F383809

General Info

Members Datasets Scaffolds Average Seq Length
280 224 560 133

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1164953|Ga0436364_1164953_2125_2520
Length 131
Sequence MTSKVLAAIVATCWVGFSLCVSASAQTTPADAPDGAALFQRQCSACHTLDPSAPSHQGPLLRGVFGRKPGIVPGYHYSPGFANADFVWDEPHLDAYLTNPQAVIPGAIMPYRQSKAPVRHAIIAYLKGQPR

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
48 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
49 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
64 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
99 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
100 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
101 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
108 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
123 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
124 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
125 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
126 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
127 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
128 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
129 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
130 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
131 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
139 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
140 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
145 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
146 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
153 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
163 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
164 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
183 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
184 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
191 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
192 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
193 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
194 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
195 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
196 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
197 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
198 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
199 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
200 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
201 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
202 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
203 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
204 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
205 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
206 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
207 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
208 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
209 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
210 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
211 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
212 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
213 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
214 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
215 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
216 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
217 2906610324
218 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
219 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
220 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
221 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
222 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
223 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
224 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.7
Metatranscriptomes 0
Isolates 4.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.93
Nodule 6.43
Rhizoplane 6.43
Rhizosphere 59.64
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_1164953 3300037853 Bacteria 4809
2 JGI25153J46596_10001545 3300003215 Bacteria 13670
3 rootL2_10285616 3300003322 Bacteria 2356
4 Ga0070683_100744458 3300005329 Bacteria 939
5 Ga0068869_100252307 3300005334 Bacteria 1409
6 Ga0070689_101707854 3300005340 Bacteria 573
7 Ga0070661_100585911 3300005344 Bacteria 900
8 Ga0070661_100996766 3300005344 Bacteria 695
9 Ga0070674_100640281 3300005356 Bacteria 903
10 Ga0070709_10195384 3300005434 Bacteria 1430
11 Ga0070714_101328905 3300005435 Bacteria 702
12 Ga0070713_100084245 3300005436 Bacteria 2720
13 Ga0070713_100212872 3300005436 Bacteria 1750
14 Ga0070710_10112579 3300005437 Bacteria 1637
15 Ga0070710_11371328 3300005437 Bacteria 528
16 Ga0070711_100024840 3300005439 Bacteria 3914
17 Ga0070663_100061590 3300005455 Bacteria 2702
18 Ga0070663_100235340 3300005455 Bacteria 1444
19 Ga0068867_100634338 3300005459 Bacteria 936
20 Ga0068867_102053832 3300005459 Bacteria 541
21 Ga0070684_100734772 3300005535 Bacteria 921
22 Ga0070697_100773061 3300005536 Bacteria 849
23 Ga0068853_100148940 3300005539 Bacteria 2105
24 Ga0070672_100737361 3300005543 Bacteria 864
25 Ga0070665_100091696 3300005548 Bacteria 3043
26 Ga0070665_100118504 3300005548 Bacteria 2649
27 Ga0070665_100234750 3300005548 Bacteria 1834
28 Ga0070664_100255369 3300005564 Bacteria 1576
29 Ga0068856_100093327 3300005614 Bacteria 2995
30 Ga0068856_100228812 3300005614 Bacteria 1875
31 Ga0068852_100319311 3300005616 Bacteria 1508
32 Ga0068859_100113333 3300005617 Bacteria 2775
33 Ga0068864_100013398 3300005618 Bacteria 6795
34 Ga0068870_10908166 3300005840 Bacteria 623
35 Ga0068863_100082691 3300005841 Bacteria 3043
36 Ga0068863_100571947 3300005841 Bacteria 1117
37 Ga0068858_101191636 3300005842 Bacteria 749
38 Ga0068862_100724297 3300005844 Bacteria 965
39 Ga0081455_10005963 3300005937 Bacteria 13212
40 Ga0081540_1040651 3300005983 Bacteria 2421
41 Ga0075365_10670571 3300006038 Bacteria 733
42 Ga0075368_10033429 3300006042 Bacteria 2000
43 Ga0075363_100000357 3300006048 Bacteria 13719
44 Ga0070716_100337647 3300006173 Bacteria 1062
45 Ga0070716_100489415 3300006173 Bacteria 905
46 Ga0070712_101081551 3300006175 Bacteria 695
47 Ga0075367_10005783 3300006178 Bacteria 6185
48 Ga0075366_10076370 3300006195 Bacteria 1999
49 Ga0097621_100304861 3300006237 Bacteria 1407
50 Ga0075370_10043788 3300006353 Bacteria 2530
51 Ga0075370_10095904 3300006353 Bacteria 1713
52 Ga0068871_101381024 3300006358 Bacteria 664
53 Ga0075430_100262329 3300006846 Bacteria 1431
54 Ga0075434_100222880 3300006871 Bacteria 1905
55 Ga0068865_100816506 3300006881 Bacteria 805
56 Ga0075436_100289310 3300006914 Bacteria 1173
57 Ga0097620_100113342 3300006931 Bacteria 2775
58 Ga0097620_100268898 3300006931 Bacteria 1796
59 Ga0099824_1010512 3300006942 Bacteria 10865
60 Ga0099822_1001984 3300006943 Bacteria 24919
61 Ga0099823_1030255 3300006944 Bacteria 4540
62 Ga0075435_100190793 3300007076 Bacteria 1734
63 Ga0105251_10154643 3300009011 Bacteria 1035
64 Ga0105241_12010418 3300009174 Bacteria 569
65 Ga0105242_10805787 3300009176 Bacteria 930
66 Ga0105237_11309697 3300009545 Bacteria 731
67 Ga0105237_11924901 3300009545 Bacteria 599
68 Ga0105239_10446186 3300010375 Bacteria 1467
69 Ga0157321_1038816 3300012487 Bacteria 516
70 Ga0163162_10041793 3300013306 Bacteria 4587
71 Ga0163162_10920500 3300013306 Bacteria 987
72 Ga0157375_11098192 3300013308 Bacteria 931
73 Ga0163163_10106199 3300014325 Bacteria 2834
74 Ga0182008_10382289 3300014497 Bacteria 753
75 Ga0157376_11421872 3300014969 Bacteria 725
76 Ga0163161_10195723 3300017792 Bacteria 1556
77 Ga0163161_10780587 3300017792 Bacteria 801
78 Ga0213873_10134856 3300021358 Bacteria 734
79 Ga0213874_10069294 3300021377 Bacteria 1121
80 Ga0213876_10319492 3300021384 Unclassified 825
81 Ga0213876_10496693 3300021384 Bacteria 649
82 Ga0213875_10057746 3300021388 Bacteria 1817
83 Ga0213875_10190496 3300021388 Bacteria 964
84 Ga0209233_1016731 3300025261 Bacteria 2014
85 Ga0207692_11017175 3300025898 Bacteria 547
86 Ga0207642_10116132 3300025899 Bacteria 1372
87 Ga0207699_10157926 3300025906 Bacteria 1507
88 Ga0207645_10072943 3300025907 Bacteria 2198
89 Ga0207643_10119334 3300025908 Bacteria 1561
90 Ga0207654_10005980 3300025911 Bacteria 6122
91 Ga0207671_10654055 3300025914 Bacteria 837
92 Ga0207671_11104953 3300025914 Bacteria 623
93 Ga0207693_10932906 3300025915 Bacteria 665
94 Ga0207693_11234892 3300025915 Bacteria 562
95 Ga0207663_10108965 3300025916 Bacteria 1876
96 Ga0207660_10386252 3300025917 Bacteria 1126
97 Ga0207657_10275797 3300025919 Bacteria 1336
98 Ga0207649_10121628 3300025920 Bacteria 1761
99 Ga0207649_10633215 3300025920 Bacteria 825
100 Ga0207687_10112464 3300025927 Bacteria 2024
101 Ga0207700_10090508 3300025928 Bacteria 2415
102 Ga0207664_11074358 3300025929 Bacteria 720
103 Ga0207704_10035617 3300025938 Bacteria 2854
104 Ga0207665_10257856 3300025939 Bacteria 1291
105 Ga0207689_10047904 3300025942 Bacteria 3526
106 Ga0207679_10143093 3300025945 Bacteria 1935
107 Ga0207667_10411074 3300025949 Bacteria 1377
108 Ga0207658_10154850 3300025986 Bacteria 1872
109 Ga0207677_10049586 3300026023 Bacteria 2834
110 Ga0207677_10123908 3300026023 Bacteria 1949
111 Ga0207703_10037270 3300026035 Bacteria 3873
112 Ga0207703_11074927 3300026035 Bacteria 773
113 Ga0207639_10092789 3300026041 Bacteria 2420
114 Ga0207678_10241378 3300026067 Bacteria 1547
115 Ga0207678_10294231 3300026067 Bacteria 1395
116 Ga0207702_10079376 3300026078 Bacteria 2844
117 Ga0207641_11610417 3300026088 Bacteria 651
118 Ga0207648_10090372 3300026089 Bacteria 2675
119 Ga0207674_10091747 3300026116 Bacteria 3027
120 Ga0207683_10082409 3300026121 Bacteria 2858
121 Ga0207683_10111729 3300026121 Bacteria 2447
122 Ga0209389_1000221 3300027296 Bacteria 39013
123 Ga0209589_1000005 3300027357 Bacteria 530958
124 Ga0209489_100005 3300027361 Bacteria 530958
125 Ga0209700_100006 3300027363 Bacteria 530958
126 Ga0268266_10012580 3300028379 Bacteria 7312
127 Ga0268266_10067193 3300028379 Bacteria 3102
128 Ga0268265_11136480 3300028380 Bacteria 776
129 Ga0307511_10058389 3300030521 Bacteria 2982
130 Ga0307513_10520449 3300031456 Bacteria 905
131 Ga0307509_10064485 3300031507 Bacteria 3852
132 Ga0307508_10284279 3300031616 Bacteria 1247
133 Ga0307516_10031276 3300031730 Bacteria 5365
134 Ga0307516_10177574 3300031730 Bacteria 1865
135 Ga0307413_10046074 3300031824 Bacteria 2590
136 Ga0307409_100218236 3300031995 Bacteria 1720
137 Ga0307411_10247213 3300032005 Bacteria 1400
138 Ga0307507_10027162 3300033179 Bacteria 6144
139 Ga0373935_0326736 3300035692 Bacteria 1089
140 Ga0373927_0033776 3300035695 Bacteria 3329
141 Ga0373927_0326240 3300035695 Bacteria 1011
142 Ga0373927_0586318 3300035695 Bacteria 737
143 Ga0373947_0016407 3300035725 Bacteria 4257
144 Ga0373947_0279917 3300035725 Bacteria 1109
145 Ga0373925_0014564 3300037068 Bacteria 5684
146 Ga0395905_1072656 3300037471 Bacteria 709
147 Ga0436364_0998263 3300037853 Bacteria 2337
148 Ga0436364_1138908 3300037853 Bacteria 2587
149 Ga0436365_0032088 3300039437 Bacteria 3789
150 Ga0436365_0270232 3300039437 Bacteria 4581
151 Ga0436360_1149317 3300039438 Bacteria 576
152 Ga0436363_0268943 3300039450 Bacteria 720
153 Ga0436363_0936316 3300039450 Bacteria 725
154 Ga0436363_0978366 3300039450 Bacteria 1478
155 Ga0436363_1114382 3300039450 Bacteria 760
156 Ga0436363_1477066 3300039450 Bacteria 1361
157 Ga0436362_0181376 3300039453 Bacteria 588
158 Ga0436362_0277375 3300039453 Bacteria 3145
159 Ga0436362_0289166 3300039453 Bacteria 536
160 Ga0439465_0039124 3300041413 Bacteria 1530
161 Ga0451789_0583888 3300041443 Bacteria 553
162 Ga0451798_0297312 3300041458 Bacteria 588
163 Ga0451800_0427268 3300041459 Bacteria 648
164 Ga0451807_1534092 3300041486 Bacteria 806
165 Ga0451837_1785447 3300041494 Bacteria 834
166 Ga0451839_0952655 3300041496 Bacteria 1125
167 Ga0451841_1064216 3300041498 Bacteria 719
168 Ga0451843_0135018 3300041509 Bacteria 677
169 Ga0495617_176560 3300046452 Bacteria 673
170 Ga0495617_201352 3300046452 Bacteria 622
171 Ga0495603_0046839 3300046455 Bacteria 2576
172 Ga0495603_0197294 3300046455 Bacteria 1163
173 Ga0495641_0074186 3300046461 Bacteria 1526
174 Ga0495582_0648558 3300046473 Bacteria 611
175 Ga0495605_0185731 3300046474 Bacteria 912
176 Ga0495664_0289055 3300046477 Bacteria 990
177 Ga0495585_0027878 3300046492 Bacteria 3223
178 Ga0495607_0183372 3300046501 Bacteria 1048
179 Ga0495616_0178133 3300046513 Bacteria 946
180 Ga0495620_0068277 3300046515 Bacteria 1460
181 Ga0495666_0258229 3300046526 Bacteria 793
182 Ga0495654_0207824 3300046530 Bacteria 834
183 Ga0495587_0413398 3300046536 Bacteria 749
184 Ga0495598_0181445 3300046537 Bacteria 751
185 Ga0495609_0183060 3300046538 Bacteria 881
186 Ga0495622_0130121 3300046557 Bacteria 1147
187 Ga0495622_0142616 3300046557 Bacteria 1087
188 Ga0495633_0180618 3300046558 Bacteria 971
189 Ga0495656_0005186 3300046615 Bacteria 4492
190 Ga0495668_0515145 3300046616 Bacteria 659
191 Ga0495611_0179154 3300046648 Bacteria 990
192 Ga0495625_0512969 3300046660 Bacteria 731
193 Ga0495625_0908111 3300046660 Bacteria 504
194 Ga0495659_0012114 3300046664 Bacteria 2788
195 Ga0495588_0076514 3300046674 Bacteria 1744
196 Ga0495669_0086756 3300046684 Bacteria 1441
197 Ga0495669_0323000 3300046684 Bacteria 745
198 Ga0495670_0208769 3300046691 Bacteria 1035
199 Ga0495670_0217585 3300046691 Bacteria 1014
200 Ga0495671_0179312 3300046692 Bacteria 1029
201 Ga0495649_0397268 3300046694 Bacteria 692
202 Ga0495581_0140480 3300047315 Bacteria 1409
203 Ga0495581_0696487 3300047315 Bacteria 586
204 Ga0495636_0456844 3300047318 Bacteria 614
205 Ga0495676_0073366 3300047321 Bacteria 2624
206 Ga0495680_0453009 3300047322 Bacteria 878
207 Ga0495683_0440119 3300047323 Bacteria 536
208 Ga0495685_077531 3300047447 Bacteria 1109
209 Ga0495673_0091543 3300047469 Bacteria 1242
210 Ga0495673_0163465 3300047469 Bacteria 853
211 Ga0495686_0237908 3300047472 Bacteria 1028
212 Ga0496100_0133391 3300048903 Bacteria 1752
213 Ga0496102_0127470 3300048905 Bacteria 2380
214 Ga0496103_0242321 3300048906 Bacteria 1160
215 Ga0496105_0653864 3300048908 Bacteria 811
216 Ga0496106_0225604 3300048909 Bacteria 1495
217 Ga0496106_0566306 3300048909 Bacteria 911
218 Ga0496110_1373062 3300048913 Bacteria 616
219 Ga0496111_0510176 3300048914 Bacteria 885
220 Ga0496112_0253371 3300048915 Bacteria 1711
221 Ga0496112_1625452 3300048915 Bacteria 559
222 Ga0496113_0508233 3300048916 Bacteria 967
223 Ga0496114_0061251 3300048917 Bacteria 3147
224 Ga0496114_1163747 3300048917 Bacteria 657
225 Ga0496115_0684871 3300048918 Bacteria 807
226 Ga0496121_0297154 3300048924 Bacteria 1097
227 Ga0496122_0060272 3300048925 Bacteria 2796
228 Ga0496124_0196179 3300048927 Bacteria 1540
229 Ga0496125_0099278 3300048928 Bacteria 2151
230 Ga0496126_0014146 3300048929 Bacteria 8076
231 Ga0496126_0138126 3300048929 Bacteria 2100
232 Ga0496126_0196803 3300048929 Bacteria 1704
233 Ga0496126_0281805 3300048929 Bacteria 1376
234 Ga0496126_0621162 3300048929 Bacteria 849
235 Ga0495678_157663 3300049459 Bacteria 728
236 Ga0495682_0077568 3300049460 Bacteria 1195
237 nmdc:mga03n38_510600_c1 3300050490 Bacteria 676
238 nmdc:mga00v17_119636_c1 3300050491 Bacteria 1676
239 nmdc:mga00v17_344517_c1 3300050491 Bacteria 969
240 nmdc:mga0yw44_1004295_c1 3300050492 Bacteria 565
241 nmdc:mga06z11_70679_c1 3300050494 Bacteria 1846
242 nmdc:mga07m45_15195_c1 3300050496 Bacteria 4110
243 nmdc:mga08x19_619129_c1 3300050514 Bacteria 767
244 nmdc:mga0sz30_339032_c1 3300050516 Bacteria 671
245 Ga0500643_031899 3300053087 Bacteria 1603
246 Ga0500646_0174391 3300053090 Bacteria 725
247 Ga0500583_0111958 3300053092 Bacteria 1345
248 Ga0500583_0121309 3300053092 Bacteria 1293
249 Ga0500583_0361192 3300053092 Bacteria 702
250 Ga0500641_0024104 3300053096 Bacteria 2344
251 Ga0500562_077722 3300053108 Bacteria 897
252 Ga0500595_011179 3300053119 Bacteria 3527
253 Ga0500621_217464 3300053126 Bacteria 664
254 Ga0500642_0219465 3300053130 Bacteria 881
255 Ga0500655_006129 3300053133 Bacteria 2167
256 Ga0500559_0130734 3300053136 Bacteria 1172
257 Ga0500568_0079606 3300053139 Bacteria 1245
258 Ga0500573_0133860 3300053140 Bacteria 1370
259 Ga0500577_0257794 3300053142 Bacteria 758
260 Ga0500579_131887 3300053143 Bacteria 1165
261 Ga0500622_0162020 3300053156 Bacteria 1048
262 Ga0500634_0161955 3300053161 Bacteria 1031
263 Ga0500636_0227999 3300053177 Bacteria 965
264 Ga0500611_191172 3300053727 Bacteria 577
265 Ga0500645_147521 3300053730 Bacteria 648
266 Ga0500656_010993 3300053732 Bacteria 1000
267 Ga0500596_003944 3300053735 Bacteria 2768
268 2524538200 2524023228 Bacteria 10118060
269 2723846016 2721755755 Bacteria 8322773
270 2876814470 2876808645 Bacteria 8824342
271 2879112060 2879110137 Bacteria 8907982
272 2904697565 2904690495 Bacteria 9412302
273 2906612145
274 2908757950 2908756301 Bacteria 8864324
275 2935633301 2935630451 Bacteria 8169952
276 2941509397 2941507105 Bacteria 8166816
277 2941517226 2941515067 Bacteria 8166720
278 2941529919 2941523033 Bacteria 8169134
279 3005597891 3005594810 Bacteria 8716512
280 8019560968 8019555841 Bacteria 9642137
281 Ga0436364_1164953
282 JGI25153J46596_10001545
283 rootL2_10285616
284 Ga0070683_100744458
285 Ga0068869_100252307
286 Ga0070689_101707854
287 Ga0070661_100585911
288 Ga0070661_100996766
289 Ga0070674_100640281
290 Ga0070709_10195384
291 Ga0070714_101328905
292 Ga0070713_100084245
293 Ga0070713_100212872
294 Ga0070710_10112579
295 Ga0070710_11371328
296 Ga0070711_100024840
297 Ga0070663_100061590
298 Ga0070663_100235340
299 Ga0068867_100634338
300 Ga0068867_102053832
301 Ga0070684_100734772
302 Ga0070697_100773061
303 Ga0068853_100148940
304 Ga0070672_100737361
305 Ga0070665_100091696
306 Ga0070665_100118504
307 Ga0070665_100234750
308 Ga0070664_100255369
309 Ga0068856_100093327
310 Ga0068856_100228812
311 Ga0068852_100319311
312 Ga0068859_100113333
313 Ga0068864_100013398
314 Ga0068870_10908166
315 Ga0068863_100082691
316 Ga0068863_100571947
317 Ga0068858_101191636
318 Ga0068862_100724297
319 Ga0081455_10005963
320 Ga0081540_1040651
321 Ga0075365_10670571
322 Ga0075368_10033429
323 Ga0075363_100000357
324 Ga0070716_100337647
325 Ga0070716_100489415
326 Ga0070712_101081551
327 Ga0075367_10005783
328 Ga0075366_10076370
329 Ga0097621_100304861
330 Ga0075370_10043788
331 Ga0075370_10095904
332 Ga0068871_101381024
333 Ga0075430_100262329
334 Ga0075434_100222880
335 Ga0068865_100816506
336 Ga0075436_100289310
337 Ga0097620_100113342
338 Ga0097620_100268898
339 Ga0099824_1010512
340 Ga0099822_1001984
341 Ga0099823_1030255
342 Ga0075435_100190793
343 Ga0105251_10154643
344 Ga0105241_12010418
345 Ga0105242_10805787
346 Ga0105237_11309697
347 Ga0105237_11924901
348 Ga0105239_10446186
349 Ga0157321_1038816
350 Ga0163162_10041793
351 Ga0163162_10920500
352 Ga0157375_11098192
353 Ga0163163_10106199
354 Ga0182008_10382289
355 Ga0157376_11421872
356 Ga0163161_10195723
357 Ga0163161_10780587
358 Ga0213873_10134856
359 Ga0213874_10069294
360 Ga0213876_10319492
361 Ga0213876_10496693
362 Ga0213875_10057746
363 Ga0213875_10190496
364 Ga0209233_1016731
365 Ga0207692_11017175
366 Ga0207642_10116132
367 Ga0207699_10157926
368 Ga0207645_10072943
369 Ga0207643_10119334
370 Ga0207654_10005980
371 Ga0207671_10654055
372 Ga0207671_11104953
373 Ga0207693_10932906
374 Ga0207693_11234892
375 Ga0207663_10108965
376 Ga0207660_10386252
377 Ga0207657_10275797
378 Ga0207649_10121628
379 Ga0207649_10633215
380 Ga0207687_10112464
381 Ga0207700_10090508
382 Ga0207664_11074358
383 Ga0207704_10035617
384 Ga0207665_10257856
385 Ga0207689_10047904
386 Ga0207679_10143093
387 Ga0207667_10411074
388 Ga0207658_10154850
389 Ga0207677_10049586
390 Ga0207677_10123908
391 Ga0207703_10037270
392 Ga0207703_11074927
393 Ga0207639_10092789
394 Ga0207678_10241378
395 Ga0207678_10294231
396 Ga0207702_10079376
397 Ga0207641_11610417
398 Ga0207648_10090372
399 Ga0207674_10091747
400 Ga0207683_10082409
401 Ga0207683_10111729
402 Ga0209389_1000221
403 Ga0209589_1000005
404 Ga0209489_100005
405 Ga0209700_100006
406 Ga0268266_10012580
407 Ga0268266_10067193
408 Ga0268265_11136480
409 Ga0307511_10058389
410 Ga0307513_10520449
411 Ga0307509_10064485
412 Ga0307508_10284279
413 Ga0307516_10031276
414 Ga0307516_10177574
415 Ga0307413_10046074
416 Ga0307409_100218236
417 Ga0307411_10247213
418 Ga0307507_10027162
419 Ga0373935_0326736
420 Ga0373927_0033776
421 Ga0373927_0326240
422 Ga0373927_0586318
423 Ga0373947_0016407
424 Ga0373947_0279917
425 Ga0373925_0014564
426 Ga0395905_1072656
427 Ga0436364_0998263
428 Ga0436364_1138908
429 Ga0436365_0032088
430 Ga0436365_0270232
431 Ga0436360_1149317
432 Ga0436363_0268943
433 Ga0436363_0936316
434 Ga0436363_0978366
435 Ga0436363_1114382
436 Ga0436363_1477066
437 Ga0436362_0181376
438 Ga0436362_0277375
439 Ga0436362_0289166
440 Ga0439465_0039124
441 Ga0451789_0583888
442 Ga0451798_0297312
443 Ga0451800_0427268
444 Ga0451807_1534092
445 Ga0451837_1785447
446 Ga0451839_0952655
447 Ga0451841_1064216
448 Ga0451843_0135018
449 Ga0495617_176560
450 Ga0495617_201352
451 Ga0495603_0046839
452 Ga0495603_0197294
453 Ga0495641_0074186
454 Ga0495582_0648558
455 Ga0495605_0185731
456 Ga0495664_0289055
457 Ga0495585_0027878
458 Ga0495607_0183372
459 Ga0495616_0178133
460 Ga0495620_0068277
461 Ga0495666_0258229
462 Ga0495654_0207824
463 Ga0495587_0413398
464 Ga0495598_0181445
465 Ga0495609_0183060
466 Ga0495622_0130121
467 Ga0495622_0142616
468 Ga0495633_0180618
469 Ga0495656_0005186
470 Ga0495668_0515145
471 Ga0495611_0179154
472 Ga0495625_0512969
473 Ga0495625_0908111
474 Ga0495659_0012114
475 Ga0495588_0076514
476 Ga0495669_0086756
477 Ga0495669_0323000
478 Ga0495670_0208769
479 Ga0495670_0217585
480 Ga0495671_0179312
481 Ga0495649_0397268
482 Ga0495581_0140480
483 Ga0495581_0696487
484 Ga0495636_0456844
485 Ga0495676_0073366
486 Ga0495680_0453009
487 Ga0495683_0440119
488 Ga0495685_077531
489 Ga0495673_0091543
490 Ga0495673_0163465
491 Ga0495686_0237908
492 Ga0496100_0133391
493 Ga0496102_0127470
494 Ga0496103_0242321
495 Ga0496105_0653864
496 Ga0496106_0225604
497 Ga0496106_0566306
498 Ga0496110_1373062
499 Ga0496111_0510176
500 Ga0496112_0253371
501 Ga0496112_1625452
502 Ga0496113_0508233
503 Ga0496114_0061251
504 Ga0496114_1163747
505 Ga0496115_0684871
506 Ga0496121_0297154
507 Ga0496122_0060272
508 Ga0496124_0196179
509 Ga0496125_0099278
510 Ga0496126_0014146
511 Ga0496126_0138126
512 Ga0496126_0196803
513 Ga0496126_0281805
514 Ga0496126_0621162
515 Ga0495678_157663
516 Ga0495682_0077568
517 nmdc:mga03n38_510600_c1
518 nmdc:mga00v17_119636_c1
519 nmdc:mga00v17_344517_c1
520 nmdc:mga0yw44_1004295_c1
521 nmdc:mga06z11_70679_c1
522 nmdc:mga07m45_15195_c1
523 nmdc:mga08x19_619129_c1
524 nmdc:mga0sz30_339032_c1
525 Ga0500643_031899
526 Ga0500646_0174391
527 Ga0500583_0111958
528 Ga0500583_0121309
529 Ga0500583_0361192
530 Ga0500641_0024104
531 Ga0500562_077722
532 Ga0500595_011179
533 Ga0500621_217464
534 Ga0500642_0219465
535 Ga0500655_006129
536 Ga0500559_0130734
537 Ga0500568_0079606
538 Ga0500573_0133860
539 Ga0500577_0257794
540 Ga0500579_131887
541 Ga0500622_0162020
542 Ga0500634_0161955
543 Ga0500636_0227999
544 Ga0500611_191172
545 Ga0500645_147521
546 Ga0500656_010993
547 Ga0500596_003944
548 2524538200
549 2723846016
550 2876814470
551 2879112060
552 2904697565
553 2906612145
554 2908757950
555 2935633301
556 2941509397
557 2941517226
558 2941529919
559 3005597891
560 8019560968

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

32

130

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ged-assembly1.cif.gz_B crystal structure of the leishmania major peroxidase-cytochrome c complex 0.8921 33 128
3jbt-assembly1.cif.gz_B atomic structure of the apaf-1 apoptosome 0.889 33 127
1i6d-assembly1.cif.gz_A solution structure of the functional domain of paracoccus denitrificans cytochrome c552 in the reduced state 0.8872 33 128
5cif-assembly1.cif.gz_B complex of yeast cytochrome c peroxidase (w191f) with iso-1 cytochrome c 0.8868 33 127
7ljx-assembly2.cif.gz_B oxidized rat cytochrome c mutant (k53q) 0.8864 33 127
ID Description Score Start End Superfamily
1i6dA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8872 33 128 1.10.760.10
2jtiB00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8802 33 127 1.10.760.10
1qn2C00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8782 33 126 1.10.760.10
5cieD00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8756 33 127 1.10.760.10
3c2cA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8749 33 128 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A160V4N2-F1-model_v4 deleted 0.9836 62 128
AF-A0A522LTD5-F1-model_v4 C-type cytochrome 0.9826 56 128 GO:0009055
GO:0020037
GO:0046872
AF-A0A2S6R1B3-F1-model_v4 Cytochrome c2 0.9756 55 127 GO:0009055
GO:0020037
AF-A0A7W6DC23-F1-model_v4 Cytochrome c2 0.9756 56 127 GO:0009055
GO:0020037
AF-A0A1H1Q232-F1-model_v4 Glucose/Sorbosone dehydrogenase domain-containing protein 0.9504 55 127 GO:0009055
GO:0020037

Map