F384026

General Info

Members Datasets Scaffolds Average Seq Length
281 157 280 221

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10011908|JGI24740J21852_100119084
Length 250
Sequence LCNRLNSFDSLQRSHKVIHKSHLREGPWRRHGRSMXLADRILFIDGEALVLDKPAGLPVDTPRRGGDSIAARLDELKCGFKRPPTAMHRLDMDTSGCLLFARTPKARTEFQRLFETKQIEKYYIAVLAAEIAAEQGVVDVPLAKQSSAEAGWRMVWSEHGLAATTHWRRIAVRDGSTLVEFRPLTGRTHQIRAHAREAFGRGIAGDRVYGVPGGPMLLHASRLVVPRDRKPSIDVTAPLPDTFGGWADVP

Samples

Sample ID Description Type Environment
1 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
114 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
115 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
125 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
126 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
127 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
128 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
129 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
130 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
131 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
136 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
151 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
152 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
153 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
154 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
155 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
156 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
157 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.34
Nodule 0
Rhizoplane 5.34
Rhizosphere 87.54
Stem 0
Stem Tuber 0
Unclassified 1.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10011908 3300001979 Bacteria 3295
2 JGI24738J21930_10033557 3300002075 Bacteria 1046
3 Ga0070658_10115904 3300005327 Bacteria 2223
4 Ga0070658_10502303 3300005327 Bacteria 1048
5 Ga0070670_100011899 3300005331 Bacteria 7440
6 Ga0070670_100025648 3300005331 Bacteria 5071
7 Ga0070666_10054920 3300005335 Bacteria 2687
8 Ga0070680_100053771 3300005336 Bacteria 3286
9 Ga0070682_100116971 3300005337 Bacteria 1784
10 Ga0068868_100250521 3300005338 Bacteria 1490
11 Ga0070660_100540628 3300005339 Bacteria 971
12 Ga0070660_100612537 3300005339 Unclassified 911
13 Ga0070691_10013408 3300005341 Bacteria 3753
14 Ga0070661_100051577 3300005344 Bacteria 3011
15 Ga0070661_100221814 3300005344 Bacteria 1450
16 Ga0070661_100648353 3300005344 Bacteria 857
17 Ga0070668_100420196 3300005347 Bacteria 1145
18 Ga0070675_100151839 3300005354 Bacteria 1986
19 Ga0070675_100243203 3300005354 Bacteria 1573
20 Ga0070675_100833740 3300005354 Unclassified 843
21 Ga0070671_100003051 3300005355 Bacteria 13024
22 Ga0070673_100003803 3300005364 Bacteria 9471
23 Ga0070673_100726877 3300005364 Unclassified 913
24 Ga0070659_100003142 3300005366 Bacteria 11760
25 Ga0070659_100048117 3300005366 Bacteria 3348
26 Ga0070667_100018960 3300005367 Bacteria 5704
27 Ga0070714_100252959 3300005435 Bacteria 1630
28 Ga0070714_100366198 3300005435 Bacteria 1356
29 Ga0070713_100065299 3300005436 Bacteria 3056
30 Ga0070713_100142038 3300005436 Bacteria 2128
31 Ga0070663_100137328 3300005455 Bacteria 1863
32 Ga0070663_100160773 3300005455 Bacteria 1729
33 Ga0070663_100167174 3300005455 Bacteria 1697
34 Ga0070662_100010272 3300005457 Bacteria 6137
35 Ga0070662_100041642 3300005457 Bacteria 3278
36 Ga0070681_10040890 3300005458 Bacteria 4645
37 Ga0070684_100106479 3300005535 Bacteria 2510
38 Ga0068853_100047084 3300005539 Bacteria 3700
39 Ga0070672_100008045 3300005543 Bacteria 7202
40 Ga0070693_100413701 3300005547 Bacteria 938
41 Ga0070665_100143210 3300005548 Bacteria 2393
42 Ga0068855_100133138 3300005563 Bacteria 2837
43 Ga0068855_100880462 3300005563 Bacteria 947
44 Ga0070664_100008107 3300005564 Bacteria 8491
45 Ga0070664_100044336 3300005564 Bacteria 3755
46 Ga0070664_100343924 3300005564 Bacteria 1355
47 Ga0068857_100004444 3300005577 Bacteria 11862
48 Ga0068857_100025761 3300005577 Bacteria 5178
49 Ga0068857_100085604 3300005577 Bacteria 2817
50 Ga0068854_100027819 3300005578 Bacteria 3900
51 Ga0068854_100046581 3300005578 Bacteria 3087
52 Ga0068854_100107680 3300005578 Bacteria 2098
53 Ga0068856_100001655 3300005614 Bacteria 23351
54 Ga0068856_100004367 3300005614 Bacteria 14088
55 Ga0068856_100332994 3300005614 Bacteria 1536
56 Ga0068856_100406776 3300005614 Bacteria 1380
57 Ga0068852_100039093 3300005616 Bacteria 3992
58 Ga0068852_100151495 3300005616 Bacteria 2157
59 Ga0068852_100806414 3300005616 Bacteria 953
60 Ga0068864_100168155 3300005618 Bacteria 1998
61 Ga0068851_10268204 3300005834 Bacteria 973
62 Ga0068863_100000013 3300005841 Bacteria 220357
63 Ga0068863_100058002 3300005841 Bacteria 3664
64 Ga0068858_100008945 3300005842 Bacteria 9597
65 Ga0070717_10026970 3300006028 Bacteria 4588
66 Ga0070717_10373378 3300006028 Bacteria 1278
67 Ga0075362_10145898 3300006177 Bacteria 1133
68 Ga0075366_10028321 3300006195 Bacteria 3288
69 Ga0075366_10109183 3300006195 Bacteria 1664
70 Ga0097621_100021424 3300006237 Bacteria 4999
71 Ga0097621_100480571 3300006237 Bacteria 1123
72 Ga0105240_10364145 3300009093 Bacteria 1637
73 Ga0105241_10128397 3300009174 Bacteria 2050
74 Ga0105248_10001787 3300009177 Bacteria 23901
75 Ga0105237_10063554 3300009545 Bacteria 3689
76 Ga0105238_10027981 3300009551 Bacteria 5744
77 Ga0105246_10054421 3300011119 Bacteria 2758
78 Ga0157373_10035293 3300013100 Bacteria 3590
79 Ga0157373_10184559 3300013100 Bacteria 1469
80 Ga0157373_10203526 3300013100 Bacteria 1396
81 Ga0157370_10009635 3300013104 Bacteria 10277
82 Ga0157370_10249262 3300013104 Bacteria 1643
83 Ga0157370_10306388 3300013104 Bacteria 1466
84 Ga0157369_10095898 3300013105 Bacteria 3165
85 Ga0157369_10112602 3300013105 Bacteria 2891
86 Ga0157369_10171851 3300013105 Bacteria 2283
87 Ga0157369_10447442 3300013105 Bacteria 1338
88 Ga0163162_10075645 3300013306 Bacteria 3428
89 Ga0157372_10035026 3300013307 Bacteria 5524
90 Ga0157372_11429336 3300013307 Bacteria 797
91 Ga0157375_10111021 3300013308 Bacteria 2840
92 Ga0163163_10067172 3300014325 Bacteria 3564
93 Ga0213876_10017149 3300021384 Bacteria 3823
94 Ga0209050_1043189 3300025298 Bacteria 1221
95 Ga0207697_10018627 3300025315 Bacteria 2847
96 Ga0207688_10023030 3300025901 Bacteria 3408
97 Ga0207647_10006318 3300025904 Bacteria 8622
98 Ga0207647_10011528 3300025904 Bacteria 6195
99 Ga0207647_10077068 3300025904 Bacteria 2004
100 Ga0207705_10030310 3300025909 Bacteria 3859
101 Ga0207705_10087291 3300025909 Bacteria 2281
102 Ga0207705_10162816 3300025909 Bacteria 1676
103 Ga0207707_10426548 3300025912 Bacteria 1136
104 Ga0207671_10140718 3300025914 Bacteria 1859
105 Ga0207657_10036376 3300025919 Bacteria 4406
106 Ga0207657_10111560 3300025919 Bacteria 2258
107 Ga0207657_10191902 3300025919 Bacteria 1647
108 Ga0207657_10314629 3300025919 Bacteria 1239
109 Ga0207649_10040567 3300025920 Bacteria 2830
110 Ga0207694_10055961 3300025924 Bacteria 3063
111 Ga0207650_10003451 3300025925 Bacteria 10859
112 Ga0207659_10054840 3300025926 Bacteria 2848
113 Ga0207659_10112865 3300025926 Bacteria 2069
114 Ga0207700_10112113 3300025928 Bacteria 2197
115 Ga0207700_10119948 3300025928 Bacteria 2131
116 Ga0207664_10039224 3300025929 Bacteria 3677
117 Ga0207664_10128291 3300025929 Bacteria 2132
118 Ga0207664_10219202 3300025929 Bacteria 1649
119 Ga0207644_10006505 3300025931 Bacteria 7618
120 Ga0207644_10007614 3300025931 Bacteria 7060
121 Ga0207690_10016249 3300025932 Bacteria 4524
122 Ga0207690_10020614 3300025932 Bacteria 4076
123 Ga0207690_10063454 3300025932 Bacteria 2519
124 Ga0207690_10147205 3300025932 Bacteria 1742
125 Ga0207706_10004012 3300025933 Bacteria 13933
126 Ga0207706_10177147 3300025933 Bacteria 1873
127 Ga0207691_10008730 3300025940 Bacteria 9719
128 Ga0207691_10040886 3300025940 Bacteria 4283
129 Ga0207711_10001082 3300025941 Bacteria 26041
130 Ga0207711_10020383 3300025941 Bacteria 5527
131 Ga0207661_10031797 3300025944 Bacteria 4081
132 Ga0207679_10042339 3300025945 Bacteria 3272
133 Ga0207679_10107664 3300025945 Bacteria 2194
134 Ga0207679_10250839 3300025945 Bacteria 1505
135 Ga0207667_10029330 3300025949 Bacteria 5968
136 Ga0207667_10082304 3300025949 Bacteria 3335
137 Ga0207667_10352650 3300025949 Bacteria 1500
138 Ga0207667_10812306 3300025949 Bacteria 931
139 Ga0207651_10473365 3300025960 Bacteria 1078
140 Ga0207668_10389648 3300025972 Bacteria 1175
141 Ga0207640_10022042 3300025981 Bacteria 3807
142 Ga0207640_10036471 3300025981 Bacteria 3087
143 Ga0207640_10107178 3300025981 Bacteria 1972
144 Ga0207658_10006472 3300025986 Bacteria 7994
145 Ga0207677_10242799 3300026023 Bacteria 1458
146 Ga0207703_10105168 3300026035 Bacteria 2399
147 Ga0207639_10051355 3300026041 Bacteria 3136
148 Ga0207678_10008325 3300026067 Bacteria 9140
149 Ga0207678_10031826 3300026067 Bacteria 4600
150 Ga0207702_10010548 3300026078 Bacteria 7724
151 Ga0207702_10024140 3300026078 Bacteria 5045
152 Ga0207702_10070922 3300026078 Bacteria 2998
153 Ga0207641_10000099 3300026088 Bacteria 122892
154 Ga0207641_10009618 3300026088 Bacteria 7967
155 Ga0207641_10141026 3300026088 Bacteria 2174
156 Ga0207676_10001614 3300026095 Bacteria 16604
157 Ga0207676_10147037 3300026095 Bacteria 2025
158 Ga0207674_10000319 3300026116 Bacteria 61196
159 Ga0207674_10003055 3300026116 Bacteria 20711
160 Ga0207683_10236834 3300026121 Bacteria 1665
161 Ga0207698_10161118 3300026142 Bacteria 1962
162 Ga0207698_10210443 3300026142 Bacteria 1749
163 Ga0207698_10716629 3300026142 Bacteria 997
164 Ga0268266_10121013 3300028379 Bacteria 2329
165 Ga0268265_11329931 3300028380 Bacteria 719
166 Ga0307408_100276379 3300031548 Bacteria 1397
167 Ga0307407_10057485 3300031903 Bacteria 2257
168 Ga0307412_10031393 3300031911 Bacteria 3355
169 Ga0307409_100040394 3300031995 Bacteria 3473
170 Ga0307416_100059244 3300032002 Bacteria 3110
171 Ga0307414_10000511 3300032004 Bacteria 20212
172 Ga0307415_100049579 3300032126 Bacteria 2840
173 Ga0307510_10018982 3300033180 Bacteria 8069
174 Ga0373955_0074931 3300035172 Bacteria 1901
175 Ga0373942_0045377 3300035207 Bacteria 1214
176 Ga0373935_0591400 3300035692 Bacteria 811
177 Ga0395899_0115248 3300037312 Bacteria 1929
178 Ga0395899_0251778 3300037312 Bacteria 1212
179 Ga0395899_0382171 3300037312 Bacteria 936
180 Ga0395900_0026291 3300037418 Bacteria 5960
181 Ga0395900_0061479 3300037418 Bacteria 3861
182 Ga0395900_0088250 3300037418 Bacteria 3188
183 Ga0395900_0224567 3300037418 Bacteria 1891
184 Ga0395900_0259656 3300037418 Bacteria 1735
185 Ga0395900_0281587 3300037418 Bacteria 1654
186 Ga0395900_0411067 3300037418 Bacteria 1315
187 Ga0395900_0420725 3300037418 Bacteria 1297
188 Ga0395900_0605727 3300037418 Bacteria 1035
189 Ga0395900_0819884 3300037418 Bacteria 857
190 Ga0395898_0089472 3300037466 Bacteria 2962
191 Ga0395898_0368521 3300037466 Bacteria 1370
192 Ga0395898_0534985 3300037466 Bacteria 1113
193 Ga0395898_0592685 3300037466 Bacteria 1051
194 Ga0395898_0674886 3300037466 Bacteria 975
195 Ga0395905_0000956 3300037471 Bacteria 37067
196 Ga0395905_0035551 3300037471 Bacteria 4678
197 Ga0395905_0060038 3300037471 Bacteria 3555
198 Ga0395905_0074783 3300037471 Bacteria 3175
199 Ga0395905_0096503 3300037471 Bacteria 2775
200 Ga0395905_0243162 3300037471 Bacteria 1681
201 Ga0395905_0352649 3300037471 Bacteria 1364
202 Ga0395905_0568174 3300037471 Bacteria 1035
203 Ga0395901_0055721 3300038443 Bacteria 4111
204 Ga0395901_0061927 3300038443 Bacteria 3893
205 Ga0395901_0066999 3300038443 Bacteria 3739
206 Ga0395901_0099192 3300038443 Bacteria 3054
207 Ga0395901_0116896 3300038443 Bacteria 2802
208 Ga0395901_0164293 3300038443 Bacteria 2331
209 Ga0395901_0271328 3300038443 Bacteria 1764
210 Ga0395901_0550199 3300038443 Bacteria 1170
211 Ga0395901_0863117 3300038443 Unclassified 889
212 Ga0436365_1559806 3300039437 Bacteria 10079
213 Ga0451853_0996121 3300041512 Bacteria 996
214 Ga0439448_0003800 3300042005 Bacteria 4216
215 Ga0439458_0000300 3300042157 Bacteria 12305
216 Ga0466972_0107957 3300044658 Bacteria 1316
217 Ga0466961_0028842 3300044693 Bacteria 3569
218 Ga0466961_0050811 3300044693 Bacteria 2648
219 Ga0466961_0108923 3300044693 Bacteria 1743
220 Ga0466963_0048284 3300044694 Bacteria 2811
221 Ga0466963_0156511 3300044694 Bacteria 1584
222 Ga0466970_0002082 3300044765 Bacteria 9676
223 Ga0466970_0120562 3300044765 Bacteria 1436
224 Ga0466957_0002575 3300044842 Bacteria 9756
225 Ga0466957_0040464 3300044842 Bacteria 2815
226 Ga0466957_0131074 3300044842 Bacteria 1606
227 Ga0466957_0147744 3300044842 Bacteria 1518
228 Ga0466959_0038409 3300045049 Bacteria 3538
229 Ga0466959_0178475 3300045049 Bacteria 1486
230 Ga0466958_0001929 3300045836 Bacteria 10160
231 Ga0466958_0308202 3300045836 Bacteria 1017
232 Ga0466967_0024114 3300045976 Bacteria 4996
233 Ga0466967_0073664 3300045976 Bacteria 3064
234 Ga0466967_0113371 3300045976 Bacteria 2494
235 Ga0466967_0313721 3300045976 Bacteria 1511
236 Ga0466967_0424366 3300045976 Bacteria 1296
237 Ga0466967_0494689 3300045976 Bacteria 1199
238 Ga0466967_0815915 3300045976 Bacteria 926
239 Ga0495638_0038649 3300046460 Bacteria 3031
240 Ga0495637_0008748 3300046520 Bacteria 4961
241 Ga0495643_0000005 3300046522 Bacteria 443135
242 Ga0495663_0022847 3300046525 Bacteria 1809
243 Ga0495642_0127725 3300046528 Bacteria 1093
244 Ga0495598_0000495 3300046537 Bacteria 7257
245 Ga0495621_0000055 3300046539 Bacteria 21830
246 Ga0495597_0131601 3300046542 Bacteria 1037
247 Ga0495633_0136934 3300046558 Bacteria 1132
248 Ga0495625_0004013 3300046660 Bacteria 14083
249 Ga0495669_0016422 3300046684 Bacteria 3170
250 Ga0495670_0000771 3300046691 Bacteria 15356
251 Ga0495671_0000007 3300046692 Bacteria 443069
252 Ga0495671_0037184 3300046692 Bacteria 2463
253 Ga0495681_0078724 3300047470 Bacteria 1476
254 Ga0496100_0636147 3300048903 Bacteria 830
255 Ga0496101_0010489 3300048904 Bacteria 6120
256 Ga0496102_0284918 3300048905 Bacteria 1557
257 Ga0496103_0106438 3300048906 Bacteria 1779
258 Ga0496106_0004503 3300048909 Bacteria 10324
259 Ga0496107_0012337 3300048910 Bacteria 5966
260 Ga0496108_0249032 3300048911 Bacteria 1545
261 Ga0496109_0010877 3300048912 Bacteria 7791
262 Ga0496110_0033261 3300048913 Bacteria 4458
263 Ga0496110_0276456 3300048913 Bacteria 1529
264 Ga0496111_0077802 3300048914 Bacteria 2418
265 Ga0496112_0002145 3300048915 Bacteria 15663
266 Ga0496112_0068401 3300048915 Bacteria 3507
267 Ga0496113_0007571 3300048916 Bacteria 7002
268 Ga0496113_0141639 3300048916 Bacteria 1892
269 Ga0501031_0452181 3300049568 Bacteria 830
270 nmdc:mga03683_166594_c1 3300050489 Bacteria 1000
271 nmdc:mga0k408_192838_c1 3300050493 Bacteria 1216
272 Ga0500643_000466 3300053087 Bacteria 29832
273 Ga0500643_001269 3300053087 Bacteria 14922
274 Ga0500643_001448 3300053087 Bacteria 13672
275 Ga0500643_005734 3300053087 Bacteria 5298
276 Ga0500556_0000074 3300053104 Bacteria 98799
277 Ga0500594_0006041 3300053118 Bacteria 2706
278 Ga0500608_049285 3300053122 Bacteria 2025
279 Ga0500642_0000002 3300053130 Bacteria 795093
280 Ga0500645_000439 3300053730 Bacteria 28425

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046520 Ga0495637_0008748 Ga0495637_0008748_501_1226 190
2 3300046522 Ga0495643_0000005 Ga0495643_0000005_370654_371379 190
3 3300046558 Ga0495633_0136934 Ga0495633_0136934_372_1097 190
4 3300046692 Ga0495671_0000007 Ga0495671_0000007_370588_371313 190
5 3300047470 Ga0495681_0078724 Ga0495681_0078724_391_1116 190
6 3300025945 Ga0207679_10250839 Ga0207679_102508392 205
7 3300005339 Ga0070660_100540628 Ga0070660_1005406281 208
8 3300025932 Ga0207690_10147205 Ga0207690_101472052 208
9 3300025981 Ga0207640_10107178 Ga0207640_101071782 208
10 3300005535 Ga0070684_100106479 Ga0070684_1001064793 210
11 3300005564 Ga0070664_100343924 Ga0070664_1003439242 210
12 3300025944 Ga0207661_10031797 Ga0207661_100317973 210
13 3300026078 Ga0207702_10070922 Ga0207702_100709222 210
14 3300033180 Ga0307510_10018982 Ga0307510_100189824 213
15 iso_pu_bacteria 2919709256 2919710513 213
16 3300005344 Ga0070661_100648353 Ga0070661_1006483531 214
17 3300005354 Ga0070675_100243203 Ga0070675_1002432032 214
18 3300025933 Ga0207706_10177147 Ga0207706_101771472 214
19 3300041512 Ga0451853_0996121 Ga0451853_0996121_87_734 214
20 3300044842 Ga0466957_0147744 Ga0466957_0147744_154_801 214
21 3300048913 Ga0496110_0276456 Ga0496110_0276456_863_1510 214
22 3300049568 Ga0501031_0452181 Ga0501031_0452181_79_729 214
23 3300002075 JGI24738J21930_10033557 JGI24738J21930_100335571 215
24 3300005338 Ga0068868_100250521 Ga0068868_1002505212 215
25 3300005339 Ga0070660_100612537 Ga0070660_1006125371 215
26 3300005355 Ga0070671_100003051 Ga0070671_1000030514 215
27 3300005364 Ga0070673_100726877 Ga0070673_1007268771 215
28 3300005435 Ga0070714_100366198 Ga0070714_1003661983 215
29 3300005455 Ga0070663_100167174 Ga0070663_1001671742 215
30 3300005578 Ga0068854_100046581 Ga0068854_1000465813 215
31 3300005614 Ga0068856_100004367 Ga0068856_10000436710 215
32 3300005616 Ga0068852_100806414 Ga0068852_1008064141 215
33 3300005618 Ga0068864_100168155 Ga0068864_1001681552 215
34 3300005834 Ga0068851_10268204 Ga0068851_102682041 215
35 3300005841 Ga0068863_100000013 Ga0068863_100000013195 215
36 3300006237 Ga0097621_100480571 Ga0097621_1004805712 215
37 3300009093 Ga0105240_10364145 Ga0105240_103641453 215
38 3300009177 Ga0105248_10001787 Ga0105248_1000178715 215
39 3300013100 Ga0157373_10203526 Ga0157373_102035262 215
40 3300013104 Ga0157370_10306388 Ga0157370_103063882 215
41 3300013105 Ga0157369_10095898 Ga0157369_100958985 215
42 3300021384 Ga0213876_10017149 Ga0213876_100171495 215
43 3300025904 Ga0207647_10077068 Ga0207647_100770684 215
44 3300025919 Ga0207657_10191902 Ga0207657_101919022 215
45 3300025919 Ga0207657_10314629 Ga0207657_103146291 215
46 3300025929 Ga0207664_10128291 Ga0207664_101282911 215
47 3300025931 Ga0207644_10007614 Ga0207644_100076147 215
48 3300025941 Ga0207711_10001082 Ga0207711_1000108219 215
49 3300025960 Ga0207651_10473365 Ga0207651_104733652 215
50 3300025981 Ga0207640_10036471 Ga0207640_100364713 215
51 3300026023 Ga0207677_10242799 Ga0207677_102427993 215
52 3300026067 Ga0207678_10008325 Ga0207678_100083252 215
53 3300026078 Ga0207702_10010548 Ga0207702_100105487 215
54 3300026088 Ga0207641_10000099 Ga0207641_1000009953 215
55 3300026095 Ga0207676_10001614 Ga0207676_1000161415 215
56 3300026142 Ga0207698_10716629 Ga0207698_107166291 215
57 3300035207 Ga0373942_0045377 Ga0373942_0045377_146_793 215
58 3300037312 Ga0395899_0251778 Ga0395899_0251778_47_694 215
59 3300037418 Ga0395900_0061479 Ga0395900_0061479_817_1464 215
60 3300037418 Ga0395900_0819884 Ga0395900_0819884_91_738 215
61 3300037466 Ga0395898_0089472 Ga0395898_0089472_608_1255 215
62 3300037471 Ga0395905_0074783 Ga0395905_0074783_1583_2230 215
63 3300038443 Ga0395901_0116896 Ga0395901_0116896_621_1268 215
64 3300039437 Ga0436365_1559806 Ga0436365_1559806_7233_7880 215
65 3300044658 Ga0466972_0107957 Ga0466972_0107957_282_929 215
66 3300044693 Ga0466961_0028842 Ga0466961_0028842_2450_3100 215
67 3300044694 Ga0466963_0156511 Ga0466963_0156511_529_1176 215
68 3300045049 Ga0466959_0178475 Ga0466959_0178475_715_1365 215
69 3300045836 Ga0466958_0308202 Ga0466958_0308202_357_1004 215
70 3300045976 Ga0466967_0424366 Ga0466967_0424366_173_844 215
71 3300045976 Ga0466967_0815915 Ga0466967_0815915_216_863 215
72 3300046525 Ga0495663_0022847 Ga0495663_0022847_949_1596 215
73 3300046528 Ga0495642_0127725 Ga0495642_0127725_59_706 215
74 3300048903 Ga0496100_0636147 Ga0496100_0636147_158_805 215
75 3300048904 Ga0496101_0010489 Ga0496101_0010489_2809_3456 215
76 3300048909 Ga0496106_0004503 Ga0496106_0004503_5852_6499 215
77 3300048910 Ga0496107_0012337 Ga0496107_0012337_2763_3410 215
78 3300048911 Ga0496108_0249032 Ga0496108_0249032_744_1391 215
79 3300048912 Ga0496109_0010877 Ga0496109_0010877_706_1353 215
80 3300048913 Ga0496110_0033261 Ga0496110_0033261_460_1107 215
81 3300048914 Ga0496111_0077802 Ga0496111_0077802_1004_1651 215
82 3300048915 Ga0496112_0002145 Ga0496112_0002145_2686_3333 215
83 3300048916 Ga0496113_0007571 Ga0496113_0007571_4656_5303 215
84 3300005327 Ga0070658_10115904 Ga0070658_101159042 216
85 3300005331 Ga0070670_100025648 Ga0070670_1000256482 216
86 3300005336 Ga0070680_100053771 Ga0070680_1000537712 216
87 3300005354 Ga0070675_100833740 Ga0070675_1008337401 216
88 3300005364 Ga0070673_100003803 Ga0070673_1000038034 216
89 3300005366 Ga0070659_100048117 Ga0070659_1000481171 216
90 3300005435 Ga0070714_100252959 Ga0070714_1002529592 216
91 3300005436 Ga0070713_100065299 Ga0070713_1000652994 216
92 3300005455 Ga0070663_100160773 Ga0070663_1001607732 216
93 3300005539 Ga0068853_100047084 Ga0068853_1000470845 216
94 3300005548 Ga0070665_100143210 Ga0070665_1001432104 216
95 3300005577 Ga0068857_100004444 Ga0068857_10000444414 216
96 3300005577 Ga0068857_100025761 Ga0068857_1000257617 216
97 3300005614 Ga0068856_100332994 Ga0068856_1003329941 216
98 3300005614 Ga0068856_100406776 Ga0068856_1004067762 216
99 3300005616 Ga0068852_100039093 Ga0068852_1000390936 216
100 3300005841 Ga0068863_100058002 Ga0068863_1000580025 216
101 3300006028 Ga0070717_10373378 Ga0070717_103733781 216
102 3300006195 Ga0075366_10109183 Ga0075366_101091833 216
103 3300009174 Ga0105241_10128397 Ga0105241_101283973 216
104 3300009545 Ga0105237_10063554 Ga0105237_100635542 216
105 3300009551 Ga0105238_10027981 Ga0105238_100279818 216
106 3300013100 Ga0157373_10184559 Ga0157373_101845592 216
107 3300013104 Ga0157370_10009635 Ga0157370_100096352 216
108 3300013104 Ga0157370_10249262 Ga0157370_102492622 216
109 3300013105 Ga0157369_10112602 Ga0157369_101126025 216
110 3300013105 Ga0157369_10171851 Ga0157369_101718514 216
111 3300013105 Ga0157369_10447442 Ga0157369_104474421 216
112 3300013306 Ga0163162_10075645 Ga0163162_100756451 216
113 3300013307 Ga0157372_10035026 Ga0157372_100350262 216
114 3300013307 Ga0157372_11429336 Ga0157372_114293361 216
115 3300025315 Ga0207697_10018627 Ga0207697_100186274 216
116 3300025901 Ga0207688_10023030 Ga0207688_100230302 216
117 3300025904 Ga0207647_10011528 Ga0207647_100115284 216
118 3300025909 Ga0207705_10087291 Ga0207705_100872912 216
119 3300025909 Ga0207705_10162816 Ga0207705_101628162 216
120 3300025919 Ga0207657_10111560 Ga0207657_101115603 216
121 3300025926 Ga0207659_10054840 Ga0207659_100548402 216
122 3300025928 Ga0207700_10112113 Ga0207700_101121132 216
123 3300025929 Ga0207664_10219202 Ga0207664_102192022 216
124 3300025932 Ga0207690_10063454 Ga0207690_100634541 216
125 3300025940 Ga0207691_10040886 Ga0207691_100408863 216
126 3300025949 Ga0207667_10812306 Ga0207667_108123062 216
127 3300026067 Ga0207678_10031826 Ga0207678_100318262 216
128 3300026088 Ga0207641_10141026 Ga0207641_101410261 216
129 3300026095 Ga0207676_10147037 Ga0207676_101470373 216
130 3300026116 Ga0207674_10000319 Ga0207674_1000031942 216
131 3300026116 Ga0207674_10003055 Ga0207674_100030558 216
132 3300026121 Ga0207683_10236834 Ga0207683_102368342 216
133 3300026142 Ga0207698_10210443 Ga0207698_102104433 216
134 3300028379 Ga0268266_10121013 Ga0268266_101210132 216
135 3300028380 Ga0268265_11329931 Ga0268265_113299311 216
136 3300031548 Ga0307408_100276379 Ga0307408_1002763793 216
137 3300031911 Ga0307412_10031393 Ga0307412_100313935 216
138 3300032002 Ga0307416_100059244 Ga0307416_1000592445 216
139 3300032126 Ga0307415_100049579 Ga0307415_1000495791 216
140 3300037312 Ga0395899_0115248 Ga0395899_0115248_434_1084 216
141 3300037312 Ga0395899_0382171 Ga0395899_0382171_110_760 216
142 3300037418 Ga0395900_0026291 Ga0395900_0026291_4777_5427 216
143 3300037418 Ga0395900_0224567 Ga0395900_0224567_30_680 216
144 3300037418 Ga0395900_0259656 Ga0395900_0259656_939_1589 216
145 3300037418 Ga0395900_0281587 Ga0395900_0281587_237_911 216
146 3300037418 Ga0395900_0411067 Ga0395900_0411067_461_1111 216
147 3300037418 Ga0395900_0420725 Ga0395900_0420725_185_835 216
148 3300037418 Ga0395900_0605727 Ga0395900_0605727_239_889 216
149 3300037466 Ga0395898_0368521 Ga0395898_0368521_462_1112 216
150 3300037466 Ga0395898_0534985 Ga0395898_0534985_83_733 216
151 3300037466 Ga0395898_0592685 Ga0395898_0592685_144_794 216
152 3300037471 Ga0395905_0035551 Ga0395905_0035551_883_1533 216
153 3300037471 Ga0395905_0060038 Ga0395905_0060038_354_1004 216
154 3300037471 Ga0395905_0243162 Ga0395905_0243162_701_1351 216
155 3300037471 Ga0395905_0352649 Ga0395905_0352649_163_813 216
156 3300037471 Ga0395905_0568174 Ga0395905_0568174_124_774 216
157 3300038443 Ga0395901_0055721 Ga0395901_0055721_2552_3202 216
158 3300038443 Ga0395901_0066999 Ga0395901_0066999_2844_3494 216
159 3300038443 Ga0395901_0099192 Ga0395901_0099192_2323_2973 216
160 3300038443 Ga0395901_0164293 Ga0395901_0164293_182_832 216
161 3300038443 Ga0395901_0271328 Ga0395901_0271328_786_1436 216
162 3300038443 Ga0395901_0550199 Ga0395901_0550199_166_816 216
163 3300038443 Ga0395901_0863117 Ga0395901_0863117_210_860 216
164 3300042005 Ga0439448_0003800 Ga0439448_0003800_1898_2548 216
165 3300042157 Ga0439458_0000300 Ga0439458_0000300_2029_2679 216
166 3300044693 Ga0466961_0050811 Ga0466961_0050811_1580_2230 216
167 3300044693 Ga0466961_0108923 Ga0466961_0108923_109_759 216
168 3300044694 Ga0466963_0048284 Ga0466963_0048284_1042_1692 216
169 3300044765 Ga0466970_0002082 Ga0466970_0002082_6185_6835 216
170 3300044765 Ga0466970_0120562 Ga0466970_0120562_669_1319 216
171 3300044842 Ga0466957_0040464 Ga0466957_0040464_652_1302 216
172 3300044842 Ga0466957_0131074 Ga0466957_0131074_595_1245 216
173 3300045049 Ga0466959_0038409 Ga0466959_0038409_2040_2690 216
174 3300045976 Ga0466967_0073664 Ga0466967_0073664_1859_2509 216
175 3300045976 Ga0466967_0113371 Ga0466967_0113371_1294_1944 216
176 3300045976 Ga0466967_0313721 Ga0466967_0313721_377_1027 216
177 3300053087 Ga0500643_000466 Ga0500643_000466_11701_12360 216
178 3300053087 Ga0500643_001269 Ga0500643_001269_14167_14826 216
179 3300005563 Ga0068855_100880462 Ga0068855_1008804622 217
180 3300005616 Ga0068852_100151495 Ga0068852_1001514951 217
181 3300025949 Ga0207667_10352650 Ga0207667_103526502 217
182 3300026142 Ga0207698_10161118 Ga0207698_101611183 217
183 3300005327 Ga0070658_10502303 Ga0070658_105023032 219
184 3300005331 Ga0070670_100011899 Ga0070670_1000118995 219
185 3300005335 Ga0070666_10054920 Ga0070666_100549202 219
186 3300005347 Ga0070668_100420196 Ga0070668_1004201962 219
187 3300005354 Ga0070675_100151839 Ga0070675_1001518392 219
188 3300005367 Ga0070667_100018960 Ga0070667_1000189604 219
189 3300005457 Ga0070662_100010272 Ga0070662_1000102726 219
190 3300005543 Ga0070672_100008045 Ga0070672_1000080457 219
191 3300005564 Ga0070664_100008107 Ga0070664_1000081076 219
192 3300005842 Ga0068858_100008945 Ga0068858_1000089458 219
193 3300006237 Ga0097621_100021424 Ga0097621_1000214245 219
194 3300013308 Ga0157375_10111021 Ga0157375_101110215 219
195 3300025925 Ga0207650_10003451 Ga0207650_100034515 219
196 3300025926 Ga0207659_10112865 Ga0207659_101128653 219
197 3300025931 Ga0207644_10006505 Ga0207644_100065054 219
198 3300025933 Ga0207706_10004012 Ga0207706_100040124 219
199 3300025940 Ga0207691_10008730 Ga0207691_100087307 219
200 3300025941 Ga0207711_10020383 Ga0207711_100203835 219
201 3300025945 Ga0207679_10042339 Ga0207679_100423394 219
202 3300025972 Ga0207668_10389648 Ga0207668_103896482 219
203 3300025986 Ga0207658_10006472 Ga0207658_100064729 219
204 3300026035 Ga0207703_10105168 Ga0207703_101051681 219
205 3300026088 Ga0207641_10009618 Ga0207641_1000961810 219
206 3300005344 Ga0070661_100221814 Ga0070661_1002218142 220
207 3300005366 Ga0070659_100003142 Ga0070659_10000314214 220
208 3300005458 Ga0070681_10040890 Ga0070681_100408902 220
209 3300005547 Ga0070693_100413701 Ga0070693_1004137011 220
210 3300005563 Ga0068855_100133138 Ga0068855_1001331385 220
211 3300005564 Ga0070664_100044336 Ga0070664_1000443365 220
212 3300005577 Ga0068857_100085604 Ga0068857_1000856042 220
213 3300005578 Ga0068854_100027819 Ga0068854_1000278191 220
214 3300005614 Ga0068856_100001655 Ga0068856_1000016559 220
215 3300006177 Ga0075362_10145898 Ga0075362_101458982 220
216 3300011119 Ga0105246_10054421 Ga0105246_100544212 220
217 3300013100 Ga0157373_10035293 Ga0157373_100352933 220
218 3300014325 Ga0163163_10067172 Ga0163163_100671725 220
219 3300025912 Ga0207707_10426548 Ga0207707_104265482 220
220 3300025920 Ga0207649_10040567 Ga0207649_100405674 220
221 3300025932 Ga0207690_10016249 Ga0207690_100162496 220
222 3300025949 Ga0207667_10082304 Ga0207667_100823042 220
223 3300025981 Ga0207640_10022042 Ga0207640_100220421 220
224 3300026078 Ga0207702_10024140 Ga0207702_100241402 220
225 3300031903 Ga0307407_10057485 Ga0307407_100574852 220
226 3300031995 Ga0307409_100040394 Ga0307409_1000403944 220
227 3300037418 Ga0395900_0088250 Ga0395900_0088250_2412_3074 220
228 3300037466 Ga0395898_0674886 Ga0395898_0674886_71_733 220
229 3300037471 Ga0395905_0000956 Ga0395905_0000956_23725_24387 220
230 3300037471 Ga0395905_0096503 Ga0395905_0096503_1188_1850 220
231 3300038443 Ga0395901_0061927 Ga0395901_0061927_2515_3177 220
232 3300044842 Ga0466957_0002575 Ga0466957_0002575_928_1590 220
233 3300045836 Ga0466958_0001929 Ga0466958_0001929_7136_7798 220
234 3300045976 Ga0466967_0024114 Ga0466967_0024114_1636_2298 220
235 3300048905 Ga0496102_0284918 Ga0496102_0284918_691_1377 220
236 3300048906 Ga0496103_0106438 Ga0496103_0106438_27_713 220
237 3300048915 Ga0496112_0068401 Ga0496112_0068401_1257_1943 220
238 3300048916 Ga0496113_0141639 Ga0496113_0141639_637_1323 220
239 3300050489 nmdc:mga03683_166594_c1 nmdc:mga03683_166594_c1_171_833 220
240 3300050493 nmdc:mga0k408_192838_c1 nmdc:mga0k408_192838_c1_283_945 220
241 3300053087 Ga0500643_001448 Ga0500643_001448_9303_10001 223
242 3300045976 Ga0466967_0494689 Ga0466967_0494689_453_1136 225
243 3300032004 Ga0307414_10000511 Ga0307414_100005119 227
244 3300035172 Ga0373955_0074931 Ga0373955_0074931_778_1461 227
245 3300035692 Ga0373935_0591400 Ga0373935_0591400_113_796 227
246 3300046537 Ga0495598_0000495 Ga0495598_0000495_3827_4510 227
247 3300046539 Ga0495621_0000055 Ga0495621_0000055_2621_3304 227
248 3300046684 Ga0495669_0016422 Ga0495669_0016422_2285_2968 227
249 3300046691 Ga0495670_0000771 Ga0495670_0000771_6343_7026 227
250 3300046692 Ga0495671_0037184 Ga0495671_0037184_1404_2207 227
251 3300053087 Ga0500643_005734 Ga0500643_005734_3087_3872 227
252 3300053118 Ga0500594_0006041 Ga0500594_0006041_12_815 227
253 3300005436 Ga0070713_100142038 Ga0070713_1001420382 228
254 3300006028 Ga0070717_10026970 Ga0070717_100269703 228
255 3300025928 Ga0207700_10119948 Ga0207700_101199482 228
256 3300025929 Ga0207664_10039224 Ga0207664_100392242 228
257 3300006195 Ga0075366_10028321 Ga0075366_100283213 229
258 3300025298 Ga0209050_1043189 Ga0209050_10431892 229
259 3300046460 Ga0495638_0038649 Ga0495638_0038649_875_1621 229
260 3300046542 Ga0495597_0131601 Ga0495597_0131601_279_1025 229
261 3300046660 Ga0495625_0004013 Ga0495625_0004013_11466_12212 229
262 3300053104 Ga0500556_0000074 Ga0500556_0000074_34624_35370 229
263 3300053122 Ga0500608_049285 Ga0500608_049285_610_1356 229
264 3300053130 Ga0500642_0000002 Ga0500642_0000002_562185_562931 229
265 3300053730 Ga0500645_000439 Ga0500645_000439_25374_26120 229
266 3300001979 JGI24740J21852_10011908 JGI24740J21852_100119084 250
267 3300005337 Ga0070682_100116971 Ga0070682_1001169712 250
268 3300005341 Ga0070691_10013408 Ga0070691_100134082 250
269 3300005344 Ga0070661_100051577 Ga0070661_1000515772 250
270 3300005455 Ga0070663_100137328 Ga0070663_1001373283 250
271 3300005457 Ga0070662_100041642 Ga0070662_1000416423 250
272 3300005578 Ga0068854_100107680 Ga0068854_1001076803 250
273 3300025904 Ga0207647_10006318 Ga0207647_100063187 250
274 3300025909 Ga0207705_10030310 Ga0207705_100303103 250
275 3300025914 Ga0207671_10140718 Ga0207671_101407182 250
276 3300025919 Ga0207657_10036376 Ga0207657_100363765 250
277 3300025924 Ga0207694_10055961 Ga0207694_100559612 250
278 3300025932 Ga0207690_10020614 Ga0207690_100206144 250
279 3300025945 Ga0207679_10107664 Ga0207679_101076643 250
280 3300025949 Ga0207667_10029330 Ga0207667_100293304 250
281 3300026041 Ga0207639_10051355 Ga0207639_100513551 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00849

PseudoU_synth_2

RNA pseudouridylate synthase

47

197

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v9k-assembly2.cif.gz_B the crystal structure of the catalytic domain of pseudouridine synthase rluc from escherichia coli 0.9024 38 243
1xpi-assembly2.cif.gz_B crystal structure of the catalytic domain of e. coli pseudouridine synthase rluc 0.9014 37 243
1xpi-assembly1.cif.gz_A crystal structure of the catalytic domain of e. coli pseudouridine synthase rluc 0.8799 34 243
7aoi-assembly1.cif.gz_XP trypanosoma brucei mitochondrial ribosome large subunit assembly intermediate 0.8791 38 245
2i82-assembly2.cif.gz_B crystal structure of pseudouridine synthase rlua: indirect sequence readout through protein-induced rna structure 0.8679 40 238
ID Description Score Start End Superfamily
af_K7MNI8_169_435_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9146 36 226 3.30.2350.10
af_Q9LT72_184_455_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9069 40 237 3.30.2350.10
af_Q69K07_177_348_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9058 40 189 3.30.2350.10
af_Q4QQT0_90_339_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9054 36 232 3.30.2350.10
af_Q4DM27_158_395_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.8996 38 245 3.30.2350.10
ID Description Score Start End GO Terms
AF-A0A654C4Z5-F1-model_v4 Putative enzyme (EC 5.4.99.-) 0.9712 50 244 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A257Q9F3-F1-model_v4 RNA pseudouridine synthase 0.9474 49 248 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A1I4SQW4-F1-model_v4 RNA pseudouridine synthase 0.942 36 248 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A7W9ZGV6-F1-model_v4 RluA family pseudouridine synthase 0.9369 36 246 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A239ALE5-F1-model_v4 tRNA pseudouridine32 synthase / 23S rRNA pseudouridine746 synthase 0.9356 36 248 GO:0000455
GO:0003723
GO:0009982
GO:0140098

Feature Viewer

pLDDT pTM Quality
85.64 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map