F383785

General Info

Members Datasets Scaffolds Average Seq Length
280 141 560 298

Family's Representative Sequence

Representative Sequence 3300035089|Ga0373944_0005093|Ga0373944_0005093_775_1698
Length 307
Sequence MNMPRLMYGPMRALVTGGAGFIGSNLVDALVARGDDVTVVDNFATGRRELVNAAAHLVEHDIREPFVVEADVVFHLAAQADVQTSMQQPGYDAAVNVVGTTNVLAAAHDAQVIFASSGGAGYGECPEPASEQTPFLPLSPYGIAKKCGEEYLAGWNRIHGTSHVSLRFGNVYGPRQDSGLEGGVVAIFLERLARGEEIVIYGDGSQSRDFVYVSDVVAAALAAVGRAGGPYNVGSGVDTSVSRLFAACATVAGSDAQPRHAAARLGDVRRSALDVSLVERELGWRAGVPLADGLAETWVWTKEAQPT

Samples

Sample ID Description Type Environment
1 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
34 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
54 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
55 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
56 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
57 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
58 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
59 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
62 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
63 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
64 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
65 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
66 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
67 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
75 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
80 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
81 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
82 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
83 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
88 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
91 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
92 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
93 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
105 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
106 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
107 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
108 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
139 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.57
Metatranscriptomes 1.43
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 15.36
Rhizosphere 83.57
Stem 0
Stem Tuber 0
Unclassified 3.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373944_0005093 3300035089 Bacteria 3452
2 Ga0070658_10172744 3300005327 Bacteria 1816
3 Ga0070683_100021166 3300005329 Bacteria 5799
4 Ga0070683_100070440 3300005329 Bacteria 3261
5 Ga0070683_100133101 3300005329 Bacteria 2353
6 Ga0070680_100002770 3300005336 Bacteria 13015
7 Ga0070680_100081804 3300005336 Bacteria 2665
8 Ga0070680_100146267 3300005336 Bacteria 1983
9 Ga0070660_100025028 3300005339 Bacteria 4434
10 Ga0070661_100044653 3300005344 Bacteria 3238
11 Ga0070671_100121595 3300005355 Bacteria 2197
12 Ga0070678_100063210 3300005456 Bacteria 2738
13 Ga0070681_10048893 3300005458 Bacteria 4224
14 Ga0070681_10059350 3300005458 Bacteria 3805
15 Ga0070681_10081122 3300005458 Bacteria 3200
16 Ga0070681_10101652 3300005458 Bacteria 2820
17 Ga0070681_10634585 3300005458 Bacteria 983
18 Ga0070679_100030284 3300005530 Bacteria 5343
19 Ga0070679_100074493 3300005530 Bacteria 3385
20 Ga0070679_100312101 3300005530 Bacteria 1522
21 Ga0070684_100019469 3300005535 Bacteria 5614
22 Ga0070684_100082268 3300005535 Bacteria 2850
23 Ga0070684_100096352 3300005535 Bacteria 2637
24 Ga0070684_100162740 3300005535 Bacteria 2025
25 Ga0068853_100520920 3300005539 Bacteria 1124
26 Ga0068855_100018973 3300005563 Bacteria 8269
27 Ga0068855_100265510 3300005563 Bacteria 1911
28 Ga0068857_100060544 3300005577 Bacteria 3363
29 Ga0068854_100550936 3300005578 Bacteria 978
30 Ga0068856_100122621 3300005614 Bacteria 2601
31 Ga0068852_100052062 3300005616 Bacteria 3517
32 Ga0068852_100518996 3300005616 Unclassified 1188
33 Ga0070717_10014964 3300006028 Bacteria 5976
34 Ga0070717_10284221 3300006028 Bacteria 1468
35 Ga0070712_100023627 3300006175 Bacteria 4064
36 Ga0075433_10274880 3300006852 Bacteria 1493
37 Ga0075434_100002695 3300006871 Bacteria 15688
38 Ga0105240_10480129 3300009093 Bacteria 1386
39 Ga0105242_10018709 3300009176 Bacteria 5420
40 Ga0105237_10038849 3300009545 Bacteria 4807
41 Ga0105237_10239905 3300009545 Bacteria 1814
42 Ga0105238_10011515 3300009551 Bacteria 8911
43 Ga0157373_10164679 3300013100 Bacteria 1560
44 Ga0157369_10007748 3300013105 Bacteria 12354
45 Ga0157369_10079346 3300013105 Bacteria 3516
46 Ga0157369_10093681 3300013105 Bacteria 3206
47 Ga0157369_10125839 3300013105 Bacteria 2718
48 Ga0157369_10222122 3300013105 Bacteria 1977
49 Ga0157374_10054460 3300013296 Bacteria 3731
50 Ga0157372_10459191 3300013307 Bacteria 1484
51 Ga0157375_10289472 3300013308 Bacteria 1801
52 Ga0206354_10127242 3300020081 Bacteria 2236
53 Ga0206354_10975443 3300020081 Bacteria 2143
54 Ga0206353_11582338 3300020082 Bacteria 5263
55 Ga0206353_11932920 3300020082 Bacteria 2446
56 Ga0213876_10036169 3300021384 Bacteria 2605
57 Ga0207705_10027092 3300025909 Bacteria 4085
58 Ga0207705_10053457 3300025909 Bacteria 2909
59 Ga0207707_10007672 3300025912 Bacteria 9398
60 Ga0207707_10227492 3300025912 Bacteria 1623
61 Ga0207693_10025210 3300025915 Bacteria 4715
62 Ga0207693_10126513 3300025915 Bacteria 2009
63 Ga0207693_10141473 3300025915 Bacteria 1892
64 Ga0207693_10259354 3300025915 Bacteria 1363
65 Ga0207663_10141500 3300025916 Unclassified 1677
66 Ga0207663_10292998 3300025916 Bacteria 1213
67 Ga0207660_10019350 3300025917 Bacteria 4550
68 Ga0207660_10040894 3300025917 Bacteria 3247
69 Ga0207657_10003306 3300025919 Bacteria 17240
70 Ga0207657_10010110 3300025919 Bacteria 9431
71 Ga0207657_10010286 3300025919 Bacteria 9340
72 Ga0207657_10029063 3300025919 Bacteria 5037
73 Ga0207657_10090688 3300025919 Bacteria 2550
74 Ga0207652_10015364 3300025921 Bacteria 6217
75 Ga0207652_10037189 3300025921 Bacteria 4120
76 Ga0207652_10042203 3300025921 Bacteria 3881
77 Ga0207652_10088178 3300025921 Bacteria 2722
78 Ga0207652_10090762 3300025921 Bacteria 2685
79 Ga0207646_10304086 3300025922 Bacteria 1441
80 Ga0207686_10279335 3300025934 Bacteria 1232
81 Ga0207709_10415747 3300025935 Bacteria 1032
82 Ga0207661_10136562 3300025944 Bacteria 2107
83 Ga0207661_10475361 3300025944 Unclassified 1140
84 Ga0207661_10658095 3300025944 Unclassified 963
85 Ga0207667_10045874 3300025949 Bacteria 4627
86 Ga0207667_10084999 3300025949 Bacteria 3275
87 Ga0207667_10101741 3300025949 Bacteria 2964
88 Ga0207667_10141742 3300025949 Bacteria 2475
89 Ga0207639_10098101 3300026041 Bacteria 2361
90 Ga0207678_10153471 3300026067 Bacteria 1967
91 Ga0207674_10256267 3300026116 Bacteria 1696
92 Ga0207683_10065396 3300026121 Bacteria 3206
93 Ga0207698_10060862 3300026142 Bacteria 2938
94 Ga0265334_10018340 3300028573 Bacteria 2886
95 Ga0265338_10048760 3300028800 Bacteria 3848
96 Ga0265325_10036380 3300031241 Bacteria 2608
97 Ga0265329_10024577 3300031242 Bacteria 1999
98 Ga0265340_10053822 3300031247 Bacteria 1943
99 Ga0265339_10027412 3300031249 Bacteria 3252
100 Ga0265327_10101305 3300031251 Bacteria 1389
101 Ga0265316_10012958 3300031344 Bacteria 7439
102 Ga0265313_10013512 3300031595 Bacteria 4895
103 Ga0265314_10008658 3300031711 Bacteria 8701
104 Ga0265342_10141414 3300031712 Bacteria 1342
105 Ga0373956_0100918 3300035119 Bacteria 1339
106 Ga0373943_0004156 3300035170 Bacteria 6570
107 Ga0373946_0047855 3300035171 Bacteria 1777
108 Ga0373935_0099595 3300035692 Bacteria 1914
109 Ga0373927_0026892 3300035695 Bacteria 3760
110 Ga0373947_0003168 3300035725 Bacteria 9790
111 Ga0373947_0267137 3300035725 Bacteria 1135
112 Ga0373937_0046019 3300036401 Bacteria 3988
113 Ga0373937_0094526 3300036401 Bacteria 2772
114 Ga0373925_0005891 3300037068 Bacteria 9085
115 Ga0373925_0020975 3300037068 Bacteria 4761
116 Ga0395899_0071338 3300037312 Bacteria 2541
117 Ga0395898_0011265 3300037466 Bacteria 9301
118 Ga0395898_0019509 3300037466 Bacteria 6899
119 Ga0395898_0081849 3300037466 Bacteria 3112
120 Ga0395905_0261175 3300037471 Bacteria 1617
121 Ga0395901_0049682 3300038443 Bacteria 4358
122 Ga0395901_0065868 3300038443 Bacteria 3773
123 Ga0395901_0108234 3300038443 Bacteria 2918
124 Ga0395901_0126931 3300038443 Bacteria 2680
125 Ga0436365_1581435 3300039437 Bacteria 3540
126 Ga0451853_0748032 3300041512 Bacteria 1156
127 Ga0466966_0003671 3300044684 Bacteria 10130
128 Ga0466966_0039032 3300044684 Bacteria 3058
129 Ga0466966_0150535 3300044684 Bacteria 1419
130 Ga0466961_0001440 3300044693 Bacteria 14761
131 Ga0466961_0025314 3300044693 Bacteria 3817
132 Ga0466961_0038303 3300044693 Bacteria 3075
133 Ga0466961_0102551 3300044693 Bacteria 1802
134 Ga0466963_0013725 3300044694 Bacteria 4982
135 Ga0466963_0044709 3300044694 Bacteria 2915
136 Ga0466963_0059915 3300044694 Bacteria 2542
137 Ga0466963_0094459 3300044694 Bacteria 2039
138 Ga0466964_0006708 3300044706 Bacteria 4293
139 Ga0466964_0009640 3300044706 Bacteria 3638
140 Ga0466971_0000127 3300044719 Bacteria 27731
141 Ga0466968_0039739 3300044735 Bacteria 1981
142 Ga0466957_0000562 3300044842 Bacteria 18756
143 Ga0466957_0045831 3300044842 Bacteria 2652
144 Ga0466957_0417245 3300044842 Unclassified 920
145 Ga0466959_0032360 3300045049 Bacteria 3871
146 Ga0466959_0049112 3300045049 Bacteria 3100
147 Ga0466959_0061413 3300045049 Bacteria 2732
148 Ga0466958_0000170 3300045836 Bacteria 23148
149 Ga0466958_0065893 3300045836 Bacteria 2210
150 Ga0466958_0066970 3300045836 Bacteria 2193
151 Ga0466958_0082861 3300045836 Bacteria 1976
152 Ga0466958_0189985 3300045836 Bacteria 1305
153 Ga0466967_0000142 3300045976 Bacteria 27844
154 Ga0466967_0007579 3300045976 Bacteria 7846
155 Ga0466967_0030942 3300045976 Bacteria 4499
156 Ga0466967_0036198 3300045976 Bacteria 4211
157 Ga0466967_0038429 3300045976 Bacteria 4105
158 Ga0466967_0042371 3300045976 Bacteria 3933
159 Ga0466967_0058047 3300045976 Bacteria 3419
160 Ga0466967_0074416 3300045976 Bacteria 3050
161 Ga0466967_0292346 3300045976 Bacteria 1566
162 Ga0466967_0310243 3300045976 Bacteria 1519
163 Ga0466967_0319424 3300045976 Unclassified 1497
164 Ga0495603_0096381 3300046455 Bacteria 1728
165 Ga0495603_0107616 3300046455 Bacteria 1627
166 Ga0495629_0001237 3300046459 Bacteria 20090
167 Ga0495629_0082103 3300046459 Bacteria 2249
168 Ga0495629_0156442 3300046459 Bacteria 1584
169 Ga0495629_0164199 3300046459 Bacteria 1542
170 Ga0495641_0001769 3300046461 Bacteria 17918
171 Ga0495641_0009542 3300046461 Bacteria 5754
172 Ga0495641_0016237 3300046461 Bacteria 3930
173 Ga0495651_0053445 3300046462 Bacteria 3109
174 Ga0495605_0013592 3300046474 Bacteria 4480
175 Ga0495639_0000617 3300046475 Bacteria 16535
176 Ga0495662_0000358 3300046476 Bacteria 20040
177 Ga0495662_0079370 3300046476 Unclassified 1595
178 Ga0495662_0158618 3300046476 Bacteria 1114
179 Ga0495664_0023494 3300046477 Bacteria 3579
180 Ga0495664_0123578 3300046477 Bacteria 1565
181 Ga0495608_0005091 3300046511 Bacteria 9389
182 Ga0495608_0048110 3300046511 Bacteria 2834
183 Ga0495618_0059469 3300046514 Bacteria 2422
184 Ga0495618_0369627 3300046514 Unclassified 881
185 Ga0495628_0008864 3300046516 Bacteria 8609
186 Ga0495628_0015134 3300046516 Bacteria 6445
187 Ga0495630_0146764 3300046517 Bacteria 1794
188 Ga0495652_0349597 3300046529 Bacteria 1059
189 Ga0495665_0008705 3300046531 Bacteria 5509
190 Ga0495640_0014948 3300046533 Bacteria 5854
191 Ga0495640_0031481 3300046533 Bacteria 3785
192 Ga0495587_0101294 3300046536 Bacteria 1659
193 Ga0495587_0128296 3300046536 Unclassified 1450
194 Ga0495645_0072948 3300046543 Bacteria 2473
195 Ga0495667_0007990 3300046559 Bacteria 7175
196 Ga0495667_0022633 3300046559 Bacteria 4234
197 Ga0495634_0086577 3300046642 Bacteria 2040
198 Ga0495635_0016858 3300046663 Bacteria 5102
199 Ga0495657_0087614 3300046675 Bacteria 2003
200 Ga0495599_0033884 3300046678 Bacteria 3210
201 Ga0495599_0131862 3300046678 Bacteria 1552
202 Ga0495646_0079717 3300046680 Bacteria 1911
203 Ga0495646_0087227 3300046680 Bacteria 1809
204 Ga0495658_0000433 3300046683 Bacteria 23365
205 Ga0495613_0007051 3300046689 Bacteria 8365
206 Ga0495613_0044852 3300046689 Bacteria 3270
207 Ga0495624_0008962 3300046690 Bacteria 6952
208 Ga0495600_0018104 3300046809 Bacteria 4485
209 Ga0495581_0001333 3300047315 Bacteria 13636
210 Ga0495674_0011600 3300047319 Bacteria 8311
211 Ga0495674_0018694 3300047319 Bacteria 6449
212 Ga0495674_0023882 3300047319 Bacteria 5627
213 Ga0495674_0358156 3300047319 Bacteria 1183
214 Ga0495676_0004926 3300047321 Bacteria 12246
215 Ga0495680_0005388 3300047322 Bacteria 12063
216 Ga0495680_0017566 3300047322 Bacteria 6100
217 Ga0495680_0025949 3300047322 Bacteria 4841
218 Ga0495684_0039140 3300047471 Bacteria 3635
219 Ga0495684_0069007 3300047471 Bacteria 2688
220 Ga0495684_0088679 3300047471 Bacteria 2344
221 Ga0495593_0006364 3300047673 Bacteria 6925
222 Ga0495602_0039762 3300048088 Bacteria 4325
223 Ga0495602_0078919 3300048088 Bacteria 2779
224 Ga0495602_0315623 3300048088 Unclassified 1139
225 Ga0495614_0000988 3300048089 Bacteria 12102
226 Ga0496100_0005876 3300048903 Bacteria 6644
227 Ga0496100_0018779 3300048903 Bacteria 4110
228 Ga0496100_0105117 3300048903 Bacteria 1952
229 Ga0496101_0005435 3300048904 Bacteria 8118
230 Ga0496101_0026683 3300048904 Bacteria 4017
231 Ga0496101_0031406 3300048904 Bacteria 3733
232 Ga0496101_0055290 3300048904 Bacteria 2867
233 Ga0496102_0006220 3300048905 Bacteria 10174
234 Ga0496102_0033208 3300048905 Bacteria 4636
235 Ga0496104_0001466 3300048907 Bacteria 20353
236 Ga0496104_0021511 3300048907 Bacteria 5923
237 Ga0496104_0056257 3300048907 Bacteria 3719
238 Ga0496105_0001100 3300048908 Bacteria 18781
239 Ga0496105_0015080 3300048908 Bacteria 6150
240 Ga0496106_0007326 3300048909 Bacteria 8152
241 Ga0496106_0034569 3300048909 Bacteria 3776
242 Ga0496106_0129874 3300048909 Bacteria 1975
243 Ga0496107_0009178 3300048910 Bacteria 6856
244 Ga0496107_0018302 3300048910 Bacteria 4932
245 Ga0496107_0455288 3300048910 Bacteria 950
246 Ga0496108_0005627 3300048911 Bacteria 10142
247 Ga0496108_0391760 3300048911 Bacteria 1213
248 Ga0496109_0002941 3300048912 Bacteria 14254
249 Ga0496109_0298910 3300048912 Bacteria 1518
250 Ga0496110_0006910 3300048913 Bacteria 9026
251 Ga0496110_0107554 3300048913 Bacteria 2504
252 Ga0496112_0008246 3300048915 Bacteria 9322
253 Ga0496112_0035723 3300048915 Bacteria 4844
254 Ga0496112_0073646 3300048915 Bacteria 3376
255 Ga0496112_0121770 3300048915 Bacteria 2579
256 Ga0496113_0027158 3300048916 Bacteria 4100
257 Ga0496114_0009110 3300048917 Bacteria 7868
258 Ga0496114_0010711 3300048917 Bacteria 7297
259 Ga0496114_0043162 3300048917 Bacteria 3739
260 Ga0496114_0103639 3300048917 Bacteria 2432
261 Ga0496114_0112596 3300048917 Bacteria 2333
262 Ga0496115_0000790 3300048918 Bacteria 23244
263 Ga0496115_0002912 3300048918 Bacteria 12352
264 Ga0496115_0013093 3300048918 Bacteria 6264
265 Ga0496115_0086344 3300048918 Bacteria 2560
266 Ga0496115_0177828 3300048918 Bacteria 1760
267 Ga0496115_0249440 3300048918 Bacteria 1462
268 Ga0496115_0415798 3300048918 Unclassified 1090
269 Ga0501070_0451873 3300049586 Bacteria 1036
270 Ga0501080_0214087 3300049742 Bacteria 1765
271 nmdc:mga0n895_11560_c1 3300050512 Bacteria 7885
272 Ga0495601_0054555 3300053077 Bacteria 2529
273 Ga0495601_0261910 3300053077 Bacteria 1128
274 Ga0495595_0032849 3300053084 Bacteria 2338
275 Ga0495595_0040218 3300053084 Bacteria 2136
276 Ga0495595_0172381 3300053084 Bacteria 1071
277 Ga0495619_0002922 3300053085 Bacteria 11107
278 Ga0495619_0090060 3300053085 Bacteria 2076
279 Ga0466962_0000465 3300061719 Bacteria 17578
280 Ga0466962_0032852 3300061719 Bacteria 2483
281 Ga0373944_0005093
282 Ga0070658_10172744
283 Ga0070683_100021166
284 Ga0070683_100070440
285 Ga0070683_100133101
286 Ga0070680_100002770
287 Ga0070680_100081804
288 Ga0070680_100146267
289 Ga0070660_100025028
290 Ga0070661_100044653
291 Ga0070671_100121595
292 Ga0070678_100063210
293 Ga0070681_10048893
294 Ga0070681_10059350
295 Ga0070681_10081122
296 Ga0070681_10101652
297 Ga0070681_10634585
298 Ga0070679_100030284
299 Ga0070679_100074493
300 Ga0070679_100312101
301 Ga0070684_100019469
302 Ga0070684_100082268
303 Ga0070684_100096352
304 Ga0070684_100162740
305 Ga0068853_100520920
306 Ga0068855_100018973
307 Ga0068855_100265510
308 Ga0068857_100060544
309 Ga0068854_100550936
310 Ga0068856_100122621
311 Ga0068852_100052062
312 Ga0068852_100518996
313 Ga0070717_10014964
314 Ga0070717_10284221
315 Ga0070712_100023627
316 Ga0075433_10274880
317 Ga0075434_100002695
318 Ga0105240_10480129
319 Ga0105242_10018709
320 Ga0105237_10038849
321 Ga0105237_10239905
322 Ga0105238_10011515
323 Ga0157373_10164679
324 Ga0157369_10007748
325 Ga0157369_10079346
326 Ga0157369_10093681
327 Ga0157369_10125839
328 Ga0157369_10222122
329 Ga0157374_10054460
330 Ga0157372_10459191
331 Ga0157375_10289472
332 Ga0206354_10127242
333 Ga0206354_10975443
334 Ga0206353_11582338
335 Ga0206353_11932920
336 Ga0213876_10036169
337 Ga0207705_10027092
338 Ga0207705_10053457
339 Ga0207707_10007672
340 Ga0207707_10227492
341 Ga0207693_10025210
342 Ga0207693_10126513
343 Ga0207693_10141473
344 Ga0207693_10259354
345 Ga0207663_10141500
346 Ga0207663_10292998
347 Ga0207660_10019350
348 Ga0207660_10040894
349 Ga0207657_10003306
350 Ga0207657_10010110
351 Ga0207657_10010286
352 Ga0207657_10029063
353 Ga0207657_10090688
354 Ga0207652_10015364
355 Ga0207652_10037189
356 Ga0207652_10042203
357 Ga0207652_10088178
358 Ga0207652_10090762
359 Ga0207646_10304086
360 Ga0207686_10279335
361 Ga0207709_10415747
362 Ga0207661_10136562
363 Ga0207661_10475361
364 Ga0207661_10658095
365 Ga0207667_10045874
366 Ga0207667_10084999
367 Ga0207667_10101741
368 Ga0207667_10141742
369 Ga0207639_10098101
370 Ga0207678_10153471
371 Ga0207674_10256267
372 Ga0207683_10065396
373 Ga0207698_10060862
374 Ga0265334_10018340
375 Ga0265338_10048760
376 Ga0265325_10036380
377 Ga0265329_10024577
378 Ga0265340_10053822
379 Ga0265339_10027412
380 Ga0265327_10101305
381 Ga0265316_10012958
382 Ga0265313_10013512
383 Ga0265314_10008658
384 Ga0265342_10141414
385 Ga0373956_0100918
386 Ga0373943_0004156
387 Ga0373946_0047855
388 Ga0373935_0099595
389 Ga0373927_0026892
390 Ga0373947_0003168
391 Ga0373947_0267137
392 Ga0373937_0046019
393 Ga0373937_0094526
394 Ga0373925_0005891
395 Ga0373925_0020975
396 Ga0395899_0071338
397 Ga0395898_0011265
398 Ga0395898_0019509
399 Ga0395898_0081849
400 Ga0395905_0261175
401 Ga0395901_0049682
402 Ga0395901_0065868
403 Ga0395901_0108234
404 Ga0395901_0126931
405 Ga0436365_1581435
406 Ga0451853_0748032
407 Ga0466966_0003671
408 Ga0466966_0039032
409 Ga0466966_0150535
410 Ga0466961_0001440
411 Ga0466961_0025314
412 Ga0466961_0038303
413 Ga0466961_0102551
414 Ga0466963_0013725
415 Ga0466963_0044709
416 Ga0466963_0059915
417 Ga0466963_0094459
418 Ga0466964_0006708
419 Ga0466964_0009640
420 Ga0466971_0000127
421 Ga0466968_0039739
422 Ga0466957_0000562
423 Ga0466957_0045831
424 Ga0466957_0417245
425 Ga0466959_0032360
426 Ga0466959_0049112
427 Ga0466959_0061413
428 Ga0466958_0000170
429 Ga0466958_0065893
430 Ga0466958_0066970
431 Ga0466958_0082861
432 Ga0466958_0189985
433 Ga0466967_0000142
434 Ga0466967_0007579
435 Ga0466967_0030942
436 Ga0466967_0036198
437 Ga0466967_0038429
438 Ga0466967_0042371
439 Ga0466967_0058047
440 Ga0466967_0074416
441 Ga0466967_0292346
442 Ga0466967_0310243
443 Ga0466967_0319424
444 Ga0495603_0096381
445 Ga0495603_0107616
446 Ga0495629_0001237
447 Ga0495629_0082103
448 Ga0495629_0156442
449 Ga0495629_0164199
450 Ga0495641_0001769
451 Ga0495641_0009542
452 Ga0495641_0016237
453 Ga0495651_0053445
454 Ga0495605_0013592
455 Ga0495639_0000617
456 Ga0495662_0000358
457 Ga0495662_0079370
458 Ga0495662_0158618
459 Ga0495664_0023494
460 Ga0495664_0123578
461 Ga0495608_0005091
462 Ga0495608_0048110
463 Ga0495618_0059469
464 Ga0495618_0369627
465 Ga0495628_0008864
466 Ga0495628_0015134
467 Ga0495630_0146764
468 Ga0495652_0349597
469 Ga0495665_0008705
470 Ga0495640_0014948
471 Ga0495640_0031481
472 Ga0495587_0101294
473 Ga0495587_0128296
474 Ga0495645_0072948
475 Ga0495667_0007990
476 Ga0495667_0022633
477 Ga0495634_0086577
478 Ga0495635_0016858
479 Ga0495657_0087614
480 Ga0495599_0033884
481 Ga0495599_0131862
482 Ga0495646_0079717
483 Ga0495646_0087227
484 Ga0495658_0000433
485 Ga0495613_0007051
486 Ga0495613_0044852
487 Ga0495624_0008962
488 Ga0495600_0018104
489 Ga0495581_0001333
490 Ga0495674_0011600
491 Ga0495674_0018694
492 Ga0495674_0023882
493 Ga0495674_0358156
494 Ga0495676_0004926
495 Ga0495680_0005388
496 Ga0495680_0017566
497 Ga0495680_0025949
498 Ga0495684_0039140
499 Ga0495684_0069007
500 Ga0495684_0088679
501 Ga0495593_0006364
502 Ga0495602_0039762
503 Ga0495602_0078919
504 Ga0495602_0315623
505 Ga0495614_0000988
506 Ga0496100_0005876
507 Ga0496100_0018779
508 Ga0496100_0105117
509 Ga0496101_0005435
510 Ga0496101_0026683
511 Ga0496101_0031406
512 Ga0496101_0055290
513 Ga0496102_0006220
514 Ga0496102_0033208
515 Ga0496104_0001466
516 Ga0496104_0021511
517 Ga0496104_0056257
518 Ga0496105_0001100
519 Ga0496105_0015080
520 Ga0496106_0007326
521 Ga0496106_0034569
522 Ga0496106_0129874
523 Ga0496107_0009178
524 Ga0496107_0018302
525 Ga0496107_0455288
526 Ga0496108_0005627
527 Ga0496108_0391760
528 Ga0496109_0002941
529 Ga0496109_0298910
530 Ga0496110_0006910
531 Ga0496110_0107554
532 Ga0496112_0008246
533 Ga0496112_0035723
534 Ga0496112_0073646
535 Ga0496112_0121770
536 Ga0496113_0027158
537 Ga0496114_0009110
538 Ga0496114_0010711
539 Ga0496114_0043162
540 Ga0496114_0103639
541 Ga0496114_0112596
542 Ga0496115_0000790
543 Ga0496115_0002912
544 Ga0496115_0013093
545 Ga0496115_0086344
546 Ga0496115_0177828
547 Ga0496115_0249440
548 Ga0496115_0415798
549 Ga0501070_0451873
550 Ga0501080_0214087
551 nmdc:mga0n895_11560_c1
552 Ga0495601_0054555
553 Ga0495601_0261910
554 Ga0495595_0032849
555 Ga0495595_0040218
556 Ga0495595_0172381
557 Ga0495619_0002922
558 Ga0495619_0090060
559 Ga0466962_0000465
560 Ga0466962_0032852

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

13

234

0.95

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

14

297

0.84

PF04321

RmlD_sub_bind

RmlD substrate binding domain

11

261

0.83

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

14

230

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wja-assembly1.cif.gz_A udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac 0.9323 1 289
4zrn-assembly1.cif.gz_B crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima 0.9312 1 294
6wjb-assembly1.cif.gz_A udp-glcnac c4-epimerase from pseudomonas protegens in complex with nad and udp-glcnac 0.9296 1 289
6dnt-assembly1.cif.gz_A-2 udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid 0.9286 2 294
7ys8-assembly1.cif.gz_B crystal structure of udp-glucose 4-epimerase (rv3634c) from mycobacterium tuberculosis 0.9282 1 294
ID Description Score Start End Superfamily
4zrmB02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9627 163 293 3.90.25.10
4zrmB02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9452 163 293 3.90.25.10
af_B7ZXP4_113_239_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9411 2 96 3.40.50.720
af_Q4E0S3_8_323_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9335 1 297 3.40.50.720
af_P37127_327_452_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9315 2 32 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A358DNQ6-F1-model_v4 UDP-glucose 4-epimerase 0.9673 154 293
AF-A0A7C0UJZ1-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9656 121 294
AF-A0A2M7ZAX9-F1-model_v4 UDP-glucuronate decarboxylase (EC 4.1.1.35) 0.9633 174 293 GO:0005737
GO:0042732
GO:0048040
GO:0070403
AF-A0A7C4ENW1-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9627 160 289
AF-A0A1V5NRR2-F1-model_v4 UDP-glucuronate decarboxylase (EC 4.1.1.35) 0.9615 175 295 GO:0005737
GO:0016020
GO:0033320
GO:0042732
GO:0048040
GO:0070403

Map