F383592

General Info

Members Datasets Scaffolds Average Seq Length
280 178 560 213

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100076670|Ga0075428_1000766703
Length 248
Sequence VWACALVRTNEDVWAGERRVIEEWIVTDVLEGSFTPNATKFFAGLERDNSKDYWTANKAVFENEVKEPMAALVESLPERFGPFKTFRMNRDIRFSADKSPYKTQHGAAHEADGTVYYVHLDAHGLMAACGAYMMAPDQLERYRQAVAAESTGPALEGILDNLNERGFDVGHGMSEPLKTAPRGFPKDHPRVDLLRQKAVSAHRRLEGSQLGDAAAVQRFVVETFEACGPMNDWIKSNIGSSESGHGRR

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
59 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
60 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
61 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
62 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
63 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
75 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
76 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
77 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
78 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
79 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
80 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
83 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
84 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
85 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
86 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
87 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
88 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
91 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
94 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
100 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
101 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
102 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
103 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
104 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
161 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
174 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.36
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 0
Rhizoplane 5.71
Rhizosphere 90.36
Stem 0
Stem Tuber 0
Unclassified 7.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100076670 3300006844 Bacteria 3650
2 JGI25406J46586_10027134 3300003203 Bacteria 2200
3 rootH2_10076713 3300003320 Bacteria 1909
4 rootL2_10308502 3300003322 Bacteria 1104
5 Ga0070683_100003264 3300005329 Bacteria 13109
6 Ga0068868_100666269 3300005338 Bacteria 928
7 Ga0070668_100001529 3300005347 Bacteria 16692
8 Ga0070710_10197417 3300005437 Bacteria 1268
9 Ga0070711_100104515 3300005439 Bacteria 2066
10 Ga0070708_100044014 3300005445 Bacteria 3924
11 Ga0070708_100704263 3300005445 Bacteria 950
12 Ga0070663_100734428 3300005455 Bacteria 842
13 Ga0070678_101080945 3300005456 Bacteria 740
14 Ga0070706_100021546 3300005467 Bacteria 5935
15 Ga0070706_100031768 3300005467 Bacteria 4868
16 Ga0070706_100622310 3300005467 Bacteria 1003
17 Ga0070707_100000204 3300005468 Bacteria 59509
18 Ga0070707_100222355 3300005468 Bacteria 1838
19 Ga0070707_100657223 3300005468 Bacteria 1011
20 Ga0070698_100000167 3300005471 Bacteria 60583
21 Ga0070698_100000784 3300005471 Bacteria 34441
22 Ga0070698_100031870 3300005471 Bacteria 5464
23 Ga0070698_100039408 3300005471 Bacteria 4863
24 Ga0070684_100392260 3300005535 Bacteria 1279
25 Ga0070696_100527789 3300005546 Bacteria 943
26 Ga0070665_100349927 3300005548 Bacteria 1483
27 Ga0068855_100463149 3300005563 Bacteria 1382
28 Ga0068856_100441725 3300005614 Bacteria 1322
29 Ga0068861_101036764 3300005719 Bacteria 785
30 Ga0068862_100049852 3300005844 Bacteria 3577
31 Ga0081455_10000897 3300005937 Bacteria 38395
32 Ga0081455_10023023 3300005937 Bacteria 5807
33 Ga0081538_10000742 3300005981 Bacteria 35568
34 Ga0081539_10000170 3300005985 Bacteria 152854
35 Ga0081539_10003746 3300005985 Bacteria 18071
36 Ga0081539_10004245 3300005985 Bacteria 16093
37 Ga0070717_10145825 3300006028 Bacteria 2044
38 Ga0070717_10617057 3300006028 Bacteria 984
39 Ga0075364_10044558 3300006051 Bacteria 2886
40 Ga0075432_10002770 3300006058 Bacteria 5877
41 Ga0075432_10011383 3300006058 Bacteria 3022
42 Ga0070712_100141476 3300006175 Bacteria 1837
43 Ga0068871_100099025 3300006358 Bacteria 2440
44 Ga0075428_100085685 3300006844 Bacteria 3436
45 Ga0075430_100599821 3300006846 Bacteria 909
46 Ga0075431_100747912 3300006847 Bacteria 953
47 Ga0075433_10023812 3300006852 Bacteria 5158
48 Ga0075433_10053136 3300006852 Bacteria 3531
49 Ga0075433_10217616 3300006852 Bacteria 1697
50 Ga0075434_100011103 3300006871 Bacteria 8477
51 Ga0075434_100342330 3300006871 Bacteria 1516
52 Ga0075429_100410766 3300006880 Bacteria 1186
53 Ga0075436_100024021 3300006914 Bacteria 4189
54 Ga0075436_100217759 3300006914 Bacteria 1354
55 Ga0075436_100224373 3300006914 Bacteria 1334
56 Ga0075435_100006066 3300007076 Bacteria 8512
57 Ga0075435_100037878 3300007076 Unclassified 3843
58 Ga0075435_100096519 3300007076 Bacteria 2445
59 Ga0075435_100372252 3300007076 Bacteria 1226
60 Ga0111539_10017862 3300009094 Bacteria 8785
61 Ga0111539_10242777 3300009094 Bacteria 2097
62 Ga0114129_10001072 3300009147 Bacteria 35951
63 Ga0114129_10006527 3300009147 Bacteria 16554
64 Ga0105239_11055576 3300010375 Unclassified 935
65 Ga0157369_10470417 3300013105 Bacteria 1301
66 Ga0157380_10975506 3300014326 Bacteria 879
67 Ga0206353_11006429 3300020082 Bacteria 3406
68 Ga0207692_10004053 3300025898 Bacteria 5774
69 Ga0207685_10017372 3300025905 Bacteria 2324
70 Ga0207684_10000929 3300025910 Bacteria 33195
71 Ga0207684_10023977 3300025910 Bacteria 5206
72 Ga0207684_10025938 3300025910 Bacteria 4996
73 Ga0207693_10068911 3300025915 Bacteria 2769
74 Ga0207693_10594755 3300025915 Bacteria 861
75 Ga0207663_10004131 3300025916 Bacteria 7187
76 Ga0207663_10278651 3300025916 Bacteria 1241
77 Ga0207646_10000123 3300025922 Bacteria 105739
78 Ga0207700_10003112 3300025928 Bacteria 9587
79 Ga0207700_10282453 3300025928 Bacteria 1428
80 Ga0207664_10042704 3300025929 Bacteria 3541
81 Ga0207664_10200683 3300025929 Bacteria 1721
82 Ga0207661_10003872 3300025944 Bacteria 10434
83 Ga0207679_10173203 3300025945 Bacteria 1779
84 Ga0207667_10425377 3300025949 Bacteria 1351
85 Ga0207668_10001910 3300025972 Bacteria 12204
86 Ga0207428_10034082 3300027907 Unclassified 4176
87 Ga0268266_10167853 3300028379 Bacteria 1990
88 Ga0307517_10110105 3300028786 Bacteria 2102
89 Ga0307515_10000027 3300028794 Bacteria 371624
90 Ga0307515_10051757 3300028794 Bacteria 6112
91 Ga0307512_10034894 3300030522 Bacteria 4296
92 Ga0307508_10014901 3300031616 Bacteria 7092
93 Ga0316578_10240041 3300031728 Bacteria 1088
94 Ga0307516_10028815 3300031730 Bacteria 5616
95 Ga0307405_10016248 3300031731 Bacteria 4053
96 Ga0307410_10000082 3300031852 Bacteria 32475
97 Ga0307410_10311361 3300031852 Bacteria 1246
98 Ga0307406_10000389 3300031901 Bacteria 25412
99 Ga0307406_10086152 3300031901 Bacteria 2102
100 Ga0307407_10029330 3300031903 Bacteria 2954
101 Ga0307412_10040183 3300031911 Bacteria 3026
102 Ga0307409_100107517 3300031995 Bacteria 2330
103 Ga0307409_100152319 3300031995 Bacteria 2009
104 Ga0307409_100209468 3300031995 Bacteria 1751
105 Ga0307409_100425491 3300031995 Bacteria 1275
106 Ga0307416_100000064 3300032002 Bacteria 95532
107 Ga0307416_100463066 3300032002 Bacteria 1323
108 Ga0307416_101057916 3300032002 Unclassified 915
109 Ga0307414_10093723 3300032004 Bacteria 2239
110 Ga0307411_10088863 3300032005 Bacteria 2150
111 Ga0307415_100000921 3300032126 Bacteria 13491
112 Ga0307415_100020075 3300032126 Bacteria 4071
113 Ga0307415_100258866 3300032126 Bacteria 1418
114 Ga0373959_0010086 3300034820 Bacteria 1644
115 Ga0373934_0054579 3300035086 Bacteria 1586
116 Ga0373940_0001960 3300035088 Bacteria 3886
117 Ga0373949_0086693 3300035090 Bacteria 841
118 Ga0373951_0030466 3300035091 Bacteria 1270
119 Ga0373952_0022930 3300035092 Bacteria 1330
120 Ga0373923_0044602 3300035111 Bacteria 1838
121 Ga0373923_0052545 3300035111 Bacteria 1712
122 Ga0373936_0000836 3300035113 Bacteria 10950
123 Ga0373939_0011936 3300035114 Bacteria 2205
124 Ga0373945_0087698 3300035116 Bacteria 1201
125 Ga0373953_0003703 3300035117 Bacteria 4800
126 Ga0373953_0069535 3300035117 Bacteria 1450
127 Ga0373954_0020257 3300035118 Bacteria 3007
128 Ga0373956_0133268 3300035119 Bacteria 1164
129 Ga0373957_0009196 3300035120 Bacteria 3226
130 Ga0373957_0010287 3300035120 Bacteria 3087
131 Ga0373960_0005650 3300035121 Bacteria 2906
132 Ga0373955_0014579 3300035172 Bacteria 3827
133 Ga0373955_0015823 3300035172 Bacteria 3699
134 Ga0373961_0014848 3300035241 Bacteria 1983
135 Ga0373924_0002232 3300035410 Bacteria 6494
136 Ga0373935_0064192 3300035692 Bacteria 2354
137 Ga0373935_0183613 3300035692 Bacteria 1437
138 Ga0373935_0322615 3300035692 Bacteria 1096
139 Ga0373927_0129045 3300035695 Bacteria 1651
140 Ga0373933_0003898 3300035724 Bacteria 8231
141 Ga0373933_0033153 3300035724 Bacteria 3002
142 Ga0373947_0095743 3300035725 Bacteria 1858
143 Ga0373947_0185580 3300035725 Bacteria 1356
144 Ga0373937_0010001 3300036401 Bacteria 8272
145 Ga0373937_0277385 3300036401 Bacteria 1582
146 Ga0373925_0190295 3300037068 Bacteria 1628
147 Ga0451853_0178765 3300041512 Bacteria 3993
148 Ga0439463_009648 3300042016 Bacteria 2374
149 Ga0439463_017187 3300042016 Bacteria 1792
150 Ga0439435_0039400 3300042436 Bacteria 1317
151 Ga0439459_0004852 3300042438 Bacteria 2184
152 Ga0439464_0015247 3300042439 Bacteria 2072
153 Ga0439460_0015085 3300042461 Bacteria 2040
154 Ga0439440_0003752 3300042993 Bacteria 2955
155 Ga0439440_0020596 3300042993 Unclassified 1480
156 Ga0466967_0227381 3300045976 Bacteria 1775
157 Ga0466967_1136003 3300045976 Bacteria 778
158 Ga0495592_0041953 3300046454 Bacteria 3427
159 Ga0495592_0247631 3300046454 Bacteria 1179
160 Ga0495603_0008955 3300046455 Bacteria 6050
161 Ga0495603_0239568 3300046455 Bacteria 1045
162 Ga0495629_0002977 3300046459 Bacteria 12884
163 Ga0495629_0052479 3300046459 Bacteria 2853
164 Ga0495641_0016758 3300046461 Bacteria 3848
165 Ga0495641_0018917 3300046461 Bacteria 3540
166 Ga0495641_0033917 3300046461 Bacteria 2418
167 Ga0495641_0248567 3300046461 Unclassified 799
168 Ga0495651_0055381 3300046462 Bacteria 3047
169 Ga0495651_0158414 3300046462 Bacteria 1624
170 Ga0495651_0263937 3300046462 Bacteria 1170
171 Ga0495653_0399057 3300046463 Bacteria 874
172 Ga0495580_0254441 3300046472 Bacteria 1202
173 Ga0495582_0012458 3300046473 Bacteria 4686
174 Ga0495582_0021980 3300046473 Bacteria 3490
175 Ga0495639_0084865 3300046475 Bacteria 1479
176 Ga0495639_0410128 3300046475 Bacteria 685
177 Ga0495662_0007893 3300046476 Bacteria 5240
178 Ga0495662_0026496 3300046476 Bacteria 2799
179 Ga0495664_0006503 3300046477 Bacteria 6457
180 Ga0495664_0071477 3300046477 Bacteria 2072
181 Ga0495664_0135566 3300046477 Bacteria 1491
182 Ga0495608_0013190 3300046511 Bacteria 5736
183 Ga0495608_0061483 3300046511 Bacteria 2469
184 Ga0495618_0007128 3300046514 Bacteria 6762
185 Ga0495628_0185175 3300046516 Bacteria 1573
186 Ga0495628_0187890 3300046516 Bacteria 1561
187 Ga0495628_0216630 3300046516 Unclassified 1439
188 Ga0495632_0011538 3300046519 Bacteria 5151
189 Ga0495652_0528301 3300046529 Unclassified 814
190 Ga0495665_0036330 3300046531 Bacteria 2630
191 Ga0495640_0085685 3300046533 Bacteria 2087
192 Ga0495586_0003792 3300046535 Bacteria 8100
193 Ga0495586_0018781 3300046535 Bacteria 3681
194 Ga0495586_0335976 3300046535 Unclassified 867
195 Ga0495587_0005895 3300046536 Bacteria 7985
196 Ga0495587_0077033 3300046536 Bacteria 1936
197 Ga0495645_0031155 3300046543 Bacteria 3885
198 Ga0495645_0292337 3300046543 Unclassified 1067
199 Ga0495667_0104877 3300046559 Bacteria 1827
200 Ga0495667_0110438 3300046559 Bacteria 1776
201 Ga0495634_0027588 3300046642 Bacteria 3949
202 Ga0495634_0072758 3300046642 Bacteria 2260
203 Ga0495635_0049733 3300046663 Bacteria 2889
204 Ga0495635_0054390 3300046663 Bacteria 2757
205 Ga0495657_0024088 3300046675 Bacteria 4340
206 Ga0495657_0088230 3300046675 Bacteria 1994
207 Ga0495599_0011129 3300046678 Bacteria 5521
208 Ga0495599_0517383 3300046678 Unclassified 701
209 Ga0495623_0032433 3300046679 Bacteria 3357
210 Ga0495623_0049800 3300046679 Bacteria 2654
211 Ga0495646_0075360 3300046680 Bacteria 1978
212 Ga0495658_0051122 3300046683 Bacteria 2340
213 Ga0495613_0043578 3300046689 Bacteria 3319
214 Ga0495613_0483240 3300046689 Bacteria 836
215 Ga0495624_0183233 3300046690 Bacteria 1275
216 Ga0495624_0252318 3300046690 Bacteria 1067
217 Ga0495581_0034928 3300047315 Bacteria 2909
218 Ga0495604_0120765 3300047317 Bacteria 1897
219 Ga0495604_0239965 3300047317 Bacteria 1240
220 Ga0495674_0015940 3300047319 Bacteria 7016
221 Ga0495674_0393564 3300047319 Unclassified 1119
222 Ga0495672_0008960 3300047320 Bacteria 7305
223 Ga0495676_0114434 3300047321 Bacteria 1974
224 Ga0495680_0047299 3300047322 Bacteria 3384
225 Ga0495675_0033719 3300047444 Bacteria 3267
226 Ga0495675_0271406 3300047444 Bacteria 1014
227 Ga0495684_0068443 3300047471 Bacteria 2699
228 Ga0495684_0096071 3300047471 Bacteria 2243
229 Ga0495593_0005245 3300047673 Bacteria 7660
230 Ga0495602_0025497 3300048088 Bacteria 5722
231 Ga0495602_0113518 3300048088 Bacteria 2195
232 Ga0495602_0188437 3300048088 Unclassified 1584
233 Ga0496101_0176078 3300048904 Bacteria 1645
234 Ga0496102_0414265 3300048905 Bacteria 1266
235 Ga0496103_0196854 3300048906 Bacteria 1296
236 Ga0496105_0733481 3300048908 Bacteria 756
237 Ga0496107_0399503 3300048910 Bacteria 1022
238 Ga0496108_0352591 3300048911 Unclassified 1284
239 Ga0496108_0887365 3300048911 Bacteria 766
240 Ga0496108_0914921 3300048911 Bacteria 752
241 Ga0496109_0427758 3300048912 Unclassified 1251
242 Ga0496109_0987932 3300048912 Bacteria 779
243 Ga0496110_0166496 3300048913 Archaea 1999
244 Ga0496112_0382362 3300048915 Bacteria 1349
245 Ga0496113_0115125 3300048916 Bacteria 2097
246 Ga0496114_0719288 3300048917 Bacteria 875
247 Ga0496115_0276277 3300048918 Bacteria 1379
248 Ga0496115_0790050 3300048918 Bacteria 740
249 Ga0501072_0144063 3300049588 Bacteria 1900
250 Ga0501198_027387 3300049649 Unclassified 936
251 Ga0501225_0090325 3300049705 Unclassified 887
252 Ga0501083_0156228 3300049744 Bacteria 1493
253 Ga0501045_0153217 3300049824 Bacteria 1715
254 nmdc:mga05p37_27434_c1 3300050507 Bacteria 6932
255 nmdc:mga09592_232_c1 3300050508 Bacteria 40256
256 nmdc:mga0qj67_120_c1 3300050509 Bacteria 51746
257 nmdc:mga0qj67_614839_c1 3300050509 Bacteria 868
258 nmdc:mga06r32_558_c1 3300050510 Bacteria 32346
259 nmdc:mga06r32_617477_c1 3300050510 Bacteria 1054
260 nmdc:mga08y16_74971_c1 3300050511 Unclassified 3527
261 nmdc:mga0n895_551749_c1 3300050512 Unclassified 1158
262 nmdc:mga0n895_86706_c1 3300050512 Bacteria 3128
263 nmdc:mga0n895_98906_c1 3300050512 Unclassified 2925
264 nmdc:mga0rr50_213971_c1 3300050513 Bacteria 1589
265 nmdc:mga0rr50_22155_c1 3300050513 Unclassified 4354
266 nmdc:mga0rr50_30716_c1 3300050513 Bacteria 3808
267 nmdc:mga08x19_172307_c1 3300050514 Bacteria 1474
268 nmdc:mga08x19_175860_c1 3300050514 Bacteria 1460
269 nmdc:mga08x19_39124_c1 3300050514 Bacteria 3014
270 nmdc:mga08x19_90245_c1 3300050514 Bacteria 2022
271 nmdc:mga0a205_125331_c1 3300050515 Unclassified 2468
272 nmdc:mga0a205_19086_c1 3300050515 Bacteria 6462
273 nmdc:mga0a205_92437_c1 3300050515 Bacteria 2923
274 Ga0495612_0066493 3300053078 Bacteria 1498
275 Ga0495595_0008600 3300053084 Bacteria 4198
276 Ga0495619_0167044 3300053085 Bacteria 1521
277 Ga0495619_0203559 3300053085 Bacteria 1370
278 Ga0500616_0075265 3300053153 Bacteria 1709
279 Ga0501084_0000226 3300054114 Bacteria 42779
280 2753262795 2751185782 Bacteria 11227053
281 Ga0075428_100076670
282 JGI25406J46586_10027134
283 rootH2_10076713
284 rootL2_10308502
285 Ga0070683_100003264
286 Ga0068868_100666269
287 Ga0070668_100001529
288 Ga0070710_10197417
289 Ga0070711_100104515
290 Ga0070708_100044014
291 Ga0070708_100704263
292 Ga0070663_100734428
293 Ga0070678_101080945
294 Ga0070706_100021546
295 Ga0070706_100031768
296 Ga0070706_100622310
297 Ga0070707_100000204
298 Ga0070707_100222355
299 Ga0070707_100657223
300 Ga0070698_100000167
301 Ga0070698_100000784
302 Ga0070698_100031870
303 Ga0070698_100039408
304 Ga0070684_100392260
305 Ga0070696_100527789
306 Ga0070665_100349927
307 Ga0068855_100463149
308 Ga0068856_100441725
309 Ga0068861_101036764
310 Ga0068862_100049852
311 Ga0081455_10000897
312 Ga0081455_10023023
313 Ga0081538_10000742
314 Ga0081539_10000170
315 Ga0081539_10003746
316 Ga0081539_10004245
317 Ga0070717_10145825
318 Ga0070717_10617057
319 Ga0075364_10044558
320 Ga0075432_10002770
321 Ga0075432_10011383
322 Ga0070712_100141476
323 Ga0068871_100099025
324 Ga0075428_100085685
325 Ga0075430_100599821
326 Ga0075431_100747912
327 Ga0075433_10023812
328 Ga0075433_10053136
329 Ga0075433_10217616
330 Ga0075434_100011103
331 Ga0075434_100342330
332 Ga0075429_100410766
333 Ga0075436_100024021
334 Ga0075436_100217759
335 Ga0075436_100224373
336 Ga0075435_100006066
337 Ga0075435_100037878
338 Ga0075435_100096519
339 Ga0075435_100372252
340 Ga0111539_10017862
341 Ga0111539_10242777
342 Ga0114129_10001072
343 Ga0114129_10006527
344 Ga0105239_11055576
345 Ga0157369_10470417
346 Ga0157380_10975506
347 Ga0206353_11006429
348 Ga0207692_10004053
349 Ga0207685_10017372
350 Ga0207684_10000929
351 Ga0207684_10023977
352 Ga0207684_10025938
353 Ga0207693_10068911
354 Ga0207693_10594755
355 Ga0207663_10004131
356 Ga0207663_10278651
357 Ga0207646_10000123
358 Ga0207700_10003112
359 Ga0207700_10282453
360 Ga0207664_10042704
361 Ga0207664_10200683
362 Ga0207661_10003872
363 Ga0207679_10173203
364 Ga0207667_10425377
365 Ga0207668_10001910
366 Ga0207428_10034082
367 Ga0268266_10167853
368 Ga0307517_10110105
369 Ga0307515_10000027
370 Ga0307515_10051757
371 Ga0307512_10034894
372 Ga0307508_10014901
373 Ga0316578_10240041
374 Ga0307516_10028815
375 Ga0307405_10016248
376 Ga0307410_10000082
377 Ga0307410_10311361
378 Ga0307406_10000389
379 Ga0307406_10086152
380 Ga0307407_10029330
381 Ga0307412_10040183
382 Ga0307409_100107517
383 Ga0307409_100152319
384 Ga0307409_100209468
385 Ga0307409_100425491
386 Ga0307416_100000064
387 Ga0307416_100463066
388 Ga0307416_101057916
389 Ga0307414_10093723
390 Ga0307411_10088863
391 Ga0307415_100000921
392 Ga0307415_100020075
393 Ga0307415_100258866
394 Ga0373959_0010086
395 Ga0373934_0054579
396 Ga0373940_0001960
397 Ga0373949_0086693
398 Ga0373951_0030466
399 Ga0373952_0022930
400 Ga0373923_0044602
401 Ga0373923_0052545
402 Ga0373936_0000836
403 Ga0373939_0011936
404 Ga0373945_0087698
405 Ga0373953_0003703
406 Ga0373953_0069535
407 Ga0373954_0020257
408 Ga0373956_0133268
409 Ga0373957_0009196
410 Ga0373957_0010287
411 Ga0373960_0005650
412 Ga0373955_0014579
413 Ga0373955_0015823
414 Ga0373961_0014848
415 Ga0373924_0002232
416 Ga0373935_0064192
417 Ga0373935_0183613
418 Ga0373935_0322615
419 Ga0373927_0129045
420 Ga0373933_0003898
421 Ga0373933_0033153
422 Ga0373947_0095743
423 Ga0373947_0185580
424 Ga0373937_0010001
425 Ga0373937_0277385
426 Ga0373925_0190295
427 Ga0451853_0178765
428 Ga0439463_009648
429 Ga0439463_017187
430 Ga0439435_0039400
431 Ga0439459_0004852
432 Ga0439464_0015247
433 Ga0439460_0015085
434 Ga0439440_0003752
435 Ga0439440_0020596
436 Ga0466967_0227381
437 Ga0466967_1136003
438 Ga0495592_0041953
439 Ga0495592_0247631
440 Ga0495603_0008955
441 Ga0495603_0239568
442 Ga0495629_0002977
443 Ga0495629_0052479
444 Ga0495641_0016758
445 Ga0495641_0018917
446 Ga0495641_0033917
447 Ga0495641_0248567
448 Ga0495651_0055381
449 Ga0495651_0158414
450 Ga0495651_0263937
451 Ga0495653_0399057
452 Ga0495580_0254441
453 Ga0495582_0012458
454 Ga0495582_0021980
455 Ga0495639_0084865
456 Ga0495639_0410128
457 Ga0495662_0007893
458 Ga0495662_0026496
459 Ga0495664_0006503
460 Ga0495664_0071477
461 Ga0495664_0135566
462 Ga0495608_0013190
463 Ga0495608_0061483
464 Ga0495618_0007128
465 Ga0495628_0185175
466 Ga0495628_0187890
467 Ga0495628_0216630
468 Ga0495632_0011538
469 Ga0495652_0528301
470 Ga0495665_0036330
471 Ga0495640_0085685
472 Ga0495586_0003792
473 Ga0495586_0018781
474 Ga0495586_0335976
475 Ga0495587_0005895
476 Ga0495587_0077033
477 Ga0495645_0031155
478 Ga0495645_0292337
479 Ga0495667_0104877
480 Ga0495667_0110438
481 Ga0495634_0027588
482 Ga0495634_0072758
483 Ga0495635_0049733
484 Ga0495635_0054390
485 Ga0495657_0024088
486 Ga0495657_0088230
487 Ga0495599_0011129
488 Ga0495599_0517383
489 Ga0495623_0032433
490 Ga0495623_0049800
491 Ga0495646_0075360
492 Ga0495658_0051122
493 Ga0495613_0043578
494 Ga0495613_0483240
495 Ga0495624_0183233
496 Ga0495624_0252318
497 Ga0495581_0034928
498 Ga0495604_0120765
499 Ga0495604_0239965
500 Ga0495674_0015940
501 Ga0495674_0393564
502 Ga0495672_0008960
503 Ga0495676_0114434
504 Ga0495680_0047299
505 Ga0495675_0033719
506 Ga0495675_0271406
507 Ga0495684_0068443
508 Ga0495684_0096071
509 Ga0495593_0005245
510 Ga0495602_0025497
511 Ga0495602_0113518
512 Ga0495602_0188437
513 Ga0496101_0176078
514 Ga0496102_0414265
515 Ga0496103_0196854
516 Ga0496105_0733481
517 Ga0496107_0399503
518 Ga0496108_0352591
519 Ga0496108_0887365
520 Ga0496108_0914921
521 Ga0496109_0427758
522 Ga0496109_0987932
523 Ga0496110_0166496
524 Ga0496112_0382362
525 Ga0496113_0115125
526 Ga0496114_0719288
527 Ga0496115_0276277
528 Ga0496115_0790050
529 Ga0501072_0144063
530 Ga0501198_027387
531 Ga0501225_0090325
532 Ga0501083_0156228
533 Ga0501045_0153217
534 nmdc:mga05p37_27434_c1
535 nmdc:mga09592_232_c1
536 nmdc:mga0qj67_120_c1
537 nmdc:mga0qj67_614839_c1
538 nmdc:mga06r32_558_c1
539 nmdc:mga06r32_617477_c1
540 nmdc:mga08y16_74971_c1
541 nmdc:mga0n895_551749_c1
542 nmdc:mga0n895_86706_c1
543 nmdc:mga0n895_98906_c1
544 nmdc:mga0rr50_213971_c1
545 nmdc:mga0rr50_22155_c1
546 nmdc:mga0rr50_30716_c1
547 nmdc:mga08x19_172307_c1
548 nmdc:mga08x19_175860_c1
549 nmdc:mga08x19_39124_c1
550 nmdc:mga08x19_90245_c1
551 nmdc:mga0a205_125331_c1
552 nmdc:mga0a205_19086_c1
553 nmdc:mga0a205_92437_c1
554 Ga0495612_0066493
555 Ga0495595_0008600
556 Ga0495619_0167044
557 Ga0495619_0203559
558 Ga0500616_0075265
559 Ga0501084_0000226
560 2753262795

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09365

DUF2461

Conserved hypothetical protein (DUF2461)

37

233

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j48-assembly1.cif.gz_O glycine mutation on single layer beta-sheet of ospasm1 0.6696 77 113
1sws-assembly1.cif.gz_C core-streptavidin mutant d128a at ph 4.5 0.65 79 112
8b4i-assembly1.cif.gz_B cryo-em structure of the neurospora crassa tom core complex at 3.3 angstrom 0.6458 80 110
7vd2-assembly1.cif.gz_B human tom complex without cross-linking 0.6314 80 114
3cxj-assembly1.cif.gz_A crystal structure of an uncharacterized protein from methanothermobacter thermautotrophicus 0.6306 80 216
ID Description Score Start End Superfamily
af_Q1L927_495_673_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.6585 84 107 2.60.120.200
2a8eA00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.6362 9 210 3.30.930.20
1mdcA00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.6269 74 113 2.40.128.20
af_Q2G2G7_1_204_3.30.930.20 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.6158 9 209 3.30.930.20
2a8eA00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.6117 9 210 3.30.930.20
ID Description Score Start End GO Terms
AF-A0A6B2TTU2-F1-model_v4 deleted 0.957 9 214
AF-A0A261CXJ0-F1-model_v4 TIGR02453 family protein 0.9558 9 214
AF-W5TW62-F1-model_v4 TIGR02453 family protein 0.9539 9 217
AF-A0A561BUB8-F1-model_v4 Uncharacterized protein (TIGR02453 family) 0.9524 9 214
AF-E5XKP5-F1-model_v4 TIGR02453 family protein 0.9519 9 218

Map