F383599

General Info

Members Datasets Scaffolds Average Seq Length
280 179 560 448

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100083844|Ga0075429_1000838442
Length 495
Sequence MKGSSPDFRRGLRSIARASGRARRRSPDFGGRTSSPSDILEALIRIAPGVVILLVLPIASFACSTKPMGVETNPAAQAQRAPGRSFDDQIDDHSKDMLKEGRKIFRYDTFGSEDFWGGKVRLHQAIAGDKQGGAGAGLTARQALQLGLKVDIGALPKILVEAIKGGSVDLDRVETTLELLRANAVVGVTGFFDKDTKRLTSLGVQCALCHSTVDDSLAKGIGRRLDGWPNRDLNIGAIVASAPTLKPFADLLGADEATVRKVLLSWGPGRYDAELNQDGKAFRPDGKSAATVLPAAFGLAGVNLHTYTGWGSVTYWNAYVATTQMYGKGTFFDPRMNDASQFPVAAKSRFWNKRDTPDLVTSKLAALHYYQLSIPAPAPPKDSYDVAAAGRGKAVFEGKAKCATCHVPPLFTEPGWGMHTAAEIGIDDFQASRSPDKKFYRTTPLRGLFVRAKGGFYHDGRFEDLKAVVAHYNRVLNLALTSAETGDLIEYLKSL

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
174 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
175 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
176 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.43
Nodule 0
Rhizoplane 3.21
Rhizosphere 94.64
Stem 0
Stem Tuber 0
Unclassified 9.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100083844 3300006880 Unclassified 2778
2 JGI25406J46586_10001882 3300003203 Bacteria 9868
3 Ga0070676_10016744 3300005328 Bacteria 4052
4 Ga0070676_10046352 3300005328 Bacteria 2535
5 Ga0070683_100002980 3300005329 Bacteria 13578
6 Ga0070690_100023844 3300005330 Bacteria 3758
7 Ga0070690_100027019 3300005330 Bacteria 3545
8 Ga0070670_100010461 3300005331 Bacteria 7917
9 Ga0070666_10006091 3300005335 Bacteria 7412
10 Ga0070680_100012975 3300005336 Bacteria 6481
11 Ga0068868_100000702 3300005338 Bacteria 22491
12 Ga0068868_100037610 3300005338 Bacteria 3753
13 Ga0068868_100085561 3300005338 Bacteria 2534
14 Ga0068868_100137866 3300005338 Bacteria 2001
15 Ga0070689_100034525 3300005340 Bacteria 3859
16 Ga0070689_100066116 3300005340 Bacteria 2817
17 Ga0070687_100088024 3300005343 Bacteria 1711
18 Ga0070661_100018254 3300005344 Bacteria 4986
19 Ga0070692_10009683 3300005345 Bacteria 4357
20 Ga0070668_100019612 3300005347 Bacteria 5090
21 Ga0070668_100056767 3300005347 Bacteria 3024
22 Ga0070668_100117711 3300005347 Bacteria 2120
23 Ga0070669_100007699 3300005353 Bacteria 7701
24 Ga0070669_100034023 3300005353 Bacteria 3689
25 Ga0070669_100049692 3300005353 Bacteria 3062
26 Ga0070675_100000092 3300005354 Bacteria 51567
27 Ga0070675_100080425 3300005354 Bacteria 2716
28 Ga0070674_100025594 3300005356 Bacteria 3843
29 Ga0070674_100091537 3300005356 Bacteria 2196
30 Ga0070673_100000104 3300005364 Bacteria 38120
31 Ga0070673_100075954 3300005364 Bacteria 2711
32 Ga0070688_100013834 3300005365 Bacteria 4563
33 Ga0070659_100065918 3300005366 Bacteria 2869
34 Ga0070667_100004199 3300005367 Bacteria 12164
35 Ga0070709_10020053 3300005434 Unclassified 3874
36 Ga0070709_10124344 3300005434 Bacteria 1753
37 Ga0070714_100039278 3300005435 Bacteria 3984
38 Ga0070701_10019453 3300005438 Bacteria 3207
39 Ga0070708_100054584 3300005445 Bacteria 3549
40 Ga0070678_100133731 3300005456 Bacteria 1974
41 Ga0070662_100059682 3300005457 Bacteria 2779
42 Ga0070662_100180419 3300005457 Bacteria 1664
43 Ga0070681_10156925 3300005458 Bacteria 2200
44 Ga0070685_10016761 3300005466 Bacteria 3908
45 Ga0070685_10046468 3300005466 Bacteria 2493
46 Ga0070679_100098303 3300005530 Bacteria 2914
47 Ga0070697_100002209 3300005536 Bacteria 14929
48 Ga0070672_100017435 3300005543 Bacteria 5169
49 Ga0070686_100020865 3300005544 Bacteria 3883
50 Ga0070696_100091571 3300005546 Bacteria 2165
51 Ga0070693_100011002 3300005547 Bacteria 4548
52 Ga0070704_100095671 3300005549 Bacteria 2225
53 Ga0068855_100007842 3300005563 Bacteria 12900
54 Ga0070664_100009826 3300005564 Bacteria 7754
55 Ga0068859_100032161 3300005617 Bacteria 5270
56 Ga0068859_100043195 3300005617 Bacteria 4530
57 Ga0068859_100096954 3300005617 Bacteria 3001
58 Ga0068859_100202531 3300005617 Bacteria 2070
59 Ga0068861_100112898 3300005719 Bacteria 2179
60 Ga0068863_100000332 3300005841 Bacteria 47939
61 Ga0068858_100005559 3300005842 Bacteria 12333
62 Ga0068858_100054342 3300005842 Bacteria 3703
63 Ga0068860_100045749 3300005843 Bacteria 4173
64 Ga0068860_100254766 3300005843 Bacteria 1710
65 Ga0068862_100015868 3300005844 Bacteria 6259
66 Ga0068862_100019400 3300005844 Bacteria 5674
67 Ga0081455_10100398 3300005937 Unclassified 2325
68 Ga0081538_10002955 3300005981 Bacteria 16226
69 Ga0081539_10000025 3300005985 Bacteria 340255
70 Ga0070717_10085819 3300006028 Unclassified 2650
71 Ga0070712_100005094 3300006175 Bacteria 8136
72 Ga0070712_100181733 3300006175 Unclassified 1639
73 Ga0097621_100054873 3300006237 Bacteria 3252
74 Ga0068871_100046107 3300006358 Bacteria 3510
75 Ga0068871_100143331 3300006358 Bacteria 2033
76 Ga0075428_100150905 3300006844 Bacteria 2524
77 Ga0075431_100031241 3300006847 Bacteria 5486
78 Ga0075433_10004215 3300006852 Bacteria 11160
79 Ga0075433_10053740 3300006852 Bacteria 3512
80 Ga0075433_10055357 3300006852 Bacteria 3462
81 Ga0075433_10127638 3300006852 Bacteria 2259
82 Ga0075434_100000351 3300006871 Bacteria 33381
83 Ga0075434_100043449 3300006871 Bacteria 4458
84 Ga0075434_100148146 3300006871 Unclassified 2367
85 Ga0075429_100108962 3300006880 Unclassified 2421
86 Ga0068865_100001119 3300006881 Bacteria 15495
87 Ga0075436_100003120 3300006914 Bacteria 11358
88 Ga0097620_100032161 3300006931 Bacteria 5270
89 Ga0097620_100043191 3300006931 Bacteria 4530
90 Ga0097620_100096961 3300006931 Bacteria 3001
91 Ga0097620_100202522 3300006931 Bacteria 2070
92 Ga0075435_100000029 3300007076 Bacteria 81530
93 Ga0075435_100091246 3300007076 Bacteria 2514
94 Ga0105240_10003388 3300009093 Bacteria 24780
95 Ga0111539_10066897 3300009094 Bacteria 4244
96 Ga0111539_10122552 3300009094 Bacteria 3047
97 Ga0105245_10006861 3300009098 Bacteria 9987
98 Ga0105245_10041432 3300009098 Bacteria 4105
99 Ga0114129_10000607 3300009147 Bacteria 44318
100 Ga0114129_10004909 3300009147 Bacteria 18875
101 Ga0114129_10005232 3300009147 Bacteria 18279
102 Ga0114129_10032660 3300009147 Bacteria 7354
103 Ga0114129_10083645 3300009147 Bacteria 4432
104 Ga0114129_10091783 3300009147 Bacteria 4207
105 Ga0114129_10115270 3300009147 Bacteria 3704
106 Ga0114129_10135365 3300009147 Unclassified 3381
107 Ga0114129_10203154 3300009147 Unclassified 2683
108 Ga0114129_10250168 3300009147 Bacteria 2379
109 Ga0114129_10251811 3300009147 Bacteria 2370
110 Ga0105242_10176466 3300009176 Unclassified 1882
111 Ga0105248_10001246 3300009177 Bacteria 28450
112 Ga0105248_10079934 3300009177 Bacteria 3674
113 Ga0105249_10350220 3300009553 Unclassified 1496
114 Ga0105239_10261539 3300010375 Unclassified 1945
115 Ga0157374_10063399 3300013296 Bacteria 3466
116 Ga0157378_10043164 3300013297 Bacteria 4003
117 Ga0163162_10001252 3300013306 Bacteria 23767
118 Ga0157375_10000078 3300013308 Bacteria 97644
119 Ga0157375_10045456 3300013308 Bacteria 4274
120 Ga0163163_10046944 3300014325 Bacteria 4243
121 Ga0163163_10163222 3300014325 Bacteria 2274
122 Ga0157380_10014454 3300014326 Bacteria 5775
123 Ga0157379_10000034 3300014968 Bacteria 82381
124 Ga0213876_10035893 3300021384 Bacteria 2615
125 Ga0207680_10011600 3300025903 Bacteria 4458
126 Ga0207680_10034346 3300025903 Bacteria 2901
127 Ga0207645_10115210 3300025907 Bacteria 1742
128 Ga0207645_10139593 3300025907 Unclassified 1579
129 Ga0207684_10001354 3300025910 Bacteria 26829
130 Ga0207695_10002514 3300025913 Bacteria 26948
131 Ga0207693_10012938 3300025915 Bacteria 6735
132 Ga0207693_10125872 3300025915 Bacteria 2014
133 Ga0207663_10103687 3300025916 Bacteria 1916
134 Ga0207662_10060161 3300025918 Bacteria 2278
135 Ga0207662_10201756 3300025918 Bacteria 1288
136 Ga0207652_10021455 3300025921 Bacteria 5331
137 Ga0207646_10002767 3300025922 Bacteria 20490
138 Ga0207681_10001653 3300025923 Bacteria 14357
139 Ga0207681_10090591 3300025923 Bacteria 2183
140 Ga0207650_10023023 3300025925 Bacteria 4415
141 Ga0207659_10035411 3300025926 Unclassified 3451
142 Ga0207659_10135404 3300025926 Bacteria 1906
143 Ga0207687_10003020 3300025927 Bacteria 11412
144 Ga0207644_10061232 3300025931 Bacteria 2725
145 Ga0207706_10039486 3300025933 Bacteria 4185
146 Ga0207706_10211343 3300025933 Bacteria 1701
147 Ga0207670_10021809 3300025936 Bacteria 3957
148 Ga0207670_10051360 3300025936 Bacteria 2768
149 Ga0207669_10019957 3300025937 Bacteria 3502
150 Ga0207669_10092927 3300025937 Bacteria 1970
151 Ga0207704_10011692 3300025938 Bacteria 4333
152 Ga0207665_10054434 3300025939 Unclassified 2698
153 Ga0207665_10070778 3300025939 Bacteria 2380
154 Ga0207665_10129562 3300025939 Bacteria 1789
155 Ga0207665_10158375 3300025939 Bacteria 1627
156 Ga0207691_10008706 3300025940 Bacteria 9736
157 Ga0207711_10000506 3300025941 Bacteria 40310
158 Ga0207711_10119883 3300025941 Bacteria 2348
159 Ga0207689_10112666 3300025942 Unclassified 2236
160 Ga0207661_10000530 3300025944 Bacteria 24456
161 Ga0207679_10005225 3300025945 Bacteria 8140
162 Ga0207667_10000705 3300025949 Bacteria 43375
163 Ga0207651_10000195 3300025960 Bacteria 26476
164 Ga0207651_10068023 3300025960 Bacteria 2509
165 Ga0207668_10078895 3300025972 Bacteria 2379
166 Ga0207658_10003990 3300025986 Bacteria 10339
167 Ga0207677_10000045 3300026023 Bacteria 106591
168 Ga0207677_10183027 3300026023 Bacteria 1650
169 Ga0207703_10007568 3300026035 Bacteria 8612
170 Ga0207703_10008127 3300026035 Bacteria 8292
171 Ga0207708_10001065 3300026075 Bacteria 20575
172 Ga0207702_10144986 3300026078 Bacteria 2154
173 Ga0207648_10028730 3300026089 Bacteria 4929
174 Ga0207675_100000361 3300026118 Bacteria 43555
175 Ga0207675_100109160 3300026118 Bacteria 2610
176 Ga0207675_100139179 3300026118 Bacteria 2305
177 Ga0207698_10011133 3300026142 Bacteria 5816
178 Ga0268265_10010303 3300028380 Bacteria 6312
179 Ga0268265_10051708 3300028380 Bacteria 3102
180 Ga0268264_10005402 3300028381 Bacteria 10823
181 Ga0307408_100009189 3300031548 Bacteria 6518
182 Ga0307408_100174717 3300031548 Bacteria 1718
183 Ga0307408_100220334 3300031548 Bacteria 1548
184 Ga0307410_10023829 3300031852 Bacteria 3814
185 Ga0307407_10043643 3300031903 Bacteria 2522
186 Ga0307409_100120809 3300031995 Bacteria 2218
187 Ga0307415_100118341 3300032126 Bacteria 1981
188 Ga0373923_0007212 3300035111 Bacteria 3897
189 Ga0373936_0004384 3300035113 Bacteria 5337
190 Ga0373945_0017734 3300035116 Bacteria 2414
191 Ga0373956_0024362 3300035119 Bacteria 2607
192 Ga0373924_0001602 3300035410 Bacteria 7419
193 Ga0373935_0024537 3300035692 Bacteria 3712
194 Ga0373937_0050185 3300036401 Bacteria 3821
195 Ga0395899_0067745 3300037312 Unclassified 2619
196 Ga0395900_0246597 3300037418 Bacteria 1789
197 Ga0436365_1129539 3300039437 Bacteria 7725
198 Ga0453683_0000127 3300044673 Bacteria 113365
199 Ga0453684_0006138 3300044712 Bacteria 23131
200 Ga0495651_0029242 3300046462 Bacteria 4297
201 Ga0495665_0009487 3300046531 Bacteria 5268
202 Ga0495613_0018495 3300046689 Bacteria 5195
203 Ga0496100_0072748 3300048903 Bacteria 2299
204 Ga0496104_0084092 3300048907 Bacteria 3036
205 Ga0496104_0149091 3300048907 Bacteria 2246
206 Ga0496104_0247064 3300048907 Bacteria 1697
207 Ga0496105_0012483 3300048908 Bacteria 6726
208 Ga0496112_0146824 3300048915 Unclassified 2327
209 Ga0496113_0020635 3300048916 Unclassified 4637
210 Ga0496114_0000355 3300048917 Bacteria 33590
211 Ga0496115_0024329 3300048918 Bacteria 4705
212 Ga0501033_0006829 3300049570 Bacteria 8908
213 Ga0501036_0146605 3300049572 Bacteria 1991
214 Ga0501037_0015407 3300049573 Bacteria 5625
215 Ga0501038_0002283 3300049574 Bacteria 17829
216 Ga0501039_0032237 3300049575 Unclassified 4039
217 Ga0501039_0108920 3300049575 Bacteria 2165
218 Ga0501040_0001352 3300049576 Bacteria 15501
219 Ga0501040_0083881 3300049576 Bacteria 2210
220 Ga0501041_0001457 3300049577 Bacteria 13089
221 Ga0501042_0000587 3300049578 Bacteria 19294
222 Ga0501042_0028722 3300049578 Bacteria 3922
223 Ga0501046_0031971 3300049580 Unclassified 4263
224 Ga0501048_0008309 3300049582 Bacteria 7851
225 Ga0501048_0031300 3300049582 Bacteria 3849
226 Ga0501068_0004007 3300049584 Bacteria 8012
227 Ga0501071_0000011 3300049587 Bacteria 63363
228 Ga0501071_0033883 3300049587 Bacteria 3631
229 Ga0501071_0037194 3300049587 Bacteria 3474
230 Ga0501072_0044603 3300049588 Bacteria 3486
231 Ga0501073_0073986 3300049589 Unclassified 2372
232 Ga0501074_0021365 3300049590 Unclassified 4700
233 Ga0501074_0122578 3300049590 Bacteria 1859
234 Ga0501075_0054938 3300049591 Bacteria 2997
235 Ga0501076_0001008 3300049592 Bacteria 18484
236 Ga0501076_0108763 3300049592 Bacteria 2239
237 Ga0501077_0056975 3300049593 Bacteria 2481
238 Ga0501079_0001779 3300049741 Bacteria 15386
239 Ga0501079_0223432 3300049741 Unclassified 1471
240 Ga0501080_0012428 3300049742 Bacteria 7805
241 Ga0501080_0047749 3300049742 Bacteria 3986
242 Ga0501080_0290935 3300049742 Bacteria 1483
243 Ga0501080_0328803 3300049742 Bacteria 1383
244 Ga0501081_0001549 3300049743 Bacteria 14145
245 Ga0501081_0008145 3300049743 Bacteria 6803
246 Ga0501083_0110931 3300049744 Unclassified 1804
247 Ga0501035_0046226 3300049822 Unclassified 3916
248 Ga0501035_0059523 3300049822 Bacteria 3402
249 nmdc:mga05p37_111085_c1 3300050507 Bacteria 3371
250 nmdc:mga05p37_119526_c1 3300050507 Bacteria 3238
251 nmdc:mga05p37_125_c1 3300050507 Bacteria 69864
252 nmdc:mga05p37_170265_c1 3300050507 Bacteria 2656
253 nmdc:mga05p37_3880_c2 3300050507 Bacteria 6202
254 nmdc:mga05p37_464630_c1 3300050507 Bacteria 1461
255 nmdc:mga09592_103360_c1 3300050508 Unclassified 2441
256 nmdc:mga0qj67_66297_c2 3300050509 Bacteria 2132
257 nmdc:mga06r32_108672_c1 3300050510 Bacteria 2727
258 nmdc:mga06r32_6106_c1 3300050510 Bacteria 10820
259 nmdc:mga08y16_67072_c1 3300050511 Bacteria 3744
260 nmdc:mga08y16_7064_c1 3300050511 Bacteria 11785
261 nmdc:mga0n895_38846_c1 3300050512 Bacteria 4614
262 nmdc:mga0n895_42482_c1 3300050512 Bacteria 4422
263 nmdc:mga0n895_64477_c1 3300050512 Bacteria 3624
264 nmdc:mga0n895_73994_c1 3300050512 Bacteria 3383
265 nmdc:mga0rr50_113_c1 3300050513 Bacteria 44867
266 nmdc:mga0rr50_93920_c1 3300050513 Bacteria 2341
267 nmdc:mga08x19_4579_c1 3300050514 Bacteria 8207
268 nmdc:mga0a205_106278_c1 3300050515 Bacteria 2705
269 nmdc:mga0a205_2378_c1 3300050515 Bacteria 15650
270 nmdc:mga0a205_252148_c1 3300050515 Bacteria 1644
271 Ga0495601_0007220 3300053077 Bacteria 6516
272 Ga0500566_0077096 3300053094 Bacteria 1862
273 Ga0500597_022813 3300053120 Bacteria 2494
274 Ga0500614_006354 3300053123 Bacteria 2483
275 Ga0500636_0023473 3300053177 Bacteria 3647
276 Ga0501084_0026620 3300054114 Bacteria 4827
277 Ga0501082_0001726 3300060353 Bacteria 19284
278 Ga0530510_0000106 3300061734 Bacteria 46126
279 Ga0530510_0000228 3300061734 Bacteria 35067
280 Ga0530510_0007081 3300061734 Bacteria 7805
281 Ga0075429_100083844
282 JGI25406J46586_10001882
283 Ga0070676_10016744
284 Ga0070676_10046352
285 Ga0070683_100002980
286 Ga0070690_100023844
287 Ga0070690_100027019
288 Ga0070670_100010461
289 Ga0070666_10006091
290 Ga0070680_100012975
291 Ga0068868_100000702
292 Ga0068868_100037610
293 Ga0068868_100085561
294 Ga0068868_100137866
295 Ga0070689_100034525
296 Ga0070689_100066116
297 Ga0070687_100088024
298 Ga0070661_100018254
299 Ga0070692_10009683
300 Ga0070668_100019612
301 Ga0070668_100056767
302 Ga0070668_100117711
303 Ga0070669_100007699
304 Ga0070669_100034023
305 Ga0070669_100049692
306 Ga0070675_100000092
307 Ga0070675_100080425
308 Ga0070674_100025594
309 Ga0070674_100091537
310 Ga0070673_100000104
311 Ga0070673_100075954
312 Ga0070688_100013834
313 Ga0070659_100065918
314 Ga0070667_100004199
315 Ga0070709_10020053
316 Ga0070709_10124344
317 Ga0070714_100039278
318 Ga0070701_10019453
319 Ga0070708_100054584
320 Ga0070678_100133731
321 Ga0070662_100059682
322 Ga0070662_100180419
323 Ga0070681_10156925
324 Ga0070685_10016761
325 Ga0070685_10046468
326 Ga0070679_100098303
327 Ga0070697_100002209
328 Ga0070672_100017435
329 Ga0070686_100020865
330 Ga0070696_100091571
331 Ga0070693_100011002
332 Ga0070704_100095671
333 Ga0068855_100007842
334 Ga0070664_100009826
335 Ga0068859_100032161
336 Ga0068859_100043195
337 Ga0068859_100096954
338 Ga0068859_100202531
339 Ga0068861_100112898
340 Ga0068863_100000332
341 Ga0068858_100005559
342 Ga0068858_100054342
343 Ga0068860_100045749
344 Ga0068860_100254766
345 Ga0068862_100015868
346 Ga0068862_100019400
347 Ga0081455_10100398
348 Ga0081538_10002955
349 Ga0081539_10000025
350 Ga0070717_10085819
351 Ga0070712_100005094
352 Ga0070712_100181733
353 Ga0097621_100054873
354 Ga0068871_100046107
355 Ga0068871_100143331
356 Ga0075428_100150905
357 Ga0075431_100031241
358 Ga0075433_10004215
359 Ga0075433_10053740
360 Ga0075433_10055357
361 Ga0075433_10127638
362 Ga0075434_100000351
363 Ga0075434_100043449
364 Ga0075434_100148146
365 Ga0075429_100108962
366 Ga0068865_100001119
367 Ga0075436_100003120
368 Ga0097620_100032161
369 Ga0097620_100043191
370 Ga0097620_100096961
371 Ga0097620_100202522
372 Ga0075435_100000029
373 Ga0075435_100091246
374 Ga0105240_10003388
375 Ga0111539_10066897
376 Ga0111539_10122552
377 Ga0105245_10006861
378 Ga0105245_10041432
379 Ga0114129_10000607
380 Ga0114129_10004909
381 Ga0114129_10005232
382 Ga0114129_10032660
383 Ga0114129_10083645
384 Ga0114129_10091783
385 Ga0114129_10115270
386 Ga0114129_10135365
387 Ga0114129_10203154
388 Ga0114129_10250168
389 Ga0114129_10251811
390 Ga0105242_10176466
391 Ga0105248_10001246
392 Ga0105248_10079934
393 Ga0105249_10350220
394 Ga0105239_10261539
395 Ga0157374_10063399
396 Ga0157378_10043164
397 Ga0163162_10001252
398 Ga0157375_10000078
399 Ga0157375_10045456
400 Ga0163163_10046944
401 Ga0163163_10163222
402 Ga0157380_10014454
403 Ga0157379_10000034
404 Ga0213876_10035893
405 Ga0207680_10011600
406 Ga0207680_10034346
407 Ga0207645_10115210
408 Ga0207645_10139593
409 Ga0207684_10001354
410 Ga0207695_10002514
411 Ga0207693_10012938
412 Ga0207693_10125872
413 Ga0207663_10103687
414 Ga0207662_10060161
415 Ga0207662_10201756
416 Ga0207652_10021455
417 Ga0207646_10002767
418 Ga0207681_10001653
419 Ga0207681_10090591
420 Ga0207650_10023023
421 Ga0207659_10035411
422 Ga0207659_10135404
423 Ga0207687_10003020
424 Ga0207644_10061232
425 Ga0207706_10039486
426 Ga0207706_10211343
427 Ga0207670_10021809
428 Ga0207670_10051360
429 Ga0207669_10019957
430 Ga0207669_10092927
431 Ga0207704_10011692
432 Ga0207665_10054434
433 Ga0207665_10070778
434 Ga0207665_10129562
435 Ga0207665_10158375
436 Ga0207691_10008706
437 Ga0207711_10000506
438 Ga0207711_10119883
439 Ga0207689_10112666
440 Ga0207661_10000530
441 Ga0207679_10005225
442 Ga0207667_10000705
443 Ga0207651_10000195
444 Ga0207651_10068023
445 Ga0207668_10078895
446 Ga0207658_10003990
447 Ga0207677_10000045
448 Ga0207677_10183027
449 Ga0207703_10007568
450 Ga0207703_10008127
451 Ga0207708_10001065
452 Ga0207702_10144986
453 Ga0207648_10028730
454 Ga0207675_100000361
455 Ga0207675_100109160
456 Ga0207675_100139179
457 Ga0207698_10011133
458 Ga0268265_10010303
459 Ga0268265_10051708
460 Ga0268264_10005402
461 Ga0307408_100009189
462 Ga0307408_100174717
463 Ga0307408_100220334
464 Ga0307410_10023829
465 Ga0307407_10043643
466 Ga0307409_100120809
467 Ga0307415_100118341
468 Ga0373923_0007212
469 Ga0373936_0004384
470 Ga0373945_0017734
471 Ga0373956_0024362
472 Ga0373924_0001602
473 Ga0373935_0024537
474 Ga0373937_0050185
475 Ga0395899_0067745
476 Ga0395900_0246597
477 Ga0436365_1129539
478 Ga0453683_0000127
479 Ga0453684_0006138
480 Ga0495651_0029242
481 Ga0495665_0009487
482 Ga0495613_0018495
483 Ga0496100_0072748
484 Ga0496104_0084092
485 Ga0496104_0149091
486 Ga0496104_0247064
487 Ga0496105_0012483
488 Ga0496112_0146824
489 Ga0496113_0020635
490 Ga0496114_0000355
491 Ga0496115_0024329
492 Ga0501033_0006829
493 Ga0501036_0146605
494 Ga0501037_0015407
495 Ga0501038_0002283
496 Ga0501039_0032237
497 Ga0501039_0108920
498 Ga0501040_0001352
499 Ga0501040_0083881
500 Ga0501041_0001457
501 Ga0501042_0000587
502 Ga0501042_0028722
503 Ga0501046_0031971
504 Ga0501048_0008309
505 Ga0501048_0031300
506 Ga0501068_0004007
507 Ga0501071_0000011
508 Ga0501071_0033883
509 Ga0501071_0037194
510 Ga0501072_0044603
511 Ga0501073_0073986
512 Ga0501074_0021365
513 Ga0501074_0122578
514 Ga0501075_0054938
515 Ga0501076_0001008
516 Ga0501076_0108763
517 Ga0501077_0056975
518 Ga0501079_0001779
519 Ga0501079_0223432
520 Ga0501080_0012428
521 Ga0501080_0047749
522 Ga0501080_0290935
523 Ga0501080_0328803
524 Ga0501081_0001549
525 Ga0501081_0008145
526 Ga0501083_0110931
527 Ga0501035_0046226
528 Ga0501035_0059523
529 nmdc:mga05p37_111085_c1
530 nmdc:mga05p37_119526_c1
531 nmdc:mga05p37_125_c1
532 nmdc:mga05p37_170265_c1
533 nmdc:mga05p37_3880_c2
534 nmdc:mga05p37_464630_c1
535 nmdc:mga09592_103360_c1
536 nmdc:mga0qj67_66297_c2
537 nmdc:mga06r32_108672_c1
538 nmdc:mga06r32_6106_c1
539 nmdc:mga08y16_67072_c1
540 nmdc:mga08y16_7064_c1
541 nmdc:mga0n895_38846_c1
542 nmdc:mga0n895_42482_c1
543 nmdc:mga0n895_64477_c1
544 nmdc:mga0n895_73994_c1
545 nmdc:mga0rr50_113_c1
546 nmdc:mga0rr50_93920_c1
547 nmdc:mga08x19_4579_c1
548 nmdc:mga0a205_106278_c1
549 nmdc:mga0a205_2378_c1
550 nmdc:mga0a205_252148_c1
551 Ga0495601_0007220
552 Ga0500566_0077096
553 Ga0500597_022813
554 Ga0500614_006354
555 Ga0500636_0023473
556 Ga0501084_0026620
557 Ga0501082_0001726
558 Ga0530510_0000106
559 Ga0530510_0000228
560 Ga0530510_0007081

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c2w-assembly1.cif.gz_F kuenenia stuttgartiensis hydrazine synthase pressurized with 20 bar xenon 0.5879 300 457
6fu3-assembly1.cif.gz_B structure of the mixed-valence, active form, of cytochrome c peroxidase from obligate human pathogenic bacterium neisseria gonorrhoeae 0.5531 227 456
2c1v-assembly1.cif.gz_B crystal structure of the di-haem cytochrome c peroxidase from paracoccus pantotrophus - mixed valence form 0.5516 243 456
2vhd-assembly1.cif.gz_B crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa - mixed valence form 0.546 227 457
4aam-assembly1.cif.gz_A maca wild-type mixed-valence 0.5315 227 456
ID Description Score Start End Superfamily
2yevE02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.3545 336 457 2.60.40.420
4nkpD01 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.3339 123 167 3.30.450.150
1vrfA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.32 346 455 1.10.490.10
af_P45395_202_325_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.2818 111 167 3.10.580.10
1vrfA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.2601 346 455 1.10.490.10
ID Description Score Start End GO Terms
AF-A0A2V9HHE6-F1-model_v4 Cytochrome c domain-containing protein 0.9943 337 457 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A7V9KNR0-F1-model_v4 Cytochrome c domain-containing protein 0.9908 282 457 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A525VJ72-F1-model_v4 Cytochrome c 0.9864 381 457 GO:0009055
GO:0020037
AF-A0A536U520-F1-model_v4 Cytochrome c domain-containing protein 0.9852 74 457 GO:0004130
GO:0009055
GO:0020037
GO:0046872
AF-A0A838FCE0-F1-model_v4 Cytochrome c domain-containing protein 0.9851 337 457 GO:0004130
GO:0009055
GO:0020037
GO:0046872

Map