F384026
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 281 | 157 | 280 | 221 |
Family's Representative Sequence
| Representative Sequence | 3300001979|JGI24740J21852_10011908|JGI24740J21852_100119084 |
| Length | 250 |
| Sequence | LCNRLNSFDSLQRSHKVIHKSHLREGPWRRHGRSMXLADRILFIDGEALVLDKPAGLPVDTPRRGGDSIAARLDELKCGFKRPPTAMHRLDMDTSGCLLFARTPKARTEFQRLFETKQIEKYYIAVLAAEIAAEQGVVDVPLAKQSSAEAGWRMVWSEHGLAATTHWRRIAVRDGSTLVEFRPLTGRTHQIRAHAREAFGRGIAGDRVYGVPGGPMLLHASRLVVPRDRKPSIDVTAPLPDTFGGWADVP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 41 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 42 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 57 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 96 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 97 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 98 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 99 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 100 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 101 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 102 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 103 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 104 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 105 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 106 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 107 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 108 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 109 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 110 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 111 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 112 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 113 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 114 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 115 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 116 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 117 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 118 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 119 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 120 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 121 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 122 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 123 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 140 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 141 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 142 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 143 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 146 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 147 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 148 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 149 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 151 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 152 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 153 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 154 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 155 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 156 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 157 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.64 |
| Metatranscriptomes | 0 |
| Isolates | 0.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.34 |
| Nodule | 0 |
| Rhizoplane | 5.34 |
| Rhizosphere | 87.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10011908 | 3300001979 | Bacteria | 3295 |
| 2 | JGI24738J21930_10033557 | 3300002075 | Bacteria | 1046 |
| 3 | Ga0070658_10115904 | 3300005327 | Bacteria | 2223 |
| 4 | Ga0070658_10502303 | 3300005327 | Bacteria | 1048 |
| 5 | Ga0070670_100011899 | 3300005331 | Bacteria | 7440 |
| 6 | Ga0070670_100025648 | 3300005331 | Bacteria | 5071 |
| 7 | Ga0070666_10054920 | 3300005335 | Bacteria | 2687 |
| 8 | Ga0070680_100053771 | 3300005336 | Bacteria | 3286 |
| 9 | Ga0070682_100116971 | 3300005337 | Bacteria | 1784 |
| 10 | Ga0068868_100250521 | 3300005338 | Bacteria | 1490 |
| 11 | Ga0070660_100540628 | 3300005339 | Bacteria | 971 |
| 12 | Ga0070660_100612537 | 3300005339 | Unclassified | 911 |
| 13 | Ga0070691_10013408 | 3300005341 | Bacteria | 3753 |
| 14 | Ga0070661_100051577 | 3300005344 | Bacteria | 3011 |
| 15 | Ga0070661_100221814 | 3300005344 | Bacteria | 1450 |
| 16 | Ga0070661_100648353 | 3300005344 | Bacteria | 857 |
| 17 | Ga0070668_100420196 | 3300005347 | Bacteria | 1145 |
| 18 | Ga0070675_100151839 | 3300005354 | Bacteria | 1986 |
| 19 | Ga0070675_100243203 | 3300005354 | Bacteria | 1573 |
| 20 | Ga0070675_100833740 | 3300005354 | Unclassified | 843 |
| 21 | Ga0070671_100003051 | 3300005355 | Bacteria | 13024 |
| 22 | Ga0070673_100003803 | 3300005364 | Bacteria | 9471 |
| 23 | Ga0070673_100726877 | 3300005364 | Unclassified | 913 |
| 24 | Ga0070659_100003142 | 3300005366 | Bacteria | 11760 |
| 25 | Ga0070659_100048117 | 3300005366 | Bacteria | 3348 |
| 26 | Ga0070667_100018960 | 3300005367 | Bacteria | 5704 |
| 27 | Ga0070714_100252959 | 3300005435 | Bacteria | 1630 |
| 28 | Ga0070714_100366198 | 3300005435 | Bacteria | 1356 |
| 29 | Ga0070713_100065299 | 3300005436 | Bacteria | 3056 |
| 30 | Ga0070713_100142038 | 3300005436 | Bacteria | 2128 |
| 31 | Ga0070663_100137328 | 3300005455 | Bacteria | 1863 |
| 32 | Ga0070663_100160773 | 3300005455 | Bacteria | 1729 |
| 33 | Ga0070663_100167174 | 3300005455 | Bacteria | 1697 |
| 34 | Ga0070662_100010272 | 3300005457 | Bacteria | 6137 |
| 35 | Ga0070662_100041642 | 3300005457 | Bacteria | 3278 |
| 36 | Ga0070681_10040890 | 3300005458 | Bacteria | 4645 |
| 37 | Ga0070684_100106479 | 3300005535 | Bacteria | 2510 |
| 38 | Ga0068853_100047084 | 3300005539 | Bacteria | 3700 |
| 39 | Ga0070672_100008045 | 3300005543 | Bacteria | 7202 |
| 40 | Ga0070693_100413701 | 3300005547 | Bacteria | 938 |
| 41 | Ga0070665_100143210 | 3300005548 | Bacteria | 2393 |
| 42 | Ga0068855_100133138 | 3300005563 | Bacteria | 2837 |
| 43 | Ga0068855_100880462 | 3300005563 | Bacteria | 947 |
| 44 | Ga0070664_100008107 | 3300005564 | Bacteria | 8491 |
| 45 | Ga0070664_100044336 | 3300005564 | Bacteria | 3755 |
| 46 | Ga0070664_100343924 | 3300005564 | Bacteria | 1355 |
| 47 | Ga0068857_100004444 | 3300005577 | Bacteria | 11862 |
| 48 | Ga0068857_100025761 | 3300005577 | Bacteria | 5178 |
| 49 | Ga0068857_100085604 | 3300005577 | Bacteria | 2817 |
| 50 | Ga0068854_100027819 | 3300005578 | Bacteria | 3900 |
| 51 | Ga0068854_100046581 | 3300005578 | Bacteria | 3087 |
| 52 | Ga0068854_100107680 | 3300005578 | Bacteria | 2098 |
| 53 | Ga0068856_100001655 | 3300005614 | Bacteria | 23351 |
| 54 | Ga0068856_100004367 | 3300005614 | Bacteria | 14088 |
| 55 | Ga0068856_100332994 | 3300005614 | Bacteria | 1536 |
| 56 | Ga0068856_100406776 | 3300005614 | Bacteria | 1380 |
| 57 | Ga0068852_100039093 | 3300005616 | Bacteria | 3992 |
| 58 | Ga0068852_100151495 | 3300005616 | Bacteria | 2157 |
| 59 | Ga0068852_100806414 | 3300005616 | Bacteria | 953 |
| 60 | Ga0068864_100168155 | 3300005618 | Bacteria | 1998 |
| 61 | Ga0068851_10268204 | 3300005834 | Bacteria | 973 |
| 62 | Ga0068863_100000013 | 3300005841 | Bacteria | 220357 |
| 63 | Ga0068863_100058002 | 3300005841 | Bacteria | 3664 |
| 64 | Ga0068858_100008945 | 3300005842 | Bacteria | 9597 |
| 65 | Ga0070717_10026970 | 3300006028 | Bacteria | 4588 |
| 66 | Ga0070717_10373378 | 3300006028 | Bacteria | 1278 |
| 67 | Ga0075362_10145898 | 3300006177 | Bacteria | 1133 |
| 68 | Ga0075366_10028321 | 3300006195 | Bacteria | 3288 |
| 69 | Ga0075366_10109183 | 3300006195 | Bacteria | 1664 |
| 70 | Ga0097621_100021424 | 3300006237 | Bacteria | 4999 |
| 71 | Ga0097621_100480571 | 3300006237 | Bacteria | 1123 |
| 72 | Ga0105240_10364145 | 3300009093 | Bacteria | 1637 |
| 73 | Ga0105241_10128397 | 3300009174 | Bacteria | 2050 |
| 74 | Ga0105248_10001787 | 3300009177 | Bacteria | 23901 |
| 75 | Ga0105237_10063554 | 3300009545 | Bacteria | 3689 |
| 76 | Ga0105238_10027981 | 3300009551 | Bacteria | 5744 |
| 77 | Ga0105246_10054421 | 3300011119 | Bacteria | 2758 |
| 78 | Ga0157373_10035293 | 3300013100 | Bacteria | 3590 |
| 79 | Ga0157373_10184559 | 3300013100 | Bacteria | 1469 |
| 80 | Ga0157373_10203526 | 3300013100 | Bacteria | 1396 |
| 81 | Ga0157370_10009635 | 3300013104 | Bacteria | 10277 |
| 82 | Ga0157370_10249262 | 3300013104 | Bacteria | 1643 |
| 83 | Ga0157370_10306388 | 3300013104 | Bacteria | 1466 |
| 84 | Ga0157369_10095898 | 3300013105 | Bacteria | 3165 |
| 85 | Ga0157369_10112602 | 3300013105 | Bacteria | 2891 |
| 86 | Ga0157369_10171851 | 3300013105 | Bacteria | 2283 |
| 87 | Ga0157369_10447442 | 3300013105 | Bacteria | 1338 |
| 88 | Ga0163162_10075645 | 3300013306 | Bacteria | 3428 |
| 89 | Ga0157372_10035026 | 3300013307 | Bacteria | 5524 |
| 90 | Ga0157372_11429336 | 3300013307 | Bacteria | 797 |
| 91 | Ga0157375_10111021 | 3300013308 | Bacteria | 2840 |
| 92 | Ga0163163_10067172 | 3300014325 | Bacteria | 3564 |
| 93 | Ga0213876_10017149 | 3300021384 | Bacteria | 3823 |
| 94 | Ga0209050_1043189 | 3300025298 | Bacteria | 1221 |
| 95 | Ga0207697_10018627 | 3300025315 | Bacteria | 2847 |
| 96 | Ga0207688_10023030 | 3300025901 | Bacteria | 3408 |
| 97 | Ga0207647_10006318 | 3300025904 | Bacteria | 8622 |
| 98 | Ga0207647_10011528 | 3300025904 | Bacteria | 6195 |
| 99 | Ga0207647_10077068 | 3300025904 | Bacteria | 2004 |
| 100 | Ga0207705_10030310 | 3300025909 | Bacteria | 3859 |
| 101 | Ga0207705_10087291 | 3300025909 | Bacteria | 2281 |
| 102 | Ga0207705_10162816 | 3300025909 | Bacteria | 1676 |
| 103 | Ga0207707_10426548 | 3300025912 | Bacteria | 1136 |
| 104 | Ga0207671_10140718 | 3300025914 | Bacteria | 1859 |
| 105 | Ga0207657_10036376 | 3300025919 | Bacteria | 4406 |
| 106 | Ga0207657_10111560 | 3300025919 | Bacteria | 2258 |
| 107 | Ga0207657_10191902 | 3300025919 | Bacteria | 1647 |
| 108 | Ga0207657_10314629 | 3300025919 | Bacteria | 1239 |
| 109 | Ga0207649_10040567 | 3300025920 | Bacteria | 2830 |
| 110 | Ga0207694_10055961 | 3300025924 | Bacteria | 3063 |
| 111 | Ga0207650_10003451 | 3300025925 | Bacteria | 10859 |
| 112 | Ga0207659_10054840 | 3300025926 | Bacteria | 2848 |
| 113 | Ga0207659_10112865 | 3300025926 | Bacteria | 2069 |
| 114 | Ga0207700_10112113 | 3300025928 | Bacteria | 2197 |
| 115 | Ga0207700_10119948 | 3300025928 | Bacteria | 2131 |
| 116 | Ga0207664_10039224 | 3300025929 | Bacteria | 3677 |
| 117 | Ga0207664_10128291 | 3300025929 | Bacteria | 2132 |
| 118 | Ga0207664_10219202 | 3300025929 | Bacteria | 1649 |
| 119 | Ga0207644_10006505 | 3300025931 | Bacteria | 7618 |
| 120 | Ga0207644_10007614 | 3300025931 | Bacteria | 7060 |
| 121 | Ga0207690_10016249 | 3300025932 | Bacteria | 4524 |
| 122 | Ga0207690_10020614 | 3300025932 | Bacteria | 4076 |
| 123 | Ga0207690_10063454 | 3300025932 | Bacteria | 2519 |
| 124 | Ga0207690_10147205 | 3300025932 | Bacteria | 1742 |
| 125 | Ga0207706_10004012 | 3300025933 | Bacteria | 13933 |
| 126 | Ga0207706_10177147 | 3300025933 | Bacteria | 1873 |
| 127 | Ga0207691_10008730 | 3300025940 | Bacteria | 9719 |
| 128 | Ga0207691_10040886 | 3300025940 | Bacteria | 4283 |
| 129 | Ga0207711_10001082 | 3300025941 | Bacteria | 26041 |
| 130 | Ga0207711_10020383 | 3300025941 | Bacteria | 5527 |
| 131 | Ga0207661_10031797 | 3300025944 | Bacteria | 4081 |
| 132 | Ga0207679_10042339 | 3300025945 | Bacteria | 3272 |
| 133 | Ga0207679_10107664 | 3300025945 | Bacteria | 2194 |
| 134 | Ga0207679_10250839 | 3300025945 | Bacteria | 1505 |
| 135 | Ga0207667_10029330 | 3300025949 | Bacteria | 5968 |
| 136 | Ga0207667_10082304 | 3300025949 | Bacteria | 3335 |
| 137 | Ga0207667_10352650 | 3300025949 | Bacteria | 1500 |
| 138 | Ga0207667_10812306 | 3300025949 | Bacteria | 931 |
| 139 | Ga0207651_10473365 | 3300025960 | Bacteria | 1078 |
| 140 | Ga0207668_10389648 | 3300025972 | Bacteria | 1175 |
| 141 | Ga0207640_10022042 | 3300025981 | Bacteria | 3807 |
| 142 | Ga0207640_10036471 | 3300025981 | Bacteria | 3087 |
| 143 | Ga0207640_10107178 | 3300025981 | Bacteria | 1972 |
| 144 | Ga0207658_10006472 | 3300025986 | Bacteria | 7994 |
| 145 | Ga0207677_10242799 | 3300026023 | Bacteria | 1458 |
| 146 | Ga0207703_10105168 | 3300026035 | Bacteria | 2399 |
| 147 | Ga0207639_10051355 | 3300026041 | Bacteria | 3136 |
| 148 | Ga0207678_10008325 | 3300026067 | Bacteria | 9140 |
| 149 | Ga0207678_10031826 | 3300026067 | Bacteria | 4600 |
| 150 | Ga0207702_10010548 | 3300026078 | Bacteria | 7724 |
| 151 | Ga0207702_10024140 | 3300026078 | Bacteria | 5045 |
| 152 | Ga0207702_10070922 | 3300026078 | Bacteria | 2998 |
| 153 | Ga0207641_10000099 | 3300026088 | Bacteria | 122892 |
| 154 | Ga0207641_10009618 | 3300026088 | Bacteria | 7967 |
| 155 | Ga0207641_10141026 | 3300026088 | Bacteria | 2174 |
| 156 | Ga0207676_10001614 | 3300026095 | Bacteria | 16604 |
| 157 | Ga0207676_10147037 | 3300026095 | Bacteria | 2025 |
| 158 | Ga0207674_10000319 | 3300026116 | Bacteria | 61196 |
| 159 | Ga0207674_10003055 | 3300026116 | Bacteria | 20711 |
| 160 | Ga0207683_10236834 | 3300026121 | Bacteria | 1665 |
| 161 | Ga0207698_10161118 | 3300026142 | Bacteria | 1962 |
| 162 | Ga0207698_10210443 | 3300026142 | Bacteria | 1749 |
| 163 | Ga0207698_10716629 | 3300026142 | Bacteria | 997 |
| 164 | Ga0268266_10121013 | 3300028379 | Bacteria | 2329 |
| 165 | Ga0268265_11329931 | 3300028380 | Bacteria | 719 |
| 166 | Ga0307408_100276379 | 3300031548 | Bacteria | 1397 |
| 167 | Ga0307407_10057485 | 3300031903 | Bacteria | 2257 |
| 168 | Ga0307412_10031393 | 3300031911 | Bacteria | 3355 |
| 169 | Ga0307409_100040394 | 3300031995 | Bacteria | 3473 |
| 170 | Ga0307416_100059244 | 3300032002 | Bacteria | 3110 |
| 171 | Ga0307414_10000511 | 3300032004 | Bacteria | 20212 |
| 172 | Ga0307415_100049579 | 3300032126 | Bacteria | 2840 |
| 173 | Ga0307510_10018982 | 3300033180 | Bacteria | 8069 |
| 174 | Ga0373955_0074931 | 3300035172 | Bacteria | 1901 |
| 175 | Ga0373942_0045377 | 3300035207 | Bacteria | 1214 |
| 176 | Ga0373935_0591400 | 3300035692 | Bacteria | 811 |
| 177 | Ga0395899_0115248 | 3300037312 | Bacteria | 1929 |
| 178 | Ga0395899_0251778 | 3300037312 | Bacteria | 1212 |
| 179 | Ga0395899_0382171 | 3300037312 | Bacteria | 936 |
| 180 | Ga0395900_0026291 | 3300037418 | Bacteria | 5960 |
| 181 | Ga0395900_0061479 | 3300037418 | Bacteria | 3861 |
| 182 | Ga0395900_0088250 | 3300037418 | Bacteria | 3188 |
| 183 | Ga0395900_0224567 | 3300037418 | Bacteria | 1891 |
| 184 | Ga0395900_0259656 | 3300037418 | Bacteria | 1735 |
| 185 | Ga0395900_0281587 | 3300037418 | Bacteria | 1654 |
| 186 | Ga0395900_0411067 | 3300037418 | Bacteria | 1315 |
| 187 | Ga0395900_0420725 | 3300037418 | Bacteria | 1297 |
| 188 | Ga0395900_0605727 | 3300037418 | Bacteria | 1035 |
| 189 | Ga0395900_0819884 | 3300037418 | Bacteria | 857 |
| 190 | Ga0395898_0089472 | 3300037466 | Bacteria | 2962 |
| 191 | Ga0395898_0368521 | 3300037466 | Bacteria | 1370 |
| 192 | Ga0395898_0534985 | 3300037466 | Bacteria | 1113 |
| 193 | Ga0395898_0592685 | 3300037466 | Bacteria | 1051 |
| 194 | Ga0395898_0674886 | 3300037466 | Bacteria | 975 |
| 195 | Ga0395905_0000956 | 3300037471 | Bacteria | 37067 |
| 196 | Ga0395905_0035551 | 3300037471 | Bacteria | 4678 |
| 197 | Ga0395905_0060038 | 3300037471 | Bacteria | 3555 |
| 198 | Ga0395905_0074783 | 3300037471 | Bacteria | 3175 |
| 199 | Ga0395905_0096503 | 3300037471 | Bacteria | 2775 |
| 200 | Ga0395905_0243162 | 3300037471 | Bacteria | 1681 |
| 201 | Ga0395905_0352649 | 3300037471 | Bacteria | 1364 |
| 202 | Ga0395905_0568174 | 3300037471 | Bacteria | 1035 |
| 203 | Ga0395901_0055721 | 3300038443 | Bacteria | 4111 |
| 204 | Ga0395901_0061927 | 3300038443 | Bacteria | 3893 |
| 205 | Ga0395901_0066999 | 3300038443 | Bacteria | 3739 |
| 206 | Ga0395901_0099192 | 3300038443 | Bacteria | 3054 |
| 207 | Ga0395901_0116896 | 3300038443 | Bacteria | 2802 |
| 208 | Ga0395901_0164293 | 3300038443 | Bacteria | 2331 |
| 209 | Ga0395901_0271328 | 3300038443 | Bacteria | 1764 |
| 210 | Ga0395901_0550199 | 3300038443 | Bacteria | 1170 |
| 211 | Ga0395901_0863117 | 3300038443 | Unclassified | 889 |
| 212 | Ga0436365_1559806 | 3300039437 | Bacteria | 10079 |
| 213 | Ga0451853_0996121 | 3300041512 | Bacteria | 996 |
| 214 | Ga0439448_0003800 | 3300042005 | Bacteria | 4216 |
| 215 | Ga0439458_0000300 | 3300042157 | Bacteria | 12305 |
| 216 | Ga0466972_0107957 | 3300044658 | Bacteria | 1316 |
| 217 | Ga0466961_0028842 | 3300044693 | Bacteria | 3569 |
| 218 | Ga0466961_0050811 | 3300044693 | Bacteria | 2648 |
| 219 | Ga0466961_0108923 | 3300044693 | Bacteria | 1743 |
| 220 | Ga0466963_0048284 | 3300044694 | Bacteria | 2811 |
| 221 | Ga0466963_0156511 | 3300044694 | Bacteria | 1584 |
| 222 | Ga0466970_0002082 | 3300044765 | Bacteria | 9676 |
| 223 | Ga0466970_0120562 | 3300044765 | Bacteria | 1436 |
| 224 | Ga0466957_0002575 | 3300044842 | Bacteria | 9756 |
| 225 | Ga0466957_0040464 | 3300044842 | Bacteria | 2815 |
| 226 | Ga0466957_0131074 | 3300044842 | Bacteria | 1606 |
| 227 | Ga0466957_0147744 | 3300044842 | Bacteria | 1518 |
| 228 | Ga0466959_0038409 | 3300045049 | Bacteria | 3538 |
| 229 | Ga0466959_0178475 | 3300045049 | Bacteria | 1486 |
| 230 | Ga0466958_0001929 | 3300045836 | Bacteria | 10160 |
| 231 | Ga0466958_0308202 | 3300045836 | Bacteria | 1017 |
| 232 | Ga0466967_0024114 | 3300045976 | Bacteria | 4996 |
| 233 | Ga0466967_0073664 | 3300045976 | Bacteria | 3064 |
| 234 | Ga0466967_0113371 | 3300045976 | Bacteria | 2494 |
| 235 | Ga0466967_0313721 | 3300045976 | Bacteria | 1511 |
| 236 | Ga0466967_0424366 | 3300045976 | Bacteria | 1296 |
| 237 | Ga0466967_0494689 | 3300045976 | Bacteria | 1199 |
| 238 | Ga0466967_0815915 | 3300045976 | Bacteria | 926 |
| 239 | Ga0495638_0038649 | 3300046460 | Bacteria | 3031 |
| 240 | Ga0495637_0008748 | 3300046520 | Bacteria | 4961 |
| 241 | Ga0495643_0000005 | 3300046522 | Bacteria | 443135 |
| 242 | Ga0495663_0022847 | 3300046525 | Bacteria | 1809 |
| 243 | Ga0495642_0127725 | 3300046528 | Bacteria | 1093 |
| 244 | Ga0495598_0000495 | 3300046537 | Bacteria | 7257 |
| 245 | Ga0495621_0000055 | 3300046539 | Bacteria | 21830 |
| 246 | Ga0495597_0131601 | 3300046542 | Bacteria | 1037 |
| 247 | Ga0495633_0136934 | 3300046558 | Bacteria | 1132 |
| 248 | Ga0495625_0004013 | 3300046660 | Bacteria | 14083 |
| 249 | Ga0495669_0016422 | 3300046684 | Bacteria | 3170 |
| 250 | Ga0495670_0000771 | 3300046691 | Bacteria | 15356 |
| 251 | Ga0495671_0000007 | 3300046692 | Bacteria | 443069 |
| 252 | Ga0495671_0037184 | 3300046692 | Bacteria | 2463 |
| 253 | Ga0495681_0078724 | 3300047470 | Bacteria | 1476 |
| 254 | Ga0496100_0636147 | 3300048903 | Bacteria | 830 |
| 255 | Ga0496101_0010489 | 3300048904 | Bacteria | 6120 |
| 256 | Ga0496102_0284918 | 3300048905 | Bacteria | 1557 |
| 257 | Ga0496103_0106438 | 3300048906 | Bacteria | 1779 |
| 258 | Ga0496106_0004503 | 3300048909 | Bacteria | 10324 |
| 259 | Ga0496107_0012337 | 3300048910 | Bacteria | 5966 |
| 260 | Ga0496108_0249032 | 3300048911 | Bacteria | 1545 |
| 261 | Ga0496109_0010877 | 3300048912 | Bacteria | 7791 |
| 262 | Ga0496110_0033261 | 3300048913 | Bacteria | 4458 |
| 263 | Ga0496110_0276456 | 3300048913 | Bacteria | 1529 |
| 264 | Ga0496111_0077802 | 3300048914 | Bacteria | 2418 |
| 265 | Ga0496112_0002145 | 3300048915 | Bacteria | 15663 |
| 266 | Ga0496112_0068401 | 3300048915 | Bacteria | 3507 |
| 267 | Ga0496113_0007571 | 3300048916 | Bacteria | 7002 |
| 268 | Ga0496113_0141639 | 3300048916 | Bacteria | 1892 |
| 269 | Ga0501031_0452181 | 3300049568 | Bacteria | 830 |
| 270 | nmdc:mga03683_166594_c1 | 3300050489 | Bacteria | 1000 |
| 271 | nmdc:mga0k408_192838_c1 | 3300050493 | Bacteria | 1216 |
| 272 | Ga0500643_000466 | 3300053087 | Bacteria | 29832 |
| 273 | Ga0500643_001269 | 3300053087 | Bacteria | 14922 |
| 274 | Ga0500643_001448 | 3300053087 | Bacteria | 13672 |
| 275 | Ga0500643_005734 | 3300053087 | Bacteria | 5298 |
| 276 | Ga0500556_0000074 | 3300053104 | Bacteria | 98799 |
| 277 | Ga0500594_0006041 | 3300053118 | Bacteria | 2706 |
| 278 | Ga0500608_049285 | 3300053122 | Bacteria | 2025 |
| 279 | Ga0500642_0000002 | 3300053130 | Bacteria | 795093 |
| 280 | Ga0500645_000439 | 3300053730 | Bacteria | 28425 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046520 | Ga0495637_0008748 | Ga0495637_0008748_501_1226 | 190 |
| 2 | 3300046522 | Ga0495643_0000005 | Ga0495643_0000005_370654_371379 | 190 |
| 3 | 3300046558 | Ga0495633_0136934 | Ga0495633_0136934_372_1097 | 190 |
| 4 | 3300046692 | Ga0495671_0000007 | Ga0495671_0000007_370588_371313 | 190 |
| 5 | 3300047470 | Ga0495681_0078724 | Ga0495681_0078724_391_1116 | 190 |
| 6 | 3300025945 | Ga0207679_10250839 | Ga0207679_102508392 | 205 |
| 7 | 3300005339 | Ga0070660_100540628 | Ga0070660_1005406281 | 208 |
| 8 | 3300025932 | Ga0207690_10147205 | Ga0207690_101472052 | 208 |
| 9 | 3300025981 | Ga0207640_10107178 | Ga0207640_101071782 | 208 |
| 10 | 3300005535 | Ga0070684_100106479 | Ga0070684_1001064793 | 210 |
| 11 | 3300005564 | Ga0070664_100343924 | Ga0070664_1003439242 | 210 |
| 12 | 3300025944 | Ga0207661_10031797 | Ga0207661_100317973 | 210 |
| 13 | 3300026078 | Ga0207702_10070922 | Ga0207702_100709222 | 210 |
| 14 | 3300033180 | Ga0307510_10018982 | Ga0307510_100189824 | 213 |
| 15 | iso_pu_bacteria | 2919709256 | 2919710513 | 213 |
| 16 | 3300005344 | Ga0070661_100648353 | Ga0070661_1006483531 | 214 |
| 17 | 3300005354 | Ga0070675_100243203 | Ga0070675_1002432032 | 214 |
| 18 | 3300025933 | Ga0207706_10177147 | Ga0207706_101771472 | 214 |
| 19 | 3300041512 | Ga0451853_0996121 | Ga0451853_0996121_87_734 | 214 |
| 20 | 3300044842 | Ga0466957_0147744 | Ga0466957_0147744_154_801 | 214 |
| 21 | 3300048913 | Ga0496110_0276456 | Ga0496110_0276456_863_1510 | 214 |
| 22 | 3300049568 | Ga0501031_0452181 | Ga0501031_0452181_79_729 | 214 |
| 23 | 3300002075 | JGI24738J21930_10033557 | JGI24738J21930_100335571 | 215 |
| 24 | 3300005338 | Ga0068868_100250521 | Ga0068868_1002505212 | 215 |
| 25 | 3300005339 | Ga0070660_100612537 | Ga0070660_1006125371 | 215 |
| 26 | 3300005355 | Ga0070671_100003051 | Ga0070671_1000030514 | 215 |
| 27 | 3300005364 | Ga0070673_100726877 | Ga0070673_1007268771 | 215 |
| 28 | 3300005435 | Ga0070714_100366198 | Ga0070714_1003661983 | 215 |
| 29 | 3300005455 | Ga0070663_100167174 | Ga0070663_1001671742 | 215 |
| 30 | 3300005578 | Ga0068854_100046581 | Ga0068854_1000465813 | 215 |
| 31 | 3300005614 | Ga0068856_100004367 | Ga0068856_10000436710 | 215 |
| 32 | 3300005616 | Ga0068852_100806414 | Ga0068852_1008064141 | 215 |
| 33 | 3300005618 | Ga0068864_100168155 | Ga0068864_1001681552 | 215 |
| 34 | 3300005834 | Ga0068851_10268204 | Ga0068851_102682041 | 215 |
| 35 | 3300005841 | Ga0068863_100000013 | Ga0068863_100000013195 | 215 |
| 36 | 3300006237 | Ga0097621_100480571 | Ga0097621_1004805712 | 215 |
| 37 | 3300009093 | Ga0105240_10364145 | Ga0105240_103641453 | 215 |
| 38 | 3300009177 | Ga0105248_10001787 | Ga0105248_1000178715 | 215 |
| 39 | 3300013100 | Ga0157373_10203526 | Ga0157373_102035262 | 215 |
| 40 | 3300013104 | Ga0157370_10306388 | Ga0157370_103063882 | 215 |
| 41 | 3300013105 | Ga0157369_10095898 | Ga0157369_100958985 | 215 |
| 42 | 3300021384 | Ga0213876_10017149 | Ga0213876_100171495 | 215 |
| 43 | 3300025904 | Ga0207647_10077068 | Ga0207647_100770684 | 215 |
| 44 | 3300025919 | Ga0207657_10191902 | Ga0207657_101919022 | 215 |
| 45 | 3300025919 | Ga0207657_10314629 | Ga0207657_103146291 | 215 |
| 46 | 3300025929 | Ga0207664_10128291 | Ga0207664_101282911 | 215 |
| 47 | 3300025931 | Ga0207644_10007614 | Ga0207644_100076147 | 215 |
| 48 | 3300025941 | Ga0207711_10001082 | Ga0207711_1000108219 | 215 |
| 49 | 3300025960 | Ga0207651_10473365 | Ga0207651_104733652 | 215 |
| 50 | 3300025981 | Ga0207640_10036471 | Ga0207640_100364713 | 215 |
| 51 | 3300026023 | Ga0207677_10242799 | Ga0207677_102427993 | 215 |
| 52 | 3300026067 | Ga0207678_10008325 | Ga0207678_100083252 | 215 |
| 53 | 3300026078 | Ga0207702_10010548 | Ga0207702_100105487 | 215 |
| 54 | 3300026088 | Ga0207641_10000099 | Ga0207641_1000009953 | 215 |
| 55 | 3300026095 | Ga0207676_10001614 | Ga0207676_1000161415 | 215 |
| 56 | 3300026142 | Ga0207698_10716629 | Ga0207698_107166291 | 215 |
| 57 | 3300035207 | Ga0373942_0045377 | Ga0373942_0045377_146_793 | 215 |
| 58 | 3300037312 | Ga0395899_0251778 | Ga0395899_0251778_47_694 | 215 |
| 59 | 3300037418 | Ga0395900_0061479 | Ga0395900_0061479_817_1464 | 215 |
| 60 | 3300037418 | Ga0395900_0819884 | Ga0395900_0819884_91_738 | 215 |
| 61 | 3300037466 | Ga0395898_0089472 | Ga0395898_0089472_608_1255 | 215 |
| 62 | 3300037471 | Ga0395905_0074783 | Ga0395905_0074783_1583_2230 | 215 |
| 63 | 3300038443 | Ga0395901_0116896 | Ga0395901_0116896_621_1268 | 215 |
| 64 | 3300039437 | Ga0436365_1559806 | Ga0436365_1559806_7233_7880 | 215 |
| 65 | 3300044658 | Ga0466972_0107957 | Ga0466972_0107957_282_929 | 215 |
| 66 | 3300044693 | Ga0466961_0028842 | Ga0466961_0028842_2450_3100 | 215 |
| 67 | 3300044694 | Ga0466963_0156511 | Ga0466963_0156511_529_1176 | 215 |
| 68 | 3300045049 | Ga0466959_0178475 | Ga0466959_0178475_715_1365 | 215 |
| 69 | 3300045836 | Ga0466958_0308202 | Ga0466958_0308202_357_1004 | 215 |
| 70 | 3300045976 | Ga0466967_0424366 | Ga0466967_0424366_173_844 | 215 |
| 71 | 3300045976 | Ga0466967_0815915 | Ga0466967_0815915_216_863 | 215 |
| 72 | 3300046525 | Ga0495663_0022847 | Ga0495663_0022847_949_1596 | 215 |
| 73 | 3300046528 | Ga0495642_0127725 | Ga0495642_0127725_59_706 | 215 |
| 74 | 3300048903 | Ga0496100_0636147 | Ga0496100_0636147_158_805 | 215 |
| 75 | 3300048904 | Ga0496101_0010489 | Ga0496101_0010489_2809_3456 | 215 |
| 76 | 3300048909 | Ga0496106_0004503 | Ga0496106_0004503_5852_6499 | 215 |
| 77 | 3300048910 | Ga0496107_0012337 | Ga0496107_0012337_2763_3410 | 215 |
| 78 | 3300048911 | Ga0496108_0249032 | Ga0496108_0249032_744_1391 | 215 |
| 79 | 3300048912 | Ga0496109_0010877 | Ga0496109_0010877_706_1353 | 215 |
| 80 | 3300048913 | Ga0496110_0033261 | Ga0496110_0033261_460_1107 | 215 |
| 81 | 3300048914 | Ga0496111_0077802 | Ga0496111_0077802_1004_1651 | 215 |
| 82 | 3300048915 | Ga0496112_0002145 | Ga0496112_0002145_2686_3333 | 215 |
| 83 | 3300048916 | Ga0496113_0007571 | Ga0496113_0007571_4656_5303 | 215 |
| 84 | 3300005327 | Ga0070658_10115904 | Ga0070658_101159042 | 216 |
| 85 | 3300005331 | Ga0070670_100025648 | Ga0070670_1000256482 | 216 |
| 86 | 3300005336 | Ga0070680_100053771 | Ga0070680_1000537712 | 216 |
| 87 | 3300005354 | Ga0070675_100833740 | Ga0070675_1008337401 | 216 |
| 88 | 3300005364 | Ga0070673_100003803 | Ga0070673_1000038034 | 216 |
| 89 | 3300005366 | Ga0070659_100048117 | Ga0070659_1000481171 | 216 |
| 90 | 3300005435 | Ga0070714_100252959 | Ga0070714_1002529592 | 216 |
| 91 | 3300005436 | Ga0070713_100065299 | Ga0070713_1000652994 | 216 |
| 92 | 3300005455 | Ga0070663_100160773 | Ga0070663_1001607732 | 216 |
| 93 | 3300005539 | Ga0068853_100047084 | Ga0068853_1000470845 | 216 |
| 94 | 3300005548 | Ga0070665_100143210 | Ga0070665_1001432104 | 216 |
| 95 | 3300005577 | Ga0068857_100004444 | Ga0068857_10000444414 | 216 |
| 96 | 3300005577 | Ga0068857_100025761 | Ga0068857_1000257617 | 216 |
| 97 | 3300005614 | Ga0068856_100332994 | Ga0068856_1003329941 | 216 |
| 98 | 3300005614 | Ga0068856_100406776 | Ga0068856_1004067762 | 216 |
| 99 | 3300005616 | Ga0068852_100039093 | Ga0068852_1000390936 | 216 |
| 100 | 3300005841 | Ga0068863_100058002 | Ga0068863_1000580025 | 216 |
| 101 | 3300006028 | Ga0070717_10373378 | Ga0070717_103733781 | 216 |
| 102 | 3300006195 | Ga0075366_10109183 | Ga0075366_101091833 | 216 |
| 103 | 3300009174 | Ga0105241_10128397 | Ga0105241_101283973 | 216 |
| 104 | 3300009545 | Ga0105237_10063554 | Ga0105237_100635542 | 216 |
| 105 | 3300009551 | Ga0105238_10027981 | Ga0105238_100279818 | 216 |
| 106 | 3300013100 | Ga0157373_10184559 | Ga0157373_101845592 | 216 |
| 107 | 3300013104 | Ga0157370_10009635 | Ga0157370_100096352 | 216 |
| 108 | 3300013104 | Ga0157370_10249262 | Ga0157370_102492622 | 216 |
| 109 | 3300013105 | Ga0157369_10112602 | Ga0157369_101126025 | 216 |
| 110 | 3300013105 | Ga0157369_10171851 | Ga0157369_101718514 | 216 |
| 111 | 3300013105 | Ga0157369_10447442 | Ga0157369_104474421 | 216 |
| 112 | 3300013306 | Ga0163162_10075645 | Ga0163162_100756451 | 216 |
| 113 | 3300013307 | Ga0157372_10035026 | Ga0157372_100350262 | 216 |
| 114 | 3300013307 | Ga0157372_11429336 | Ga0157372_114293361 | 216 |
| 115 | 3300025315 | Ga0207697_10018627 | Ga0207697_100186274 | 216 |
| 116 | 3300025901 | Ga0207688_10023030 | Ga0207688_100230302 | 216 |
| 117 | 3300025904 | Ga0207647_10011528 | Ga0207647_100115284 | 216 |
| 118 | 3300025909 | Ga0207705_10087291 | Ga0207705_100872912 | 216 |
| 119 | 3300025909 | Ga0207705_10162816 | Ga0207705_101628162 | 216 |
| 120 | 3300025919 | Ga0207657_10111560 | Ga0207657_101115603 | 216 |
| 121 | 3300025926 | Ga0207659_10054840 | Ga0207659_100548402 | 216 |
| 122 | 3300025928 | Ga0207700_10112113 | Ga0207700_101121132 | 216 |
| 123 | 3300025929 | Ga0207664_10219202 | Ga0207664_102192022 | 216 |
| 124 | 3300025932 | Ga0207690_10063454 | Ga0207690_100634541 | 216 |
| 125 | 3300025940 | Ga0207691_10040886 | Ga0207691_100408863 | 216 |
| 126 | 3300025949 | Ga0207667_10812306 | Ga0207667_108123062 | 216 |
| 127 | 3300026067 | Ga0207678_10031826 | Ga0207678_100318262 | 216 |
| 128 | 3300026088 | Ga0207641_10141026 | Ga0207641_101410261 | 216 |
| 129 | 3300026095 | Ga0207676_10147037 | Ga0207676_101470373 | 216 |
| 130 | 3300026116 | Ga0207674_10000319 | Ga0207674_1000031942 | 216 |
| 131 | 3300026116 | Ga0207674_10003055 | Ga0207674_100030558 | 216 |
| 132 | 3300026121 | Ga0207683_10236834 | Ga0207683_102368342 | 216 |
| 133 | 3300026142 | Ga0207698_10210443 | Ga0207698_102104433 | 216 |
| 134 | 3300028379 | Ga0268266_10121013 | Ga0268266_101210132 | 216 |
| 135 | 3300028380 | Ga0268265_11329931 | Ga0268265_113299311 | 216 |
| 136 | 3300031548 | Ga0307408_100276379 | Ga0307408_1002763793 | 216 |
| 137 | 3300031911 | Ga0307412_10031393 | Ga0307412_100313935 | 216 |
| 138 | 3300032002 | Ga0307416_100059244 | Ga0307416_1000592445 | 216 |
| 139 | 3300032126 | Ga0307415_100049579 | Ga0307415_1000495791 | 216 |
| 140 | 3300037312 | Ga0395899_0115248 | Ga0395899_0115248_434_1084 | 216 |
| 141 | 3300037312 | Ga0395899_0382171 | Ga0395899_0382171_110_760 | 216 |
| 142 | 3300037418 | Ga0395900_0026291 | Ga0395900_0026291_4777_5427 | 216 |
| 143 | 3300037418 | Ga0395900_0224567 | Ga0395900_0224567_30_680 | 216 |
| 144 | 3300037418 | Ga0395900_0259656 | Ga0395900_0259656_939_1589 | 216 |
| 145 | 3300037418 | Ga0395900_0281587 | Ga0395900_0281587_237_911 | 216 |
| 146 | 3300037418 | Ga0395900_0411067 | Ga0395900_0411067_461_1111 | 216 |
| 147 | 3300037418 | Ga0395900_0420725 | Ga0395900_0420725_185_835 | 216 |
| 148 | 3300037418 | Ga0395900_0605727 | Ga0395900_0605727_239_889 | 216 |
| 149 | 3300037466 | Ga0395898_0368521 | Ga0395898_0368521_462_1112 | 216 |
| 150 | 3300037466 | Ga0395898_0534985 | Ga0395898_0534985_83_733 | 216 |
| 151 | 3300037466 | Ga0395898_0592685 | Ga0395898_0592685_144_794 | 216 |
| 152 | 3300037471 | Ga0395905_0035551 | Ga0395905_0035551_883_1533 | 216 |
| 153 | 3300037471 | Ga0395905_0060038 | Ga0395905_0060038_354_1004 | 216 |
| 154 | 3300037471 | Ga0395905_0243162 | Ga0395905_0243162_701_1351 | 216 |
| 155 | 3300037471 | Ga0395905_0352649 | Ga0395905_0352649_163_813 | 216 |
| 156 | 3300037471 | Ga0395905_0568174 | Ga0395905_0568174_124_774 | 216 |
| 157 | 3300038443 | Ga0395901_0055721 | Ga0395901_0055721_2552_3202 | 216 |
| 158 | 3300038443 | Ga0395901_0066999 | Ga0395901_0066999_2844_3494 | 216 |
| 159 | 3300038443 | Ga0395901_0099192 | Ga0395901_0099192_2323_2973 | 216 |
| 160 | 3300038443 | Ga0395901_0164293 | Ga0395901_0164293_182_832 | 216 |
| 161 | 3300038443 | Ga0395901_0271328 | Ga0395901_0271328_786_1436 | 216 |
| 162 | 3300038443 | Ga0395901_0550199 | Ga0395901_0550199_166_816 | 216 |
| 163 | 3300038443 | Ga0395901_0863117 | Ga0395901_0863117_210_860 | 216 |
| 164 | 3300042005 | Ga0439448_0003800 | Ga0439448_0003800_1898_2548 | 216 |
| 165 | 3300042157 | Ga0439458_0000300 | Ga0439458_0000300_2029_2679 | 216 |
| 166 | 3300044693 | Ga0466961_0050811 | Ga0466961_0050811_1580_2230 | 216 |
| 167 | 3300044693 | Ga0466961_0108923 | Ga0466961_0108923_109_759 | 216 |
| 168 | 3300044694 | Ga0466963_0048284 | Ga0466963_0048284_1042_1692 | 216 |
| 169 | 3300044765 | Ga0466970_0002082 | Ga0466970_0002082_6185_6835 | 216 |
| 170 | 3300044765 | Ga0466970_0120562 | Ga0466970_0120562_669_1319 | 216 |
| 171 | 3300044842 | Ga0466957_0040464 | Ga0466957_0040464_652_1302 | 216 |
| 172 | 3300044842 | Ga0466957_0131074 | Ga0466957_0131074_595_1245 | 216 |
| 173 | 3300045049 | Ga0466959_0038409 | Ga0466959_0038409_2040_2690 | 216 |
| 174 | 3300045976 | Ga0466967_0073664 | Ga0466967_0073664_1859_2509 | 216 |
| 175 | 3300045976 | Ga0466967_0113371 | Ga0466967_0113371_1294_1944 | 216 |
| 176 | 3300045976 | Ga0466967_0313721 | Ga0466967_0313721_377_1027 | 216 |
| 177 | 3300053087 | Ga0500643_000466 | Ga0500643_000466_11701_12360 | 216 |
| 178 | 3300053087 | Ga0500643_001269 | Ga0500643_001269_14167_14826 | 216 |
| 179 | 3300005563 | Ga0068855_100880462 | Ga0068855_1008804622 | 217 |
| 180 | 3300005616 | Ga0068852_100151495 | Ga0068852_1001514951 | 217 |
| 181 | 3300025949 | Ga0207667_10352650 | Ga0207667_103526502 | 217 |
| 182 | 3300026142 | Ga0207698_10161118 | Ga0207698_101611183 | 217 |
| 183 | 3300005327 | Ga0070658_10502303 | Ga0070658_105023032 | 219 |
| 184 | 3300005331 | Ga0070670_100011899 | Ga0070670_1000118995 | 219 |
| 185 | 3300005335 | Ga0070666_10054920 | Ga0070666_100549202 | 219 |
| 186 | 3300005347 | Ga0070668_100420196 | Ga0070668_1004201962 | 219 |
| 187 | 3300005354 | Ga0070675_100151839 | Ga0070675_1001518392 | 219 |
| 188 | 3300005367 | Ga0070667_100018960 | Ga0070667_1000189604 | 219 |
| 189 | 3300005457 | Ga0070662_100010272 | Ga0070662_1000102726 | 219 |
| 190 | 3300005543 | Ga0070672_100008045 | Ga0070672_1000080457 | 219 |
| 191 | 3300005564 | Ga0070664_100008107 | Ga0070664_1000081076 | 219 |
| 192 | 3300005842 | Ga0068858_100008945 | Ga0068858_1000089458 | 219 |
| 193 | 3300006237 | Ga0097621_100021424 | Ga0097621_1000214245 | 219 |
| 194 | 3300013308 | Ga0157375_10111021 | Ga0157375_101110215 | 219 |
| 195 | 3300025925 | Ga0207650_10003451 | Ga0207650_100034515 | 219 |
| 196 | 3300025926 | Ga0207659_10112865 | Ga0207659_101128653 | 219 |
| 197 | 3300025931 | Ga0207644_10006505 | Ga0207644_100065054 | 219 |
| 198 | 3300025933 | Ga0207706_10004012 | Ga0207706_100040124 | 219 |
| 199 | 3300025940 | Ga0207691_10008730 | Ga0207691_100087307 | 219 |
| 200 | 3300025941 | Ga0207711_10020383 | Ga0207711_100203835 | 219 |
| 201 | 3300025945 | Ga0207679_10042339 | Ga0207679_100423394 | 219 |
| 202 | 3300025972 | Ga0207668_10389648 | Ga0207668_103896482 | 219 |
| 203 | 3300025986 | Ga0207658_10006472 | Ga0207658_100064729 | 219 |
| 204 | 3300026035 | Ga0207703_10105168 | Ga0207703_101051681 | 219 |
| 205 | 3300026088 | Ga0207641_10009618 | Ga0207641_1000961810 | 219 |
| 206 | 3300005344 | Ga0070661_100221814 | Ga0070661_1002218142 | 220 |
| 207 | 3300005366 | Ga0070659_100003142 | Ga0070659_10000314214 | 220 |
| 208 | 3300005458 | Ga0070681_10040890 | Ga0070681_100408902 | 220 |
| 209 | 3300005547 | Ga0070693_100413701 | Ga0070693_1004137011 | 220 |
| 210 | 3300005563 | Ga0068855_100133138 | Ga0068855_1001331385 | 220 |
| 211 | 3300005564 | Ga0070664_100044336 | Ga0070664_1000443365 | 220 |
| 212 | 3300005577 | Ga0068857_100085604 | Ga0068857_1000856042 | 220 |
| 213 | 3300005578 | Ga0068854_100027819 | Ga0068854_1000278191 | 220 |
| 214 | 3300005614 | Ga0068856_100001655 | Ga0068856_1000016559 | 220 |
| 215 | 3300006177 | Ga0075362_10145898 | Ga0075362_101458982 | 220 |
| 216 | 3300011119 | Ga0105246_10054421 | Ga0105246_100544212 | 220 |
| 217 | 3300013100 | Ga0157373_10035293 | Ga0157373_100352933 | 220 |
| 218 | 3300014325 | Ga0163163_10067172 | Ga0163163_100671725 | 220 |
| 219 | 3300025912 | Ga0207707_10426548 | Ga0207707_104265482 | 220 |
| 220 | 3300025920 | Ga0207649_10040567 | Ga0207649_100405674 | 220 |
| 221 | 3300025932 | Ga0207690_10016249 | Ga0207690_100162496 | 220 |
| 222 | 3300025949 | Ga0207667_10082304 | Ga0207667_100823042 | 220 |
| 223 | 3300025981 | Ga0207640_10022042 | Ga0207640_100220421 | 220 |
| 224 | 3300026078 | Ga0207702_10024140 | Ga0207702_100241402 | 220 |
| 225 | 3300031903 | Ga0307407_10057485 | Ga0307407_100574852 | 220 |
| 226 | 3300031995 | Ga0307409_100040394 | Ga0307409_1000403944 | 220 |
| 227 | 3300037418 | Ga0395900_0088250 | Ga0395900_0088250_2412_3074 | 220 |
| 228 | 3300037466 | Ga0395898_0674886 | Ga0395898_0674886_71_733 | 220 |
| 229 | 3300037471 | Ga0395905_0000956 | Ga0395905_0000956_23725_24387 | 220 |
| 230 | 3300037471 | Ga0395905_0096503 | Ga0395905_0096503_1188_1850 | 220 |
| 231 | 3300038443 | Ga0395901_0061927 | Ga0395901_0061927_2515_3177 | 220 |
| 232 | 3300044842 | Ga0466957_0002575 | Ga0466957_0002575_928_1590 | 220 |
| 233 | 3300045836 | Ga0466958_0001929 | Ga0466958_0001929_7136_7798 | 220 |
| 234 | 3300045976 | Ga0466967_0024114 | Ga0466967_0024114_1636_2298 | 220 |
| 235 | 3300048905 | Ga0496102_0284918 | Ga0496102_0284918_691_1377 | 220 |
| 236 | 3300048906 | Ga0496103_0106438 | Ga0496103_0106438_27_713 | 220 |
| 237 | 3300048915 | Ga0496112_0068401 | Ga0496112_0068401_1257_1943 | 220 |
| 238 | 3300048916 | Ga0496113_0141639 | Ga0496113_0141639_637_1323 | 220 |
| 239 | 3300050489 | nmdc:mga03683_166594_c1 | nmdc:mga03683_166594_c1_171_833 | 220 |
| 240 | 3300050493 | nmdc:mga0k408_192838_c1 | nmdc:mga0k408_192838_c1_283_945 | 220 |
| 241 | 3300053087 | Ga0500643_001448 | Ga0500643_001448_9303_10001 | 223 |
| 242 | 3300045976 | Ga0466967_0494689 | Ga0466967_0494689_453_1136 | 225 |
| 243 | 3300032004 | Ga0307414_10000511 | Ga0307414_100005119 | 227 |
| 244 | 3300035172 | Ga0373955_0074931 | Ga0373955_0074931_778_1461 | 227 |
| 245 | 3300035692 | Ga0373935_0591400 | Ga0373935_0591400_113_796 | 227 |
| 246 | 3300046537 | Ga0495598_0000495 | Ga0495598_0000495_3827_4510 | 227 |
| 247 | 3300046539 | Ga0495621_0000055 | Ga0495621_0000055_2621_3304 | 227 |
| 248 | 3300046684 | Ga0495669_0016422 | Ga0495669_0016422_2285_2968 | 227 |
| 249 | 3300046691 | Ga0495670_0000771 | Ga0495670_0000771_6343_7026 | 227 |
| 250 | 3300046692 | Ga0495671_0037184 | Ga0495671_0037184_1404_2207 | 227 |
| 251 | 3300053087 | Ga0500643_005734 | Ga0500643_005734_3087_3872 | 227 |
| 252 | 3300053118 | Ga0500594_0006041 | Ga0500594_0006041_12_815 | 227 |
| 253 | 3300005436 | Ga0070713_100142038 | Ga0070713_1001420382 | 228 |
| 254 | 3300006028 | Ga0070717_10026970 | Ga0070717_100269703 | 228 |
| 255 | 3300025928 | Ga0207700_10119948 | Ga0207700_101199482 | 228 |
| 256 | 3300025929 | Ga0207664_10039224 | Ga0207664_100392242 | 228 |
| 257 | 3300006195 | Ga0075366_10028321 | Ga0075366_100283213 | 229 |
| 258 | 3300025298 | Ga0209050_1043189 | Ga0209050_10431892 | 229 |
| 259 | 3300046460 | Ga0495638_0038649 | Ga0495638_0038649_875_1621 | 229 |
| 260 | 3300046542 | Ga0495597_0131601 | Ga0495597_0131601_279_1025 | 229 |
| 261 | 3300046660 | Ga0495625_0004013 | Ga0495625_0004013_11466_12212 | 229 |
| 262 | 3300053104 | Ga0500556_0000074 | Ga0500556_0000074_34624_35370 | 229 |
| 263 | 3300053122 | Ga0500608_049285 | Ga0500608_049285_610_1356 | 229 |
| 264 | 3300053130 | Ga0500642_0000002 | Ga0500642_0000002_562185_562931 | 229 |
| 265 | 3300053730 | Ga0500645_000439 | Ga0500645_000439_25374_26120 | 229 |
| 266 | 3300001979 | JGI24740J21852_10011908 | JGI24740J21852_100119084 | 250 |
| 267 | 3300005337 | Ga0070682_100116971 | Ga0070682_1001169712 | 250 |
| 268 | 3300005341 | Ga0070691_10013408 | Ga0070691_100134082 | 250 |
| 269 | 3300005344 | Ga0070661_100051577 | Ga0070661_1000515772 | 250 |
| 270 | 3300005455 | Ga0070663_100137328 | Ga0070663_1001373283 | 250 |
| 271 | 3300005457 | Ga0070662_100041642 | Ga0070662_1000416423 | 250 |
| 272 | 3300005578 | Ga0068854_100107680 | Ga0068854_1001076803 | 250 |
| 273 | 3300025904 | Ga0207647_10006318 | Ga0207647_100063187 | 250 |
| 274 | 3300025909 | Ga0207705_10030310 | Ga0207705_100303103 | 250 |
| 275 | 3300025914 | Ga0207671_10140718 | Ga0207671_101407182 | 250 |
| 276 | 3300025919 | Ga0207657_10036376 | Ga0207657_100363765 | 250 |
| 277 | 3300025924 | Ga0207694_10055961 | Ga0207694_100559612 | 250 |
| 278 | 3300025932 | Ga0207690_10020614 | Ga0207690_100206144 | 250 |
| 279 | 3300025945 | Ga0207679_10107664 | Ga0207679_101076643 | 250 |
| 280 | 3300025949 | Ga0207667_10029330 | Ga0207667_100293304 | 250 |
| 281 | 3300026041 | Ga0207639_10051355 | Ga0207639_100513551 | 250 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1v9k-assembly2.cif.gz_B | the crystal structure of the catalytic domain of pseudouridine synthase rluc from escherichia coli | 0.9024 | 38 | 243 |
| 1xpi-assembly2.cif.gz_B | crystal structure of the catalytic domain of e. coli pseudouridine synthase rluc | 0.9014 | 37 | 243 |
| 1xpi-assembly1.cif.gz_A | crystal structure of the catalytic domain of e. coli pseudouridine synthase rluc | 0.8799 | 34 | 243 |
| 7aoi-assembly1.cif.gz_XP | trypanosoma brucei mitochondrial ribosome large subunit assembly intermediate | 0.8791 | 38 | 245 |
| 2i82-assembly2.cif.gz_B | crystal structure of pseudouridine synthase rlua: indirect sequence readout through protein-induced rna structure | 0.8679 | 40 | 238 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7MNI8_169_435_3.30.2350.10 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.9146 | 36 | 226 | 3.30.2350.10 |
| af_Q9LT72_184_455_3.30.2350.10 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.9069 | 40 | 237 | 3.30.2350.10 |
| af_Q69K07_177_348_3.30.2350.10 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.9058 | 40 | 189 | 3.30.2350.10 |
| af_Q4QQT0_90_339_3.30.2350.10 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.9054 | 36 | 232 | 3.30.2350.10 |
| af_Q4DM27_158_395_3.30.2350.10 | Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase | 0.8996 | 38 | 245 | 3.30.2350.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A654C4Z5-F1-model_v4 | Putative enzyme (EC 5.4.99.-) | 0.9712 | 50 | 244 |
GO:0000455
GO:0003723 GO:0009982 GO:0140098 |
| AF-A0A257Q9F3-F1-model_v4 | RNA pseudouridine synthase | 0.9474 | 49 | 248 |
GO:0000455
GO:0003723 GO:0009982 GO:0140098 |
| AF-A0A1I4SQW4-F1-model_v4 | RNA pseudouridine synthase | 0.942 | 36 | 248 |
GO:0000455
GO:0003723 GO:0009982 GO:0140098 |
| AF-A0A7W9ZGV6-F1-model_v4 | RluA family pseudouridine synthase | 0.9369 | 36 | 246 |
GO:0000455
GO:0003723 GO:0009982 GO:0140098 |
| AF-A0A239ALE5-F1-model_v4 | tRNA pseudouridine32 synthase / 23S rRNA pseudouridine746 synthase | 0.9356 | 36 | 248 |
GO:0000455
GO:0003723 GO:0009982 GO:0140098 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar