F383818

General Info

Members Datasets Scaffolds Average Seq Length
280 226 560 105

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0708148|Ga0436365_0708148_257_631
Length 124
Sequence VLVAQAKVSPKKEKTLKMKRYGSLIGIRPEVIEEYKRYHADVWPGVLNMIQKCNIRNYSIFLKDDRLFGYFEYHGTDFEADMAKMAADPKTQEWWSIMMPMQQPLETRAEGEWWANMEEVFHMD

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
114 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
115 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
117 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
123 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
167 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
168 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
169 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
170 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
171 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
172 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
173 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
174 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
175 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
176 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
177 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
178 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
179 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
180 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
181 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
182 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
183 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
184 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
185 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
186 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
187 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
188 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
189 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
190 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
191 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
192 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
193 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
194 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
195 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
196 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
197 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
198 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
199 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
200 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
201 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
202 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
203 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
204 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
205 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
206 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
207 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
208 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
209 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
210 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
211 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
212 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
213 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
214 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
215 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
216 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
217 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
218 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
219 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
220 3004167301 Mesorhizobium loti 582 Isolate Unclassified
221 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
222 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
223 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
224 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
225 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
226 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.14
Metatranscriptomes 1.43
Isolates 21.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.07
Nodule 19.64
Rhizoplane 6.07
Rhizosphere 68.57
Stem 0
Stem Tuber 0
Unclassified 17.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0708148 3300039437 Bacteria 1084
2 LJNas_1002920 3300000546 Bacteria 2008
3 Ga0065712_10002539 3300005290 Bacteria 6217
4 Ga0065715_10020114 3300005293 Bacteria 1458
5 Ga0070658_10035333 3300005327 Unclassified 4025
6 Ga0070683_100062989 3300005329 Unclassified 3449
7 Ga0070690_100193341 3300005330 Bacteria 1412
8 Ga0070690_101080712 3300005330 Bacteria 635
9 Ga0068869_102055049 3300005334 Unclassified 513
10 Ga0070666_10966681 3300005335 Bacteria 631
11 Ga0070680_100895267 3300005336 Bacteria 766
12 Ga0068868_100143815 3300005338 Unclassified 1960
13 Ga0070660_100140591 3300005339 Bacteria 1936
14 Ga0070689_100181832 3300005340 Bacteria 1708
15 Ga0070687_100716493 3300005343 Unclassified 700
16 Ga0070661_100045490 3300005344 Bacteria 3209
17 Ga0070692_10062757 3300005345 Bacteria 1961
18 Ga0070671_100019233 3300005355 Bacteria 5556
19 Ga0070673_100855389 3300005364 Bacteria 842
20 Ga0070659_100139051 3300005366 Bacteria 1976
21 Ga0070709_10030197 3300005434 Unclassified 3250
22 Ga0070709_10206792 3300005434 Bacteria 1393
23 Ga0070709_10577761 3300005434 Bacteria 863
24 Ga0070714_100123352 3300005435 Bacteria 2307
25 Ga0070714_100265631 3300005435 Bacteria 1590
26 Ga0070714_100978798 3300005435 Bacteria 823
27 Ga0070713_100019897 3300005436 Bacteria 5138
28 Ga0070713_100344863 3300005436 Bacteria 1381
29 Ga0070711_100363617 3300005439 Bacteria 1166
30 Ga0070711_101688029 3300005439 Unclassified 555
31 Ga0070708_100259724 3300005445 Unclassified 1633
32 Ga0070663_100909334 3300005455 Unclassified 761
33 Ga0070662_100908020 3300005457 Bacteria 752
34 Ga0068867_100819733 3300005459 Unclassified 831
35 Ga0070685_10215774 3300005466 Bacteria 1254
36 Ga0070706_100064524 3300005467 Bacteria 3385
37 Ga0070707_100147477 3300005468 Bacteria 2290
38 Ga0070707_100449151 3300005468 Bacteria 1250
39 Ga0070707_100513939 3300005468 Bacteria 1160
40 Ga0070707_100961176 3300005468 Bacteria 819
41 Ga0070698_100051550 3300005471 Bacteria 4191
42 Ga0070698_100697569 3300005471 Unclassified 957
43 Ga0070699_100161863 3300005518 Unclassified 1981
44 Ga0070679_100098178 3300005530 Bacteria 2916
45 Ga0070697_100003453 3300005536 Bacteria 12149
46 Ga0070697_100029849 3300005536 Unclassified 4376
47 Ga0070672_100426897 3300005543 Bacteria 1139
48 Ga0070693_100047809 3300005547 Bacteria 2435
49 Ga0070665_101570897 3300005548 Bacteria 666
50 Ga0070704_101715020 3300005549 Unclassified 580
51 Ga0068855_100103397 3300005563 Bacteria 3277
52 Ga0068854_100023910 3300005578 Bacteria 4177
53 Ga0068856_101867552 3300005614 Bacteria 612
54 Ga0068856_102376798 3300005614 Unclassified 537
55 Ga0068852_100257621 3300005616 Bacteria 1674
56 Ga0068864_100231890 3300005618 Bacteria 1708
57 Ga0068851_10018427 3300005834 Bacteria 3361
58 Ga0068863_100134047 3300005841 Bacteria 2366
59 Ga0070717_10008414 3300006028 Bacteria 7705
60 Ga0070717_10138159 3300006028 Bacteria 2100
61 Ga0070717_10662925 3300006028 Unclassified 947
62 Ga0070716_100001662 3300006173 Bacteria 10023
63 Ga0070712_101147428 3300006175 Unclassified 675
64 Ga0068871_100658756 3300006358 Bacteria 956
65 Ga0075436_100967781 3300006914 Bacteria 638
66 Ga0075435_101743261 3300007076 Bacteria 547
67 Ga0105240_10074939 3300009093 Bacteria 4175
68 Ga0105240_10331160 3300009093 Bacteria 1733
69 Ga0105240_10936672 3300009093 Bacteria 930
70 Ga0111539_12389011 3300009094 Unclassified 613
71 Ga0105243_10265169 3300009148 Bacteria 1540
72 Ga0105243_10956811 3300009148 Bacteria 856
73 Ga0105243_12247720 3300009148 Bacteria 582
74 Ga0105241_10042245 3300009174 Bacteria 3448
75 Ga0105241_11667414 3300009174 Bacteria 618
76 Ga0105242_10855846 3300009176 Bacteria 905
77 Ga0105248_10011721 3300009177 Bacteria 9667
78 Ga0105248_10531295 3300009177 Unclassified 1326
79 Ga0105237_10014369 3300009545 Bacteria 8283
80 Ga0105237_10177466 3300009545 Bacteria 2131
81 Ga0105238_10014230 3300009551 Bacteria 8046
82 Ga0105238_10713446 3300009551 Bacteria 1015
83 Ga0099796_10013427 3300010159 Bacteria 2339
84 Ga0099796_10545847 3300010159 Unclassified 521
85 Ga0105239_10034637 3300010375 Bacteria 5546
86 Ga0105246_10668536 3300011119 Bacteria 906
87 Ga0157373_10020427 3300013100 Bacteria 4813
88 Ga0157373_10093481 3300013100 Bacteria 2118
89 Ga0157370_10177130 3300013104 Unclassified 1982
90 Ga0157370_10385426 3300013104 Bacteria 1291
91 Ga0157378_10001115 3300013297 Bacteria 24461
92 Ga0157378_10009139 3300013297 Bacteria 8625
93 Ga0157372_10044291 3300013307 Bacteria 4930
94 Ga0157372_10264283 3300013307 Bacteria 1998
95 Ga0163163_10136249 3300014325 Bacteria 2496
96 Ga0182008_10034457 3300014497 Unclassified 2538
97 Ga0182008_10087687 3300014497 Bacteria 1533
98 Ga0157379_10103167 3300014968 Bacteria 2559
99 Ga0182006_1015918 3300015261 Bacteria 3215
100 Ga0182007_10002822 3300015262 Bacteria 8459
101 Ga0213874_10004835 3300021377 Bacteria 3108
102 Ga0213876_10251721 3300021384 Bacteria 939
103 Ga0213876_10253526 3300021384 Unclassified 935
104 Ga0224572_1082795 3300024225 Unclassified 592
105 Ga0207699_10042747 3300025906 Bacteria 2628
106 Ga0207699_10311352 3300025906 Bacteria 1102
107 Ga0207705_10288480 3300025909 Bacteria 1257
108 Ga0207684_10054399 3300025910 Bacteria 3395
109 Ga0207654_11111196 3300025911 Bacteria 576
110 Ga0207707_10689833 3300025912 Unclassified 858
111 Ga0207695_10068695 3300025913 Unclassified 3630
112 Ga0207695_10074026 3300025913 Bacteria 3468
113 Ga0207671_10013417 3300025914 Bacteria 6524
114 Ga0207671_10357961 3300025914 Unclassified 1158
115 Ga0207663_10529596 3300025916 Bacteria 919
116 Ga0207663_11330135 3300025916 Bacteria 579
117 Ga0207660_10351456 3300025917 Unclassified 1181
118 Ga0207657_10002087 3300025919 Bacteria 21614
119 Ga0207649_10193414 3300025920 Bacteria 1432
120 Ga0207652_10046595 3300025921 Bacteria 3700
121 Ga0207646_10162239 3300025922 Bacteria 2017
122 Ga0207646_10529615 3300025922 Bacteria 1060
123 Ga0207694_10038713 3300025924 Unclassified 3667
124 Ga0207694_10593163 3300025924 Bacteria 932
125 Ga0207650_10708253 3300025925 Unclassified 851
126 Ga0207700_10013852 3300025928 Bacteria 5265
127 Ga0207664_10346647 3300025929 Bacteria 1314
128 Ga0207664_10459860 3300025929 Bacteria 1136
129 Ga0207664_10892368 3300025929 Bacteria 798
130 Ga0207644_10231221 3300025931 Bacteria 1469
131 Ga0207690_10186616 3300025932 Unclassified 1565
132 Ga0207706_10047254 3300025933 Unclassified 3809
133 Ga0207686_11098345 3300025934 Bacteria 648
134 Ga0207709_10649915 3300025935 Unclassified 839
135 Ga0207670_10134546 3300025936 Bacteria 1816
136 Ga0207665_10017997 3300025939 Bacteria 4643
137 Ga0207711_10264940 3300025941 Bacteria 1580
138 Ga0207711_10408813 3300025941 Bacteria 1261
139 Ga0207689_10298906 3300025942 Bacteria 1334
140 Ga0207661_10852066 3300025944 Bacteria 839
141 Ga0207679_10080437 3300025945 Unclassified 2488
142 Ga0207667_11128485 3300025949 Unclassified 766
143 Ga0207640_10024907 3300025981 Bacteria 3616
144 Ga0207639_10055471 3300026041 Unclassified 3033
145 Ga0207678_10154585 3300026067 Bacteria 1959
146 Ga0207676_10192848 3300026095 Bacteria 1794
147 Ga0207676_11063250 3300026095 Bacteria 799
148 Ga0207674_10027922 3300026116 Bacteria 5963
149 Ga0207698_11589727 3300026142 Unclassified 669
150 Ga0265762_1126335 3300030760 Bacteria 589
151 Ga0265763_1024937 3300030763 Bacteria 650
152 Ga0265760_10115807 3300031090 Bacteria 857
153 Ga0316578_10385871 3300031728 Bacteria 831
154 Ga0316577_10029561 3300031733 Bacteria 3057
155 Ga0316577_10218838 3300031733 Bacteria 1076
156 Ga0316596_1197749 3300033541 Bacteria 559
157 Ga0316582_0997557 3300036647 Unclassified 572
158 Ga0316584_0001459 3300036712 Bacteria 14174
159 Ga0316584_0183996 3300036712 Bacteria 1546
160 Ga0316584_1066680 3300036712 Bacteria 537
161 Ga0395905_1550781 3300037471 Bacteria 567
162 Ga0316581_0035741 3300037588 Bacteria 1506
163 Ga0436364_0821289 3300037853 Bacteria 913
164 Ga0436365_0660428 3300039437 Bacteria 557
165 Ga0436365_1205744 3300039437 Unclassified 956
166 Ga0436363_0640066 3300039450 Bacteria 7567
167 Ga0436362_0284332 3300039453 Bacteria 1102
168 Ga0451800_1197210 3300041459 Bacteria 687
169 Ga0451577_0000376 3300042876 Bacteria 83261
170 Ga0451577_0389794 3300042876 Bacteria 1264
171 Ga0466972_0000383 3300044658 Bacteria 23678
172 Ga0466966_0469839 3300044684 Bacteria 756
173 Ga0466964_0092079 3300044706 Bacteria 1321
174 Ga0453684_0001137 3300044712 Bacteria 83152
175 Ga0453684_0397438 3300044712 Bacteria 1544
176 Ga0453684_0927067 3300044712 Unclassified 931
177 Ga0453684_1709894 3300044712 Bacteria 642
178 Ga0466959_0656141 3300045049 Bacteria 704
179 Ga0451576_0001195 3300045051 Bacteria 46437
180 Ga0451576_0012627 3300045051 Bacteria 9482
181 Ga0495638_0067595 3300046460 Bacteria 2193
182 Ga0495638_0073811 3300046460 Bacteria 2081
183 Ga0495580_0524416 3300046472 Bacteria 789
184 Ga0495584_0024105 3300046491 Bacteria 3085
185 Ga0495628_0307891 3300046516 Bacteria 1171
186 Ga0495628_0981028 3300046516 Bacteria 582
187 Ga0495645_0263814 3300046543 Bacteria 1139
188 Ga0495625_0000046 3300046660 Bacteria 202299
189 Ga0495613_0677494 3300046689 Unclassified 680
190 Ga0495581_0078694 3300047315 Bacteria 1908
191 Ga0495674_0084579 3300047319 Bacteria 2719
192 Ga0495673_0309251 3300047469 Unclassified 565
193 Ga0495686_0081178 3300047472 Bacteria 1981
194 Ga0495593_0436647 3300047673 Unclassified 655
195 Ga0496100_0172944 3300048903 Bacteria 1557
196 Ga0496101_0219843 3300048904 Bacteria 1474
197 Ga0496102_0050911 3300048905 Unclassified 3772
198 Ga0496103_0254967 3300048906 Bacteria 1129
199 Ga0496104_0038751 3300048907 Bacteria 4461
200 Ga0496104_0406108 3300048907 Bacteria 1274
201 Ga0496105_0551676 3300048908 Bacteria 899
202 Ga0496106_0444744 3300048909 Unclassified 1041
203 Ga0496107_0127593 3300048910 Unclassified 1877
204 Ga0496108_0044586 3300048911 Unclassified 3701
205 Ga0496109_0029724 3300048912 Bacteria 4896
206 Ga0496110_0060192 3300048913 Bacteria 3348
207 Ga0496111_0008988 3300048914 Bacteria 6645
208 Ga0496112_0349289 3300048915 Bacteria 1421
209 Ga0496113_1043969 3300048916 Unclassified 642
210 Ga0496115_0101965 3300048918 Bacteria 2354
211 Ga0501033_0417636 3300049570 Bacteria 934
212 Ga0501036_0390773 3300049572 Bacteria 1161
213 Ga0501044_0356546 3300049823 Bacteria 1381
214 nmdc:mga00v17_312235_c1 3300050491 Bacteria 1021
215 nmdc:mga0yw44_280782_c1 3300050492 Bacteria 1113
216 nmdc:mga0n895_66864_c1 3300050512 Unclassified 3558
217 nmdc:mga0rr50_71494_c1 3300050513 Unclassified 2647
218 nmdc:mga0rr50_803816_c1 3300050513 Bacteria 802
219 Ga0495601_0061141 3300053077 Bacteria 2391
220 Ga0500622_0001235 3300053156 Bacteria 20963
221 2509398303 2509276022 Bacteria 6200534
222 2510316881 2510065059 Bacteria 6847884
223 2643986362 2643221595 Bacteria 6565519
224 2644152594 2643221627 Bacteria 6761570
225 2844016025 2844009547 Bacteria 6728125
226 2869176516 2869169390 Bacteria 6659796
227 2869238634 2869234852 Bacteria 6654993
228 2869246268 2869242130 Bacteria 6609239
229 2869259497 2869256925 Bacteria 6981691
230 2869284066 2869278585 Bacteria 7077053
231 2871437569 2871435913 Bacteria 6880295
232 2871482132 2871481445 Bacteria 6700002
233 2874116018 2874109183 Bacteria 6517025
234 2874123639 2874116593 Bacteria 6674494
235 2874144686 2874139085 Bacteria 7021506
236 2874173959 2874168670 Bacteria 8062617
237 2876391247 2876386047 Bacteria 6698674
238 2876427907 2876420981 Bacteria 6687741
239 2878734900 2878730984 Bacteria 6380721
240 2878743940 2878738818 Bacteria 7136951
241 2888342119 2888337043 Bacteria 6629336
242 2903520185 2903513507 Bacteria 6344008
243 2906403762 2906401398 Bacteria 6693206
244 2906434923 2906427513 Bacteria 6375796
245 2924713058 2924710171 Bacteria 6752351
246 2924723793 2924718760 Bacteria 6331356
247 2924738876 2924733363 Bacteria 7574837
248 2924781857 2924776078 Bacteria 7492003
249 2937866949 2937861824 Bacteria 6660327
250 2937978087 2937972304 Bacteria 7532020
251 2937985388 2937980651 Bacteria 6517427
252 2958040455 2958034702 Bacteria 6989922
253 2958055303 2958041894 Bacteria 13082850
254 2958094427 2958092219 Bacteria 6861151
255 2958108593 2958108152 Bacteria 6681128
256 2958147208 2958144490 Bacteria 6677056
257 2961189090 2961183825 Bacteria 6688536
258 2968021919 2968016561 Bacteria 7022047
259 2968143512 2968138860 Bacteria 6605449
260 2970474509 2970469710 Bacteria 6969209
261 2970516125 2970510686 Bacteria 7006402
262 2970536770 2970532167 Bacteria 6553173
263 2970598678 2970593180 Bacteria 7073582
264 2970625235 2970619444 Bacteria 6986144
265 2977855622 2977851361 Bacteria 6694324
266 2977906382 2977898635 Bacteria 6675551
267 2977914217 2977907340 Bacteria 6577984
268 2979768410 2979764755 Bacteria 6610066
269 2979779480 2979772303 Bacteria 6618277
270 2980186176 2980182181 Bacteria 9454109
271 2989352485 2989349275 Bacteria 6349068
272 2996353918 2996348954 Bacteria 7239054
273 2996391203 2996386984 Bacteria 6978667
274 3004171560 3004167301 Bacteria 8330599
275 3004235747 3004232784 Bacteria 6662140
276 3004252891 3004248173 Bacteria 6563236
277 3004270218 3004268573 Bacteria 7043476
278 3004280586 3004275668 Bacteria 7114440
279 3004296492 3004289098 Bacteria 6135450
280 8004733017 8004727605 Bacteria 6643904
281 Ga0436365_0708148
282 LJNas_1002920
283 Ga0065712_10002539
284 Ga0065715_10020114
285 Ga0070658_10035333
286 Ga0070683_100062989
287 Ga0070690_100193341
288 Ga0070690_101080712
289 Ga0068869_102055049
290 Ga0070666_10966681
291 Ga0070680_100895267
292 Ga0068868_100143815
293 Ga0070660_100140591
294 Ga0070689_100181832
295 Ga0070687_100716493
296 Ga0070661_100045490
297 Ga0070692_10062757
298 Ga0070671_100019233
299 Ga0070673_100855389
300 Ga0070659_100139051
301 Ga0070709_10030197
302 Ga0070709_10206792
303 Ga0070709_10577761
304 Ga0070714_100123352
305 Ga0070714_100265631
306 Ga0070714_100978798
307 Ga0070713_100019897
308 Ga0070713_100344863
309 Ga0070711_100363617
310 Ga0070711_101688029
311 Ga0070708_100259724
312 Ga0070663_100909334
313 Ga0070662_100908020
314 Ga0068867_100819733
315 Ga0070685_10215774
316 Ga0070706_100064524
317 Ga0070707_100147477
318 Ga0070707_100449151
319 Ga0070707_100513939
320 Ga0070707_100961176
321 Ga0070698_100051550
322 Ga0070698_100697569
323 Ga0070699_100161863
324 Ga0070679_100098178
325 Ga0070697_100003453
326 Ga0070697_100029849
327 Ga0070672_100426897
328 Ga0070693_100047809
329 Ga0070665_101570897
330 Ga0070704_101715020
331 Ga0068855_100103397
332 Ga0068854_100023910
333 Ga0068856_101867552
334 Ga0068856_102376798
335 Ga0068852_100257621
336 Ga0068864_100231890
337 Ga0068851_10018427
338 Ga0068863_100134047
339 Ga0070717_10008414
340 Ga0070717_10138159
341 Ga0070717_10662925
342 Ga0070716_100001662
343 Ga0070712_101147428
344 Ga0068871_100658756
345 Ga0075436_100967781
346 Ga0075435_101743261
347 Ga0105240_10074939
348 Ga0105240_10331160
349 Ga0105240_10936672
350 Ga0111539_12389011
351 Ga0105243_10265169
352 Ga0105243_10956811
353 Ga0105243_12247720
354 Ga0105241_10042245
355 Ga0105241_11667414
356 Ga0105242_10855846
357 Ga0105248_10011721
358 Ga0105248_10531295
359 Ga0105237_10014369
360 Ga0105237_10177466
361 Ga0105238_10014230
362 Ga0105238_10713446
363 Ga0099796_10013427
364 Ga0099796_10545847
365 Ga0105239_10034637
366 Ga0105246_10668536
367 Ga0157373_10020427
368 Ga0157373_10093481
369 Ga0157370_10177130
370 Ga0157370_10385426
371 Ga0157378_10001115
372 Ga0157378_10009139
373 Ga0157372_10044291
374 Ga0157372_10264283
375 Ga0163163_10136249
376 Ga0182008_10034457
377 Ga0182008_10087687
378 Ga0157379_10103167
379 Ga0182006_1015918
380 Ga0182007_10002822
381 Ga0213874_10004835
382 Ga0213876_10251721
383 Ga0213876_10253526
384 Ga0224572_1082795
385 Ga0207699_10042747
386 Ga0207699_10311352
387 Ga0207705_10288480
388 Ga0207684_10054399
389 Ga0207654_11111196
390 Ga0207707_10689833
391 Ga0207695_10068695
392 Ga0207695_10074026
393 Ga0207671_10013417
394 Ga0207671_10357961
395 Ga0207663_10529596
396 Ga0207663_11330135
397 Ga0207660_10351456
398 Ga0207657_10002087
399 Ga0207649_10193414
400 Ga0207652_10046595
401 Ga0207646_10162239
402 Ga0207646_10529615
403 Ga0207694_10038713
404 Ga0207694_10593163
405 Ga0207650_10708253
406 Ga0207700_10013852
407 Ga0207664_10346647
408 Ga0207664_10459860
409 Ga0207664_10892368
410 Ga0207644_10231221
411 Ga0207690_10186616
412 Ga0207706_10047254
413 Ga0207686_11098345
414 Ga0207709_10649915
415 Ga0207670_10134546
416 Ga0207665_10017997
417 Ga0207711_10264940
418 Ga0207711_10408813
419 Ga0207689_10298906
420 Ga0207661_10852066
421 Ga0207679_10080437
422 Ga0207667_11128485
423 Ga0207640_10024907
424 Ga0207639_10055471
425 Ga0207678_10154585
426 Ga0207676_10192848
427 Ga0207676_11063250
428 Ga0207674_10027922
429 Ga0207698_11589727
430 Ga0265762_1126335
431 Ga0265763_1024937
432 Ga0265760_10115807
433 Ga0316578_10385871
434 Ga0316577_10029561
435 Ga0316577_10218838
436 Ga0316596_1197749
437 Ga0316582_0997557
438 Ga0316584_0001459
439 Ga0316584_0183996
440 Ga0316584_1066680
441 Ga0395905_1550781
442 Ga0316581_0035741
443 Ga0436364_0821289
444 Ga0436365_0660428
445 Ga0436365_1205744
446 Ga0436363_0640066
447 Ga0436362_0284332
448 Ga0451800_1197210
449 Ga0451577_0000376
450 Ga0451577_0389794
451 Ga0466972_0000383
452 Ga0466966_0469839
453 Ga0466964_0092079
454 Ga0453684_0001137
455 Ga0453684_0397438
456 Ga0453684_0927067
457 Ga0453684_1709894
458 Ga0466959_0656141
459 Ga0451576_0001195
460 Ga0451576_0012627
461 Ga0495638_0067595
462 Ga0495638_0073811
463 Ga0495580_0524416
464 Ga0495584_0024105
465 Ga0495628_0307891
466 Ga0495628_0981028
467 Ga0495645_0263814
468 Ga0495625_0000046
469 Ga0495613_0677494
470 Ga0495581_0078694
471 Ga0495674_0084579
472 Ga0495673_0309251
473 Ga0495686_0081178
474 Ga0495593_0436647
475 Ga0496100_0172944
476 Ga0496101_0219843
477 Ga0496102_0050911
478 Ga0496103_0254967
479 Ga0496104_0038751
480 Ga0496104_0406108
481 Ga0496105_0551676
482 Ga0496106_0444744
483 Ga0496107_0127593
484 Ga0496108_0044586
485 Ga0496109_0029724
486 Ga0496110_0060192
487 Ga0496111_0008988
488 Ga0496112_0349289
489 Ga0496113_1043969
490 Ga0496115_0101965
491 Ga0501033_0417636
492 Ga0501036_0390773
493 Ga0501044_0356546
494 nmdc:mga00v17_312235_c1
495 nmdc:mga0yw44_280782_c1
496 nmdc:mga0n895_66864_c1
497 nmdc:mga0rr50_71494_c1
498 nmdc:mga0rr50_803816_c1
499 Ga0495601_0061141
500 Ga0500622_0001235
501 2509398303
502 2510316881
503 2643986362
504 2644152594
505 2844016025
506 2869176516
507 2869238634
508 2869246268
509 2869259497
510 2869284066
511 2871437569
512 2871482132
513 2874116018
514 2874123639
515 2874144686
516 2874173959
517 2876391247
518 2876427907
519 2878734900
520 2878743940
521 2888342119
522 2903520185
523 2906403762
524 2906434923
525 2924713058
526 2924723793
527 2924738876
528 2924781857
529 2937866949
530 2937978087
531 2937985388
532 2958040455
533 2958055303
534 2958094427
535 2958108593
536 2958147208
537 2961189090
538 2968021919
539 2968143512
540 2970474509
541 2970516125
542 2970536770
543 2970598678
544 2970625235
545 2977855622
546 2977906382
547 2977914217
548 2979768410
549 2979779480
550 2980186176
551 2989352485
552 2996353918
553 2996391203
554 3004171560
555 3004235747
556 3004252891
557 3004270218
558 3004280586
559 3004296492
560 8004733017

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05336

rhaM

L-rhamnose mutarotase

20

123

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7byw-assembly1.cif.gz_B crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose-bound form) 0.8674 2 100
7byw-assembly1.cif.gz_B crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose-bound form) 0.8507 2 100
1vqs-assembly1.cif.gz_B crystal structure of a nipsnap family protein with unknown function (atu4242) from agrobacterium tumefaciens str. c58 at 1.50 a resolution 0.7469 3 86
1x8d-assembly2.cif.gz_D crystal structure of e. coli yiil protein containing l-rhamnose 0.7434 1 100
5b0b-assembly2.cif.gz_B polyketide cyclase oac from cannabis sativa, i7f mutant 0.7411 3 86
ID Description Score Start End Superfamily
af_Q556R9_3_105_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8786 2 93 3.30.70.100
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8353 1 89 3.30.70.100
af_Q556R9_3_105_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8058 2 93 3.30.70.100
2qlxB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7604 2 79 3.30.70.100
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7575 1 89 3.30.70.100
ID Description Score Start End GO Terms
AF-Q2NWN0-F1-model_v4 L-rhamnose mutarotase 0.9951 2 79 GO:0016857
AF-K9FAH3-F1-model_v4 DUF718 domain protein 0.9936 2 86 GO:0016857
AF-A0A2C5XXX4-F1-model_v4 L-rhamnose mutarotase 0.9925 2 88 GO:0016857
AF-A0A7K1C1M9-F1-model_v4 L-rhamnose mutarotase (EC 5.1.3.32) 0.9898 1 81 GO:0062192
AF-A0A1F3N300-F1-model_v4 L-rhamnose 1-epimerase 0.9843 1 78 GO:0016857

Map