclassified 1112
3 Ga0070683_100284590 3300005329 Unclassified 1573
4 Ga0070680_100010495 3300005336 Bacteria 7144
5 Ga0070680_100311232 3300005336 Unclassified 1336
6 Ga0070660_100001080 3300005339 Bacteria 18313
7 Ga0070660_100041776 3300005339 Bacteria 3496
8 Ga0070660_100148927 3300005339 Unclassified 1881
9 Ga0070660_100208390 3300005339 Bacteria 1586
10 Ga0070660_100263462 3300005339 Bacteria 1408
11 Ga0070661_100088545 3300005344 Bacteria 2291
12 Ga0070661_100456289 3300005344 Bacteria 1017
13 Ga0070673_100752674 3300005364 Bacteria 897
14 Ga0070659_100018721 3300005366 Bacteria 5228
15 Ga0070659_100133221 3300005366 Bacteria 2020
16 Ga0070659_100760266 3300005366 Bacteria 841
17 Ga0070659_101850098 3300005366 Unclassified 541
18 Ga0070709_10098784 3300005434 Bacteria 1941
19 Ga0070709_11559298 3300005434 Unclassified 537
20 Ga0070714_100025458 3300005435 Bacteria 4883
21 Ga0070714_100045252 3300005435 Bacteria 3729
22 Ga0070714_100121405 3300005435 Bacteria 2325
23 Ga0070714_100243564 3300005435 Unclassified 1660
24 Ga0070714_100625765 3300005435 Bacteria 1035
25 Ga0070713_100074015 3300005436 Bacteria 2885
26 Ga0070710_10051938 3300005437 Bacteria 2304
27 Ga0070711_100022570 3300005439 Bacteria 4081
28 Ga0070663_100153312 3300005455 Bacteria 1768
29 Ga0070681_10027714 3300005458 Bacteria 5695
30 Ga0070681_10030561 3300005458 Bacteria 5404
31 Ga0070681_10035194 3300005458 Bacteria 5030
32 Ga0070681_10216848 3300005458 Bacteria 1829
33 Ga0070681_10624562 3300005458 Bacteria 992
34 Ga0070679_100033744 3300005530 Bacteria 5068
35 Ga0070679_100059153 3300005530 Bacteria 3819
36 Ga0070679_100142842 3300005530 Bacteria 2372
37 Ga0068853_100061233 3300005539 Bacteria 3255
38 Ga0068853_100486649 3300005539 Bacteria 1164
39 Ga0070693_100764400 3300005547 Bacteria 713
40 Ga0070665_100068970 3300005548 Bacteria 3544
41 Ga0070665_100233666 3300005548 Bacteria 1839
42 Ga0068855_100033644 3300005563 Bacteria 6115
43 Ga0068855_100063349 3300005563 Bacteria 4314
44 Ga0068855_100231547 3300005563 Bacteria 2068
45 Ga0068857_100021906 3300005577 Bacteria 5624
46 Ga0068857_100281663 3300005577 Bacteria 1529
47 Ga0068857_100672765 3300005577 Bacteria 982
48 Ga0068854_100497644 3300005578 Unclassified 1026
49 Ga0068856_100129442 3300005614 Bacteria 2528
50 Ga0068852_101153339 3300005616 Bacteria 796
51 Ga0068851_10023840 3300005834 Bacteria 2993
52 Ga0070716_100719285 3300006173 Bacteria 765
53 Ga0070712_101133916 3300006175 Bacteria 679
54 Ga0105240_10083495 3300009093 Bacteria 3919
55 Ga0105240_10347785 3300009093 Unclassified 1682
56 Ga0105241_11076194 3300009174 Bacteria 756
57 Ga0105241_11379934 3300009174 Bacteria 674
58 Ga0105248_10314469 3300009177 Bacteria 1764
59 Ga0105248_10754045 3300009177 Unclassified 1098
60 Ga0105248_12158467 3300009177 Bacteria 634
61 Ga0105237_10014918 3300009545 Bacteria 8103
62 Ga0105237_10859009 3300009545 Bacteria 914
63 Ga0105238_10041927 3300009551 Bacteria 4636
64 Ga0105238_10075831 3300009551 Bacteria 3354
65 Ga0105238_11790080 3300009551 Unclassified 646
66 Ga0105239_10066550 3300010375 Unclassified 3958
67 Ga0105239_11609639 3300010375 Bacteria 751
68 Ga0105246_11878460 3300011119 Bacteria 574
69 Ga0157371_10515630 3300013102 Bacteria 884
70 Ga0157370_10119017 3300013104 Bacteria 2466
71 Ga0157370_10126798 3300013104 Bacteria 2382
72 Ga0157370_10458118 3300013104 Bacteria 1172
73 Ga0157369_10033792 3300013105 Bacteria 5617
74 Ga0157369_10079715 3300013105 Bacteria 3507
75 Ga0157374_10073315 3300013296 Bacteria 3232
76 Ga0157374_10136453 3300013296 Unclassified 2379
77 Ga0157374_11983307 3300013296 Unclassified 608
78 Ga0157374_12239134 3300013296 Bacteria 574
79 Ga0157378_10411982 3300013297 Bacteria 1334
80 Ga0157372_10022581 3300013307 Bacteria 6809
81 Ga0157372_10026957 3300013307 Bacteria 6255
82 Ga0157372_10668205 3300013307 Bacteria 1210
83 Ga0157372_10973886 3300013307 Bacteria 983
84 Ga0157375_11304452 3300013308 Bacteria 854
85 Ga0182008_10048094 3300014497 Bacteria 2118
86 Ga0182008_10075702 3300014497 Bacteria 1656
87 Ga0197907_10285655 3300020069 Unclassified 1568
88 Ga0197907_10610725 3300020069 Bacteria 1199
89 Ga0206356_10710383 3300020070 Bacteria 793
90 Ga0206354_11345720 3300020081 Bacteria 1107
91 Ga0206353_10157127 3300020082 Unclassified 825
92 Ga0206353_11295820 3300020082 Bacteria 3507
93 Ga0213876_10098622 3300021384 Bacteria 1549
94 Ga0213871_10021861 3300021441 Bacteria 1598
95 Ga0207692_10026747 3300025898 Bacteria 2709
96 Ga0207699_11258872 3300025906 Unclassified 548
97 Ga0207705_10089448 3300025909 Bacteria 2253
98 Ga0207705_10136857 3300025909 Bacteria 1826
99 Ga0207705_10693509 3300025909 Unclassified 792
100 Ga0207654_10068941 3300025911 Bacteria 2094
101 Ga0207707_10004969 3300025912 Bacteria 11687
102 Ga0207707_10042116 3300025912 Bacteria 3987
103 Ga0207707_10043499 3300025912 Bacteria 3918
104 Ga0207707_10540127 3300025912 Bacteria 991
105 Ga0207695_10134182 3300025913 Bacteria 2430
106 Ga0207695_10294076 3300025913 Bacteria 1516
107 Ga0207671_10285217 3300025914 Unclassified 1303
108 Ga0207693_10118779 3300025915 Bacteria 2076
109 Ga0207693_11059582 3300025915 Bacteria 617
110 Ga0207660_10068750 3300025917 Bacteria 2570
111 Ga0207660_10097291 3300025917 Bacteria 2193
112 Ga0207660_10262243 3300025917 Unclassified 1367
113 Ga0207660_11169891 3300025917 Bacteria 626
114 Ga0207657_10000889 3300025919 Bacteria 31610
115 Ga0207657_10006259 3300025919 Bacteria 12372
116 Ga0207657_10029003 3300025919 Bacteria 5043
117 Ga0207657_10316500 3300025919 Bacteria 1234
118 Ga0207657_10504504 3300025919 Unclassified 948
119 Ga0207649_10037517 3300025920 Bacteria 2927
120 Ga0207649_10064665 3300025920 Bacteria 2313
121 Ga0207649_10235852 3300025920 Bacteria 1311
122 Ga0207649_11341526 3300025920 Unclassified 566
123 Ga0207652_10059921 3300025921 Bacteria 3282
124 Ga0207652_10263337 3300025921 Unclassified 1555
125 Ga0207694_10254909 3300025924 Bacteria 1436
126 Ga0207687_10155066 3300025927 Unclassified 1751
127 Ga0207687_10455621 3300025927 Bacteria 1061
128 Ga0207687_11238548 3300025927 Bacteria 641
129 Ga0207687_11674480 3300025927 Bacteria 545
130 Ga0207700_10370843 3300025928 Bacteria 1250
131 Ga0207700_10609587 3300025928 Bacteria 972
132 Ga0207664_10014338 3300025929 Bacteria 5721
133 Ga0207664_10061720 3300025929 Bacteria 2991
134 Ga0207664_10103136 3300025929 Unclassified 2360
135 Ga0207664_10130165 3300025929 Bacteria 2117
136 Ga0207664_10341113 3300025929 Unclassified 1325
137 Ga0207664_10498436 3300025929 Bacteria 1090
138 Ga0207664_10532253 3300025929 Bacteria 1053
139 Ga0207690_10155707 3300025932 Bacteria 1698
140 Ga0207690_10272624 3300025932 Bacteria 1315
141 Ga0207690_10284512 3300025932 Bacteria 1289
142 Ga0207686_10289843 3300025934 Bacteria 1212
143 Ga0207665_10702773 3300025939 Bacteria 795
144 Ga0207711_10846643 3300025941 Unclassified 851
145 Ga0207661_10594311 3300025944 Unclassified 1016
146 Ga0207667_10064198 3300025949 Bacteria 3835
147 Ga0207668_11254545 3300025972 Unclassified 667
148 Ga0207639_10064801 3300026041 Bacteria 2834
149 Ga0207639_10296810 3300026041 Bacteria 1427
150 Ga0207678_10121640 3300026067 Bacteria 2227
151 Ga0207678_11184139 3300026067 Bacteria 677
152 Ga0207702_10227693 3300026078 Bacteria 1740
153 Ga0207702_10437717 3300026078 Bacteria 1267
154 Ga0207702_10674904 3300026078 Bacteria 1017
155 Ga0207702_11230082 3300026078 Bacteria 743
156 Ga0207674_10300640 3300026116 Bacteria 1554
157 Ga0268266_10550858 3300028379 Bacteria 1105
158 Ga0268266_10683171 3300028379 Bacteria 989
159 Ga0265318_10082010 3300028577 Bacteria 1191
160 Ga0265322_10031093 3300028654 Bacteria 1524
161 Ga0265338_10113407 3300028800 Bacteria 2177
162 Ga0265325_10263798 3300031241 Bacteria 777
163 Ga0265316_10270293 3300031344 Bacteria 1244
164 Ga0373943_0127972 3300035170 Bacteria 1356
165 Ga0373935_0033757 3300035692 Bacteria 3187
166 Ga0373927_0027747 3300035695 Bacteria 3697
167 Ga0373947_0107843 3300035725 Bacteria 1756
168 Ga0373947_0405536 3300035725 Bacteria 920
169 Ga0373925_0017711 3300037068 Bacteria 5168
170 Ga0395899_0072950 3300037312 Bacteria 2511
171 Ga0395899_0088002 3300037312 Bacteria 2254
172 Ga0395899_0095515 3300037312 Bacteria 2150
173 Ga0395900_0030029 3300037418 Bacteria 5579
174 Ga0395900_0055521 3300037418 Bacteria 4078
175 Ga0395900_0062834 3300037418 Bacteria 3817
176 Ga0395900_0249581 3300037418 Bacteria 1776
177 Ga0395900_0725994 3300037418 Bacteria 925
178 Ga0395898_0005391 3300037466 Bacteria 13824
179 Ga0395898_0049864 3300037466 Bacteria 4100
180 Ga0395898_0544467 3300037466 Bacteria 1102
181 Ga0395905_0231363 3300037471 Bacteria 1728
182 Ga0395905_0579416 3300037471 Bacteria 1023
183 Ga0395905_1656906 3300037471 Unclassified 545
184 Ga0395901_0002575 3300038443 Bacteria 18381
185 Ga0395901_0008842 3300038443 Bacteria 10195
186 Ga0395901_0167960 3300038443 Bacteria 2303
187 Ga0395901_0350488 3300038443 Unclassified 1523
188 Ga0395901_0388450 3300038443 Unclassified 1435
189 Ga0395901_0543082 3300038443 Bacteria 1179
190 Ga0395901_0800663 3300038443 Unclassified 931
191 Ga0395901_1466592 3300038443 Unclassified 639
192 Ga0436365_0987007 3300039437 Bacteria 1277
193 Ga0436360_0700049 3300039438 Bacteria 3457
194 Ga0466966_0244741 3300044684 Unclassified 1081
195 Ga0466961_0044578 3300044693 Bacteria 2838
196 Ga0466963_0067849 3300044694 Bacteria 2394
197 Ga0466963_0193154 3300044694 Unclassified 1422
198 Ga0466963_0908020 3300044694 Unclassified 621
199 Ga0466971_0017870 3300044719 Bacteria 3141
200 Ga0466971_0076493 3300044719 Unclassified 1523
201 Ga0466970_0076268 3300044765 Bacteria 1806
202 Ga0466957_0084159 3300044842 Bacteria 1985
203 Ga0466957_0324925 3300044842 Unclassified 1039
204 Ga0466960_0102458 3300044901 Unclassified 1476
205 Ga0466959_0060576 3300045049 Bacteria 2754
206 Ga0466959_0200823 3300045049 Bacteria 1388
207 Ga0466958_0115072 3300045836 Bacteria 1681
208 Ga0466958_0211652 3300045836 Bacteria 1235
209 Ga0466958_0213056 3300045836 Bacteria 1231
210 Ga0466958_1008375 3300045836 Bacteria 543
211 Ga0466967_0007751 3300045976 Bacteria 7788
212 Ga0466967_0120316 3300045976 Bacteria 2425
213 Ga0466967_0214622 3300045976 Bacteria 1826
214 Ga0466967_0281730 3300045976 Bacteria 1595
215 Ga0466967_0349849 3300045976 Unclassified 1430
216 Ga0466967_0484998 3300045976 Bacteria 1211
217 Ga0466967_1334098 3300045976 Bacteria 714
218 Ga0466967_2123456 3300045976 Bacteria 558
219 Ga0466967_2444392 3300045976 Bacteria 517
220 Ga0495592_0154884 3300046454 Bacteria 1582
221 Ga0495603_0145801 3300046455 Bacteria 1376
222 Ga0495651_0240930 3300046462 Bacteria 1240
223 Ga0495653_0308955 3300046463 Unclassified 1029
224 Ga0495580_0637430 3300046472 Unclassified 702
225 Ga0495664_0107427 3300046477 Bacteria 1684
226 Ga0495594_0142076 3300046499 Unclassified 1362
227 Ga0495608_0091177 3300046511 Bacteria 1971
228 Ga0495628_0264857 3300046516 Bacteria 1280
229 Ga0495630_0145296 3300046517 Bacteria 1804
230 Ga0495630_0232969 3300046517 Bacteria 1407
231 Ga0495652_0075509 3300046529 Bacteria 2799
232 Ga0495667_0015605 3300046559 Bacteria 5135
233 Ga0495635_0180946 3300046663 Bacteria 1433
234 Ga0495635_0308439 3300046663 Unclassified 1060
235 Ga0495657_0017998 3300046675 Bacteria 5121
236 Ga0495657_0063830 3300046675 Bacteria 2428
237 Ga0495623_0161827 3300046679 Bacteria 1315
238 Ga0495581_0198337 3300047315 Bacteria 1174
239 Ga0495680_0122980 3300047322 Unclassified 1914
240 Ga0495680_0153521 3300047322 Bacteria 1677
241 Ga0495684_0017709 3300047471 Bacteria 5486
242 Ga0495602_0158491 3300048088 Bacteria 1770
243 Ga0496100_0002260 3300048903 Bacteria 9733
244 Ga0496101_0002817 3300048904 Bacteria 10685
245 Ga0496102_0001267 3300048905 Bacteria 22812
246 Ga0496102_0318985 3300048905 Bacteria 1464
247 Ga0496102_0585417 3300048905 Unclassified 1039
248 Ga0496103_0031906 3300048906 Bacteria 3213
249 Ga0496104_0001579 3300048907 Bacteria 19611
250 Ga0496104_0105471 3300048907 Bacteria 2701
251 Ga0496104_1079082 3300048907 Unclassified 707
252 Ga0496105_0000948 3300048908 Bacteria 19862
253 Ga0496105_0478463 3300048908 Bacteria 980
254 Ga0496105_1335028 3300048908 Bacteria 522
255 Ga0496106_0030947 3300048909 Bacteria 3989
256 Ga0496107_0040841 3300048910 Bacteria 3331
257 Ga0496108_0005028 3300048911 Bacteria 10685
258 Ga0496109_0000791 3300048912 Bacteria 26324
259 Ga0496109_1187928 3300048912 Unclassified 700
260 Ga0496110_0005196 3300048913 Bacteria 10187
261 Ga0496111_0029035 3300048914 Bacteria 3924
262 Ga0496112_0004873 3300048915 Bacteria 11474
263 Ga0496112_0138360 3300048915 Unclassified 2405
264 Ga0496112_0896749 3300048915 Unclassified 809
265 Ga0496114_0004643 3300048917 Bacteria 10678
266 Ga0496114_1036122 3300048917 Bacteria 704
267 Ga0496114_1491706 3300048917 Bacteria 564
268 Ga0496115_0001152 3300048918 Bacteria 19108
269 Ga0496115_0203029 3300048918 Unclassified 1637
270 Ga0496115_0220748 3300048918 Bacteria 1564
271 Ga0501070_1312501 3300049586 Bacteria 552
272 Ga0501080_0134440 3300049742 Bacteria 2289
273 nmdc:mga0n895_308425_c1 3300050512 Unclassified 1604
274 Ga0495595_0218696 3300053084 Unclassified 950
275 Ga0587066_035501 3300059490 Unclassified 913
276 Ga0587073_0050363 3300059492 Unclassified 942
277 Ga0587073_0313688 3300059492 Unclassified 515
278 Ga0587068_085778 3300059641 Unclassified 642
279 Ga0466962_0026686 3300061719 Bacteria 2773
280 Ga0466962_0090778 3300061719 Unclassified 1463
281 Ga0466962_0371933 3300061719 Bacteria 713
282 Ga0070710_10892006
283 Ga0070658_10447929
284 Ga0070683_100284590
285 Ga0070680_100010495
286 Ga0070680_100311232
287 Ga0070660_100001080
288 Ga0070660_100041776
289 Ga0070660_100148927
290 Ga0070660_100208390
291 Ga0070660_100263462
292 Ga0070661_100088545
293 Ga0070661_100456289
294 Ga0070673_100752674
295 Ga0070659_100018721
296 Ga0070659_100133221
297 Ga0070659_100760266
298 Ga0070659_101850098
299 Ga0070709_10098784
300 Ga0070709_11559298
301 Ga0070714_100025458
302 Ga0070714_100045252
303 Ga0070714_100121405
304 Ga0070714_100243564
305 Ga0070714_100625765
306 Ga0070713_100074015
307 Ga0070710_10051938
308 Ga0070711_100022570
309 Ga0070663_100153312
310 Ga0070681_10027714
311 Ga0070681_10030561
312 Ga0070681_10035194
313 Ga0070681_10216848
314 Ga0070681_10624562
315 Ga0070679_100033744
316 Ga0070679_100059153
317 Ga0070679_100142842
318 Ga0068853_100061233
319 Ga0068853_100486649
320 Ga0070693_100764400
321 Ga0070665_100068970
322 Ga0070665_100233666
323 Ga0068855_100033644
324 Ga0068855_100063349
325 Ga0068855_100231547
326 Ga0068857_100021906
327 Ga0068857_100281663
328 Ga0068857_100672765
329 Ga0068854_100497644
330 Ga0068856_100129442
331 Ga0068852_101153339
332 Ga0068851_10023840
333 Ga0070716_100719285
334 Ga0070712_101133916
335 Ga0105240_10083495
336 Ga0105240_10347785
337 Ga0105241_11076194
338 Ga0105241_11379934
339 Ga0105248_10314469
340 Ga0105248_10754045
341 Ga0105248_12158467
342 Ga0105237_10014918
343 Ga0105237_10859009
344 Ga0105238_10041927
345 Ga0105238_10075831
346 Ga0105238_11790080
347 Ga0105239_10066550
348 Ga0105239_11609639
349 Ga0105246_11878460
350 Ga0157371_10515630
351 Ga0157370_10119017
352 Ga0157370_10126798
353 Ga0157370_10458118
354 Ga0157369_10033792
355 Ga0157369_10079715
356 Ga0157374_10073315
357 Ga0157374_10136453
358 Ga0157374_11983307
359 Ga0157374_12239134
360 Ga0157378_10411982
361 Ga0157372_10022581
362 Ga0157372_10026957
363 Ga0157372_10668205
364 Ga0157372_10973886
365 Ga0157375_11304452
366 Ga0182008_10048094
367 Ga0182008_10075702
368 Ga0197907_10285655
369 Ga0197907_10610725
370 Ga0206356_10710383
371 Ga0206354_11345720
372 Ga0206353_10157127
373 Ga0206353_11295820
374 Ga0213876_10098622
375 Ga0213871_10021861
376 Ga0207692_10026747
377 Ga0207699_11258872
378 Ga0207705_10089448
379 Ga0207705_10136857
380 Ga0207705_10693509
381 Ga0207654_10068941
382 Ga0207707_10004969
383 Ga0207707_10042116
384 Ga0207707_10043499
385 Ga0207707_10540127
386 Ga0207695_10134182
387 Ga0207695_10294076
388 Ga0207671_10285217
389 Ga0207693_10118779
390 Ga0207693_11059582
391 Ga0207660_10068750
392 Ga0207660_10097291
393 Ga0207660_10262243
394 Ga0207660_11169891
395 Ga0207657_10000889
396 Ga0207657_10006259
397 Ga0207657_10029003
398 Ga0207657_10316500
399 Ga0207657_10504504
400 Ga0207649_10037517
401 Ga0207649_10064665
402 Ga0207649_10235852
403 Ga0207649_11341526
404 Ga0207652_10059921
405 Ga0207652_10263337
406 Ga0207694_10254909
407 Ga0207687_10155066
408 Ga0207687_10455621
409 Ga0207687_11238548
410 Ga0207687_11674480
411 Ga0207700_10370843
412 Ga0207700_10609587
413 Ga0207664_10014338
414 Ga0207664_10061720
415 Ga0207664_10103136
416 Ga0207664_10130165
417 Ga0207664_10341113
418 Ga0207664_10498436
419 Ga0207664_10532253
420 Ga0207690_10155707
421 Ga0207690_10272624
422 Ga0207690_10284512
423 Ga0207686_10289843
424 Ga0207665_10702773
425 Ga0207711_10846643
426 Ga0207661_10594311
427 Ga0207667_10064198
428 Ga0207668_11254545
429 Ga0207639_10064801
430 Ga0207639_10296810
431 Ga0207678_10121640
432 Ga0207678_11184139
433 Ga0207702_10227693
434 Ga0207702_10437717
435 Ga0207702_10674904
436 Ga0207702_11230082
437 Ga0207674_10300640
438 Ga0268266_10550858
439 Ga0268266_10683171
440 Ga0265318_10082010
441 Ga0265322_10031093
442 Ga0265338_10113407
443 Ga0265325_10263798
444 Ga0265316_10270293
445 Ga0373943_0127972
446 Ga0373935_0033757
447 Ga0373927_0027747
448 Ga0373947_0107843
449 Ga0373947_0405536
450 Ga0373925_0017711
451 Ga0395899_0072950
452 Ga0395899_0088002
453 Ga0395899_0095515
454 Ga0395900_0030029
455 Ga0395900_0055521
456 Ga0395900_0062834
457 Ga0395900_0249581
458 Ga0395900_0725994
459 Ga0395898_0005391
460 Ga0395898_0049864
461 Ga0395898_0544467
462 Ga0395905_0231363
463 Ga0395905_0579416
464 Ga0395905_1656906
465 Ga0395901_0002575
466 Ga0395901_0008842
467 Ga0395901_0167960
468 Ga0395901_0350488
469 Ga0395901_0388450
470 Ga0395901_0543082
471 Ga0395901_0800663
472 Ga0395901_1466592
473 Ga0436365_0987007
474 Ga0436360_0700049
475 Ga0466966_0244741
476 Ga0466961_0044578
477 Ga0466963_0067849
478 Ga0466963_0193154
479 Ga0466963_0908020
480 Ga0466971_0017870
481 Ga0466971_0076493
482 Ga0466970_0076268
483 Ga0466957_0084159
484 Ga0466957_0324925
485 Ga0466960_0102458
486 Ga0466959_0060576
487 Ga0466959_0200823
488 Ga0466958_0115072
489 Ga0466958_0211652
490 Ga0466958_0213056
491 Ga0466958_1008375
492 Ga0466967_0007751
493 Ga0466967_0120316
494 Ga0466967_0214622
495 Ga0466967_0281730
496 Ga0466967_0349849
497 Ga0466967_0484998
498 Ga0466967_1334098
499 Ga0466967_2123456
500 Ga0466967_2444392
501 Ga0495592_0154884
502 Ga0495603_0145801
503 Ga0495651_0240930
504 Ga0495653_0308955
505 Ga0495580_0637430
506 Ga0495664_0107427
507 Ga0495594_0142076
508 Ga0495608_0091177
509 Ga0495628_0264857
510 Ga0495630_0145296
511 Ga0495630_0232969
512 Ga0495652_0075509
513 Ga0495667_0015605
514 Ga0495635_0180946
515 Ga0495635_0308439
516 Ga0495657_0017998
517 Ga0495657_0063830
518 Ga0495623_0161827
519 Ga0495581_0198337
520 Ga0495680_0122980
521 Ga0495680_0153521
522 Ga0495684_0017709
523 Ga0495602_0158491
524 Ga0496100_0002260
525 Ga0496101_0002817
526 Ga0496102_0001267
527 Ga0496102_0318985
528 Ga0496102_0585417
529 Ga0496103_0031906
530 Ga0496104_0001579
531 Ga0496104_0105471
532 Ga0496104_1079082
533 Ga0496105_0000948
534 Ga0496105_0478463
535 Ga0496105_1335028
536 Ga0496106_0030947
537 Ga0496107_0040841
538 Ga0496108_0005028
539 Ga0496109_0000791
540 Ga0496109_1187928
541 Ga0496110_0005196
542 Ga0496111_0029035
543 Ga0496112_0004873
544 Ga0496112_0138360
545 Ga0496112_0896749
546 Ga0496114_0004643
547 Ga0496114_1036122
548 Ga0496114_1491706
549 Ga0496115_0001152
550 Ga0496115_0203029
551 Ga0496115_0220748
552 Ga0501070_1312501
553 Ga0501080_0134440
554 nmdc:mga0n895_308425_c1
555 Ga0495595_0218696
556 Ga0587066_035501
557 Ga0587073_0050363
558 Ga0587073_0313688
559 Ga0587068_085778
560 Ga0466962_0026686
561 Ga0466962_0090778
562 Ga0466962_0371933

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5exv-assembly1.cif.gz_A crystal structure of heme binding protein hutx from vibrio cholerae 0.5289 9 117
5uim-assembly1.cif.gz_B x-ray structure of the fdtf n-formyltransferase from salmonella enteric o60 in complex with folinic acid and tdp-qui3n 0.5215 99 129
6r8i-assembly1.cif.gz_A pp4r3a evh1 domain bound to fxxp motif 0.5156 29 129
5uin-assembly1.cif.gz_B x-ray structure of the w305a variant of the fdtf n-formyltransferase from salmonella enteric o60 0.5119 99 129
2oqb-assembly1.cif.gz_B crystal structure of the n-terminal domain of coactivator-associated methyltransferase 1 (carm1) 0.5084 31 129
ID Description Score Start End Superfamily
af_Q54S40_938_1039_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6661 77 129 2.30.29.30
af_Q5PQT2_1_122_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6437 77 129 2.30.29.30
3pzdA04 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6377 77 129 2.30.29.30
af_A0A0A0MPV6_159_259_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5651 77 129 2.30.29.30
af_Q9ES63_3_107_2.30.29.180 Mainly Beta;Roll;PH-domain like;Ubiquitin carboxyl-terminal hydrolase 26/29/37, pleckstrin homology-like domain 0.5561 31 129 2.30.29.180
ID Description Score Start End GO Terms
AF-A0A5B8U7R5-F1-model_v4 SCP2 sterol-binding domain-containing protein 0.8097 14 121
AF-A0A5B8U7R5-F1-model_v4 SCP2 sterol-binding domain-containing protein 0.7704 14 121
AF-A0A7W0LXB9-F1-model_v4 Uncharacterized protein 0.752 13 122
AF-A0A7W1M154-F1-model_v4 Uncharacterized protein 0.7277 1 121
AF-A0A7V8VJJ9-F1-model_v4 Uncharacterized protein 0.7201 16 121

Map