F383583
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 280 | 168 | 241 | 442 |
Family's Representative Sequence
| Representative Sequence | 3300006195|Ga0075366_10000700|Ga0075366_1000070010 |
| Length | 491 |
| Sequence | MGESREVRKTESRKEKEKKHSLVKKSSGLPVFPTSGLKKLSLPAMAAAFDDFNFNKQVLSAIADAGYTEPTPVQQKAIPPILNGQDVMGIAQTGTGKTAAYVLPIIMKLKYAQGEHARALIISPTRELAMQIEENVVAYSKYTDLRTVVLYGGLGPKTQIENIKKGVDIIVATPGRFMDIYLAGHIHTKPLQVLVLDEADKMMDMGFMPQINRILEIVPRKRQNLLFSATMSDKIHQLAGNFLEFPTVIEVTPQATPAQTIKQKLYYVPNVKTKINLLRRLLDEEDNAITKLIIFCKTRAVAEDVYKYLVRKYNQKEVKVLHANKGQNTRINSINSFKEDEVKILVATDVASRGIDVSNVSHVINFDVPVVYEDYVHRIGRTGRALQAGEAITFCNPTEVYYMGKIQKLIRQTVDVYPIPEGVFIEETPYEEKQDQNREIDLQKRKEDPDFKGAFHEKKTMSQHKKFDAKKLKANPRLGSKNPTKKFKKKH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 3 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 4 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 5 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 6 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 7 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 8 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 9 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 10 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 11 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 12 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 13 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 14 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 15 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 16 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 17 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 18 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 19 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 20 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 21 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 22 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 23 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 24 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 25 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 26 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 27 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 28 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 29 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 30 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 31 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 32 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 33 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 34 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 35 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 36 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 37 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 38 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 39 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 40 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 41 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 42 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 43 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 44 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 45 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 46 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 47 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 48 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 49 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 50 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 51 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 52 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 53 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 54 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 55 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 56 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 91 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 121 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 122 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 123 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 124 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 125 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 126 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 127 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 128 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 129 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 130 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 131 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 132 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 133 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 134 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 135 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 136 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 137 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 138 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 139 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 140 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 141 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 142 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 143 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 160 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 161 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 162 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 163 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 164 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 165 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 166 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 167 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 168 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.07 |
| Metatranscriptomes | 0 |
| Isolates | 13.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.36 |
| Nodule | 0 |
| Rhizoplane | 0.36 |
| Rhizosphere | 76.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2014720 | 2162886007 | Bacteria | 5060 |
| 2 | JGI24737J22298_10002294 | 3300001990 | Bacteria | 6798 |
| 3 | JGI24735J21928_10000006 | 3300002067 | Bacteria | 339303 |
| 4 | JGI24744J21845_10008743 | 3300002077 | Bacteria | 2081 |
| 5 | JGI25162J39368_1000046 | 3300002737 | Bacteria | 169695 |
| 6 | JGI25162J39368_1000948 | 3300002737 | Bacteria | 18580 |
| 7 | JGI25152J39213_1000049 | 3300002773 | Bacteria | 83240 |
| 8 | JGI25150J39212_1000001 | 3300002774 | Bacteria | 1318726 |
| 9 | JGI25151J46595_10000001 | 3300003187 | Bacteria | 887211 |
| 10 | JGI25165J46597_1003638 | 3300003214 | Bacteria | 3701 |
| 11 | JGI25153J46596_10000001 | 3300003215 | Bacteria | 748985 |
| 12 | rootH1_10054365 | 3300003316 | Bacteria | 1888 |
| 13 | rootH2_10006566 | 3300003320 | Bacteria | 99379 |
| 14 | rootH2_10130860 | 3300003320 | Bacteria | 7122 |
| 15 | rootL2_10007319 | 3300003322 | Bacteria | 3096 |
| 16 | rootH1_10010186 | 3300003323 | Bacteria | 30481 |
| 17 | rootH1_10228380 | 3300003323 | Bacteria | 3456 |
| 18 | Ga0055531_10001778 | 3300003794 | Bacteria | 15309 |
| 19 | Ga0065714_10002618 | 3300005288 | Bacteria | 39500 |
| 20 | Ga0065714_10002669 | 3300005288 | Bacteria | 17643 |
| 21 | Ga0065714_10003838 | 3300005288 | Bacteria | 17859 |
| 22 | Ga0065714_10005076 | 3300005288 | Bacteria | 5339 |
| 23 | Ga0065714_10064545 | 3300005288 | Bacteria | 38585 |
| 24 | Ga0065714_10066795 | 3300005288 | Bacteria | 6289 |
| 25 | Ga0065704_10000210 | 3300005289 | Bacteria | 93612 |
| 26 | Ga0065704_10071313 | 3300005289 | Bacteria | 11797 |
| 27 | Ga0065704_10080129 | 3300005289 | Bacteria | 4003 |
| 28 | Ga0070658_10000079 | 3300005327 | Bacteria | 90829 |
| 29 | Ga0070676_10002652 | 3300005328 | Bacteria | 9219 |
| 30 | Ga0070671_100005273 | 3300005355 | Bacteria | 10308 |
| 31 | Ga0070659_100000675 | 3300005366 | Bacteria | 24835 |
| 32 | Ga0070659_100053554 | 3300005366 | Bacteria | 3176 |
| 33 | Ga0070659_100114830 | 3300005366 | Bacteria | 2176 |
| 34 | Ga0070678_100007130 | 3300005456 | Bacteria | 6608 |
| 35 | Ga0070662_100000030 | 3300005457 | Bacteria | 81418 |
| 36 | Ga0068867_100003022 | 3300005459 | Bacteria | 11861 |
| 37 | Ga0068853_100020413 | 3300005539 | Bacteria | 5510 |
| 38 | Ga0068853_100037703 | 3300005539 | Bacteria | 4114 |
| 39 | Ga0070665_100000083 | 3300005548 | Bacteria | 181044 |
| 40 | Ga0068855_100000009 | 3300005563 | Bacteria | 246035 |
| 41 | Ga0068855_100000154 | 3300005563 | Bacteria | 87746 |
| 42 | Ga0068855_100039172 | 3300005563 | Bacteria | 5626 |
| 43 | Ga0068857_100065071 | 3300005577 | Bacteria | 3241 |
| 44 | Ga0068856_100000619 | 3300005614 | Bacteria | 38918 |
| 45 | Ga0068856_100004773 | 3300005614 | Bacteria | 13436 |
| 46 | Ga0068856_100192374 | 3300005614 | Bacteria | 2054 |
| 47 | Ga0068856_100199191 | 3300005614 | Bacteria | 2017 |
| 48 | Ga0068852_100009461 | 3300005616 | Bacteria | 7239 |
| 49 | Ga0068866_10115672 | 3300005718 | Bacteria | 1503 |
| 50 | Ga0068858_100133104 | 3300005842 | Bacteria | 2332 |
| 51 | Ga0075366_10000129 | 3300006195 | Bacteria | 31405 |
| 52 | Ga0075366_10000700 | 3300006195 | Bacteria | 15874 |
| 53 | Ga0075366_10009269 | 3300006195 | Bacteria | 5496 |
| 54 | Ga0097621_100000093 | 3300006237 | Bacteria | 49437 |
| 55 | Ga0068871_100000181 | 3300006358 | Bacteria | 42792 |
| 56 | Ga0068865_100000788 | 3300006881 | Bacteria | 17830 |
| 57 | Ga0105240_10000068 | 3300009093 | Bacteria | 207756 |
| 58 | Ga0105240_10003528 | 3300009093 | Bacteria | 24266 |
| 59 | Ga0105240_10029325 | 3300009093 | Bacteria | 7172 |
| 60 | Ga0105240_10132874 | 3300009093 | Bacteria | 2983 |
| 61 | Ga0105243_10000018 | 3300009148 | Bacteria | 227618 |
| 62 | Ga0105241_10001376 | 3300009174 | Bacteria | 18545 |
| 63 | Ga0105241_10021104 | 3300009174 | Bacteria | 4815 |
| 64 | Ga0105241_10024533 | 3300009174 | Bacteria | 4477 |
| 65 | Ga0105241_10037345 | 3300009174 | Bacteria | 3659 |
| 66 | Ga0105237_10000274 | 3300009545 | Bacteria | 72354 |
| 67 | Ga0105237_10001246 | 3300009545 | Bacteria | 33969 |
| 68 | Ga0105237_10001416 | 3300009545 | Bacteria | 31687 |
| 69 | Ga0105237_10004430 | 3300009545 | Bacteria | 16270 |
| 70 | Ga0105237_10005992 | 3300009545 | Bacteria | 13611 |
| 71 | Ga0105237_10155160 | 3300009545 | Bacteria | 2286 |
| 72 | Ga0105238_10046155 | 3300009551 | Bacteria | 4398 |
| 73 | Ga0105239_10000002 | 3300010375 | Bacteria | 610298 |
| 74 | Ga0105239_10000228 | 3300010375 | Bacteria | 82820 |
| 75 | Ga0105239_10005643 | 3300010375 | Bacteria | 14625 |
| 76 | Ga0105239_10005856 | 3300010375 | Bacteria | 14331 |
| 77 | Ga0105239_10023756 | 3300010375 | Bacteria | 6750 |
| 78 | Ga0105239_10058117 | 3300010375 | Bacteria | 4243 |
| 79 | Ga0105246_10101761 | 3300011119 | Bacteria | 2093 |
| 80 | Ga0157373_10000249 | 3300013100 | Bacteria | 44077 |
| 81 | Ga0157373_10000897 | 3300013100 | Bacteria | 23049 |
| 82 | Ga0157373_10004803 | 3300013100 | Bacteria | 10170 |
| 83 | Ga0157373_10005028 | 3300013100 | Bacteria | 9932 |
| 84 | Ga0157371_10000016 | 3300013102 | Bacteria | 330495 |
| 85 | Ga0157371_10000135 | 3300013102 | Bacteria | 107607 |
| 86 | Ga0157371_10000926 | 3300013102 | Bacteria | 32870 |
| 87 | Ga0157371_10004652 | 3300013102 | Bacteria | 11883 |
| 88 | Ga0157371_10013481 | 3300013102 | Bacteria | 6205 |
| 89 | Ga0157371_10024380 | 3300013102 | Bacteria | 4418 |
| 90 | Ga0157370_10000350 | 3300013104 | Bacteria | 58500 |
| 91 | Ga0157370_10004917 | 3300013104 | Bacteria | 15134 |
| 92 | Ga0157370_10012602 | 3300013104 | Bacteria | 8762 |
| 93 | Ga0157370_10023916 | 3300013104 | Bacteria | 6058 |
| 94 | Ga0157370_10039225 | 3300013104 | Bacteria | 4577 |
| 95 | Ga0157370_10045710 | 3300013104 | Bacteria | 4200 |
| 96 | Ga0157370_10076971 | 3300013104 | Bacteria | 3143 |
| 97 | Ga0157369_10000129 | 3300013105 | Bacteria | 108473 |
| 98 | Ga0157369_10000475 | 3300013105 | Bacteria | 53219 |
| 99 | Ga0157374_10000755 | 3300013296 | Bacteria | 28230 |
| 100 | Ga0157374_10012081 | 3300013296 | Bacteria | 7498 |
| 101 | Ga0163162_10000186 | 3300013306 | Bacteria | 57565 |
| 102 | Ga0163162_10000399 | 3300013306 | Bacteria | 39845 |
| 103 | Ga0163162_10014175 | 3300013306 | Bacteria | 7790 |
| 104 | Ga0163162_10027946 | 3300013306 | Bacteria | 5580 |
| 105 | Ga0157372_10000017 | 3300013307 | Bacteria | 219543 |
| 106 | Ga0157372_10000061 | 3300013307 | Bacteria | 119814 |
| 107 | Ga0157372_10004976 | 3300013307 | Bacteria | 14115 |
| 108 | Ga0157372_10065624 | 3300013307 | Bacteria | 4076 |
| 109 | Ga0157375_10011368 | 3300013308 | Bacteria | 7859 |
| 110 | Ga0157375_10061386 | 3300013308 | Bacteria | 3732 |
| 111 | Ga0182008_10000006 | 3300014497 | Bacteria | 378521 |
| 112 | Ga0182008_10000283 | 3300014497 | Bacteria | 39715 |
| 113 | Ga0182008_10005721 | 3300014497 | Bacteria | 7039 |
| 114 | Ga0182008_10012384 | 3300014497 | Bacteria | 4503 |
| 115 | Ga0182006_1000301 | 3300015261 | Bacteria | 43124 |
| 116 | Ga0182006_1002822 | 3300015261 | Bacteria | 9265 |
| 117 | Ga0182006_1008558 | 3300015261 | Bacteria | 4637 |
| 118 | Ga0182007_10000003 | 3300015262 | Bacteria | 548244 |
| 119 | Ga0163161_10000074 | 3300017792 | Bacteria | 101784 |
| 120 | Ga0163161_10000085 | 3300017792 | Bacteria | 93534 |
| 121 | Ga0163161_10000159 | 3300017792 | Bacteria | 62460 |
| 122 | Ga0163161_10047932 | 3300017792 | Bacteria | 3085 |
| 123 | Ga0207427_100076 | 3300025231 | Bacteria | 149885 |
| 124 | Ga0209437_100008 | 3300025233 | Bacteria | 921142 |
| 125 | Ga0209437_100070 | 3300025233 | Bacteria | 306718 |
| 126 | Ga0207425_1000002 | 3300025245 | Bacteria | 1362590 |
| 127 | Ga0209129_1000002 | 3300025258 | Bacteria | 1359086 |
| 128 | Ga0209233_1000024 | 3300025261 | Bacteria | 695418 |
| 129 | Ga0209233_1021793 | 3300025261 | Bacteria | 1650 |
| 130 | Ga0209455_1003554 | 3300025272 | Bacteria | 5454 |
| 131 | Ga0209025_1000004 | 3300025294 | Bacteria | 1361782 |
| 132 | Ga0209758_1000006 | 3300025297 | Bacteria | 1359562 |
| 133 | Ga0207647_10000448 | 3300025904 | Bacteria | 33476 |
| 134 | Ga0207647_10000545 | 3300025904 | Bacteria | 30015 |
| 135 | Ga0207645_10005673 | 3300025907 | Bacteria | 9016 |
| 136 | Ga0207705_10000112 | 3300025909 | Bacteria | 90821 |
| 137 | Ga0207654_10016175 | 3300025911 | Bacteria | 3880 |
| 138 | Ga0207654_10072624 | 3300025911 | Bacteria | 2049 |
| 139 | Ga0207695_10000131 | 3300025913 | Bacteria | 223762 |
| 140 | Ga0207695_10035783 | 3300025913 | Bacteria | 5378 |
| 141 | Ga0207695_10047036 | 3300025913 | Bacteria | 4569 |
| 142 | Ga0207671_10002363 | 3300025914 | Bacteria | 20310 |
| 143 | Ga0207671_10004975 | 3300025914 | Bacteria | 12451 |
| 144 | Ga0207671_10006367 | 3300025914 | Bacteria | 10528 |
| 145 | Ga0207671_10009968 | 3300025914 | Bacteria | 7892 |
| 146 | Ga0207671_10011013 | 3300025914 | Bacteria | 7404 |
| 147 | Ga0207671_10016803 | 3300025914 | Bacteria | 5672 |
| 148 | Ga0207671_10052674 | 3300025914 | Bacteria | 3015 |
| 149 | Ga0207687_10014842 | 3300025927 | Bacteria | 5101 |
| 150 | Ga0207690_10000439 | 3300025932 | Bacteria | 27079 |
| 151 | Ga0207706_10000129 | 3300025933 | Bacteria | 81280 |
| 152 | Ga0207709_10000021 | 3300025935 | Bacteria | 386722 |
| 153 | Ga0207667_10000045 | 3300025949 | Bacteria | 246053 |
| 154 | Ga0207667_10002915 | 3300025949 | Bacteria | 21237 |
| 155 | Ga0207667_10009137 | 3300025949 | Bacteria | 11708 |
| 156 | Ga0207677_10125022 | 3300026023 | Bacteria | 1942 |
| 157 | Ga0207639_10023075 | 3300026041 | Bacteria | 4489 |
| 158 | Ga0207702_10000899 | 3300026078 | Bacteria | 30910 |
| 159 | Ga0207702_10085612 | 3300026078 | Bacteria | 2747 |
| 160 | Ga0207648_10000241 | 3300026089 | Bacteria | 58974 |
| 161 | Ga0207683_10003055 | 3300026121 | Bacteria | 14640 |
| 162 | Ga0207698_10034008 | 3300026142 | Bacteria | 3711 |
| 163 | Ga0207698_10085642 | 3300026142 | Bacteria | 2560 |
| 164 | Ga0268266_10000095 | 3300028379 | Bacteria | 186169 |
| 165 | Ga0307517_10000719 | 3300028786 | Bacteria | 56987 |
| 166 | Ga0307515_10001923 | 3300028794 | Bacteria | 46075 |
| 167 | Ga0307515_10009923 | 3300028794 | Bacteria | 18332 |
| 168 | Ga0307515_10042467 | 3300028794 | Bacteria | 7111 |
| 169 | Ga0316177_1212624 | 3300030731 | Bacteria | 8351 |
| 170 | Ga0316176_1199340 | 3300030732 | Bacteria | 7919 |
| 171 | Ga0316183_1046144 | 3300030742 | Bacteria | 19599 |
| 172 | Ga0316181_1057272 | 3300030744 | Bacteria | 9497 |
| 173 | Ga0307509_10031108 | 3300031507 | Bacteria | 5897 |
| 174 | Ga0307509_10098778 | 3300031507 | Bacteria | 2962 |
| 175 | Ga0307408_100001373 | 3300031548 | Bacteria | 18154 |
| 176 | Ga0307408_100006729 | 3300031548 | Bacteria | 7620 |
| 177 | Ga0307408_100011272 | 3300031548 | Bacteria | 5903 |
| 178 | Ga0307405_10000003 | 3300031731 | Bacteria | 569064 |
| 179 | Ga0307407_10000008 | 3300031903 | Bacteria | 191228 |
| 180 | Ga0307412_10000055 | 3300031911 | Bacteria | 147100 |
| 181 | Ga0307412_10006409 | 3300031911 | Bacteria | 6654 |
| 182 | Ga0307409_100086786 | 3300031995 | Bacteria | 2548 |
| 183 | Ga0307416_100000009 | 3300032002 | Bacteria | 374271 |
| 184 | Ga0307414_10001536 | 3300032004 | Bacteria | 12011 |
| 185 | Ga0307414_10005470 | 3300032004 | Bacteria | 6999 |
| 186 | Ga0307414_10026129 | 3300032004 | Bacteria | 3753 |
| 187 | Ga0307414_10152203 | 3300032004 | Bacteria | 1826 |
| 188 | Ga0307507_10000510 | 3300033179 | Bacteria | 81853 |
| 189 | Ga0307510_10072222 | 3300033180 | Bacteria | 3430 |
| 190 | Ga0395899_0000033 | 3300037312 | Bacteria | 306589 |
| 191 | Ga0395899_0000382 | 3300037312 | Bacteria | 52888 |
| 192 | Ga0395899_0009476 | 3300037312 | Bacteria | 7475 |
| 193 | Ga0395900_0000362 | 3300037418 | Bacteria | 65661 |
| 194 | Ga0395900_0071583 | 3300037418 | Bacteria | 3564 |
| 195 | Ga0395905_0001575 | 3300037471 | Bacteria | 27234 |
| 196 | Ga0395901_0009198 | 3300038443 | Bacteria | 10010 |
| 197 | Ga0395901_0014855 | 3300038443 | Bacteria | 7912 |
| 198 | Ga0466969_0061178 | 3300044656 | Bacteria | 1830 |
| 199 | Ga0466966_0041884 | 3300044684 | Bacteria | 2941 |
| 200 | Ga0466959_0103951 | 3300045049 | Bacteria | 2032 |
| 201 | Ga0495650_0000014 | 3300046471 | Bacteria | 581606 |
| 202 | Ga0495585_0000081 | 3300046492 | Bacteria | 99243 |
| 203 | Ga0495585_0004145 | 3300046492 | Bacteria | 9485 |
| 204 | Ga0495596_0013122 | 3300046500 | Bacteria | 3524 |
| 205 | Ga0495583_0020788 | 3300046506 | Bacteria | 3390 |
| 206 | Ga0495606_0000020 | 3300046507 | Bacteria | 274490 |
| 207 | Ga0495606_0049940 | 3300046507 | Bacteria | 2740 |
| 208 | Ga0495610_0001612 | 3300046512 | Bacteria | 19839 |
| 209 | Ga0495610_0010246 | 3300046512 | Bacteria | 5842 |
| 210 | Ga0495616_0000533 | 3300046513 | Bacteria | 28740 |
| 211 | Ga0495616_0002796 | 3300046513 | Bacteria | 11393 |
| 212 | Ga0495631_0083885 | 3300046518 | Bacteria | 1373 |
| 213 | Ga0495648_0003414 | 3300046524 | Bacteria | 13959 |
| 214 | Ga0495652_0082285 | 3300046529 | Bacteria | 2654 |
| 215 | Ga0495633_0000097 | 3300046558 | Bacteria | 117316 |
| 216 | Ga0495633_0006858 | 3300046558 | Bacteria | 6670 |
| 217 | Ga0495633_0026078 | 3300046558 | Bacteria | 2871 |
| 218 | Ga0495668_0000069 | 3300046616 | Bacteria | 174287 |
| 219 | Ga0495625_0000009 | 3300046660 | Bacteria | 404954 |
| 220 | Ga0495625_0000097 | 3300046660 | Bacteria | 141191 |
| 221 | Ga0495625_0002039 | 3300046660 | Bacteria | 22734 |
| 222 | Ga0495625_0091799 | 3300046660 | Bacteria | 2099 |
| 223 | Ga0495625_0156253 | 3300046660 | Bacteria | 1530 |
| 224 | Ga0495661_0000997 | 3300046665 | Bacteria | 25537 |
| 225 | Ga0495661_0074439 | 3300046665 | Bacteria | 1976 |
| 226 | Ga0495649_0000172 | 3300046694 | Bacteria | 56537 |
| 227 | Ga0495686_0002807 | 3300047472 | Bacteria | 15809 |
| 228 | Ga0495686_0003397 | 3300047472 | Bacteria | 13853 |
| 229 | Ga0496117_0001260 | 3300048920 | Bacteria | 37607 |
| 230 | Ga0496122_0000404 | 3300048925 | Bacteria | 91618 |
| 231 | Ga0496122_0004732 | 3300048925 | Bacteria | 16698 |
| 232 | Ga0496123_0001627 | 3300048926 | Bacteria | 30246 |
| 233 | Ga0496123_0041356 | 3300048926 | Bacteria | 3197 |
| 234 | nmdc:mga0k408_111_c1 | 3300050493 | Bacteria | 39614 |
| 235 | nmdc:mga0k408_209_c1 | 3300050493 | Bacteria | 27944 |
| 236 | nmdc:mga0k408_58799_c1 | 3300050493 | Bacteria | 2233 |
| 237 | Ga0500635_0000551 | 3300053080 | Bacteria | 10027 |
| 238 | Ga0500651_0000839 | 3300053093 | Bacteria | 15089 |
| 239 | Ga0500608_001682 | 3300053122 | Bacteria | 7929 |
| 240 | Ga0500618_000158 | 3300053125 | Bacteria | 56115 |
| 241 | Ga0500622_0001412 | 3300053156 | Bacteria | 19356 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014497 | Ga0182008_10005721 | Ga0182008_100057211 | 367 |
| 2 | 3300046518 | Ga0495631_0083885 | Ga0495631_0083885_120_1340 | 385 |
| 3 | 3300005366 | Ga0070659_100000675 | Ga0070659_1000006755 | 402 |
| 4 | 3300025932 | Ga0207690_10000439 | Ga0207690_100004393 | 402 |
| 5 | 3300025904 | Ga0207647_10000448 | Ga0207647_1000044812 | 410 |
| 6 | 3300005614 | Ga0068856_100000619 | Ga0068856_10000061928 | 414 |
| 7 | 3300013100 | Ga0157373_10000249 | Ga0157373_1000024927 | 414 |
| 8 | 3300013306 | Ga0163162_10000399 | Ga0163162_1000039913 | 414 |
| 9 | 3300013307 | Ga0157372_10004976 | Ga0157372_1000497612 | 414 |
| 10 | 3300026078 | Ga0207702_10000899 | Ga0207702_1000089912 | 414 |
| 11 | 3300032004 | Ga0307414_10026129 | Ga0307414_100261292 | 414 |
| 12 | 3300037418 | Ga0395900_0000362 | Ga0395900_0000362_25986_27350 | 414 |
| 13 | 3300013100 | Ga0157373_10004803 | Ga0157373_100048035 | 415 |
| 14 | 3300037312 | Ga0395899_0000382 | Ga0395899_0000382_30612_31967 | 415 |
| 15 | 3300003322 | rootL2_10007319 | rootL2_100073192 | 416 |
| 16 | 3300003323 | rootH1_10228380 | rootH1_102283802 | 416 |
| 17 | 3300013104 | Ga0157370_10000350 | Ga0157370_1000035013 | 416 |
| 18 | 3300025927 | Ga0207687_10014842 | Ga0207687_100148423 | 416 |
| 19 | 3300031507 | Ga0307509_10031108 | Ga0307509_100311085 | 416 |
| 20 | 3300037471 | Ga0395905_0001575 | Ga0395905_0001575_2838_4319 | 416 |
| 21 | 3300038443 | Ga0395901_0014855 | Ga0395901_0014855_6405_7886 | 416 |
| 22 | 3300037312 | Ga0395899_0000033 | Ga0395899_0000033_225958_227298 | 417 |
| 23 | 3300003794 | Ga0055531_10001778 | Ga0055531_100017787 | 418 |
| 24 | 3300005539 | Ga0068853_100020413 | Ga0068853_1000204132 | 418 |
| 25 | 3300030731 | Ga0316177_1212624 | Ga0316177_12126245 | 418 |
| 26 | 3300030732 | Ga0316176_1199340 | Ga0316176_11993404 | 418 |
| 27 | 3300003320 | rootH2_10006566 | rootH2_1000656682 | 419 |
| 28 | 3300005289 | Ga0065704_10080129 | Ga0065704_100801292 | 419 |
| 29 | 3300009093 | Ga0105240_10132874 | Ga0105240_101328743 | 419 |
| 30 | 3300017792 | Ga0163161_10000074 | Ga0163161_1000007469 | 419 |
| 31 | 3300026041 | Ga0207639_10023075 | Ga0207639_100230752 | 419 |
| 32 | iso_pu_bacteria | 2898713307 | 2898716625 | 419 |
| 33 | 3300005563 | Ga0068855_100039172 | Ga0068855_1000391722 | 420 |
| 34 | 3300025949 | Ga0207667_10009137 | Ga0207667_100091371 | 420 |
| 35 | 3300047472 | Ga0495686_0002807 | Ga0495686_0002807_11705_13066 | 420 |
| 36 | iso_pu_bacteria | 2842903701 | 2842903907 | 420 |
| 37 | 3300013102 | Ga0157371_10024380 | Ga0157371_100243805 | 421 |
| 38 | 3300013306 | Ga0163162_10014175 | Ga0163162_100141756 | 421 |
| 39 | 3300013307 | Ga0157372_10000017 | Ga0157372_10000017193 | 421 |
| 40 | 3300026142 | Ga0207698_10085642 | Ga0207698_100856421 | 421 |
| 41 | 3300044656 | Ga0466969_0061178 | Ga0466969_0061178_23_1378 | 421 |
| 42 | 3300044684 | Ga0466966_0041884 | Ga0466966_0041884_1150_2505 | 421 |
| 43 | 3300045049 | Ga0466959_0103951 | Ga0466959_0103951_163_1518 | 421 |
| 44 | iso_pu_bacteria | 2896317667 | 2896319421 | 421 |
| 45 | 3300005548 | Ga0070665_100000083 | Ga0070665_100000083121 | 422 |
| 46 | 3300009093 | Ga0105240_10003528 | Ga0105240_1000352811 | 422 |
| 47 | 3300048920 | Ga0496117_0001260 | Ga0496117_0001260_32935_34365 | 422 |
| 48 | 3300048925 | Ga0496122_0004732 | Ga0496122_0004732_14483_15913 | 422 |
| 49 | 3300048926 | Ga0496123_0041356 | Ga0496123_0041356_1308_2738 | 422 |
| 50 | 3300002077 | JGI24744J21845_10008743 | JGI24744J21845_100087432 | 423 |
| 51 | 3300005327 | Ga0070658_10000079 | Ga0070658_1000007925 | 423 |
| 52 | 3300005328 | Ga0070676_10002652 | Ga0070676_100026528 | 423 |
| 53 | 3300005355 | Ga0070671_100005273 | Ga0070671_1000052737 | 423 |
| 54 | 3300005366 | Ga0070659_100114830 | Ga0070659_1001148302 | 423 |
| 55 | 3300005456 | Ga0070678_100007130 | Ga0070678_1000071304 | 423 |
| 56 | 3300005457 | Ga0070662_100000030 | Ga0070662_10000003025 | 423 |
| 57 | 3300005459 | Ga0068867_100003022 | Ga0068867_1000030225 | 423 |
| 58 | 3300005539 | Ga0068853_100037703 | Ga0068853_1000377032 | 423 |
| 59 | 3300005616 | Ga0068852_100009461 | Ga0068852_1000094615 | 423 |
| 60 | 3300005718 | Ga0068866_10115672 | Ga0068866_101156721 | 423 |
| 61 | 3300006237 | Ga0097621_100000093 | Ga0097621_1000000933 | 423 |
| 62 | 3300006358 | Ga0068871_100000181 | Ga0068871_10000018138 | 423 |
| 63 | 3300006881 | Ga0068865_100000788 | Ga0068865_10000078815 | 423 |
| 64 | 3300009174 | Ga0105241_10001376 | Ga0105241_100013762 | 423 |
| 65 | 3300009174 | Ga0105241_10021104 | Ga0105241_100211046 | 423 |
| 66 | 3300009545 | Ga0105237_10001246 | Ga0105237_100012463 | 423 |
| 67 | 3300009545 | Ga0105237_10004430 | Ga0105237_1000443012 | 423 |
| 68 | 3300009551 | Ga0105238_10046155 | Ga0105238_100461556 | 423 |
| 69 | 3300011119 | Ga0105246_10101761 | Ga0105246_101017612 | 423 |
| 70 | 3300013104 | Ga0157370_10045710 | Ga0157370_100457104 | 423 |
| 71 | 3300013296 | Ga0157374_10000755 | Ga0157374_1000075519 | 423 |
| 72 | 3300013296 | Ga0157374_10012081 | Ga0157374_100120815 | 423 |
| 73 | 3300013308 | Ga0157375_10011368 | Ga0157375_100113684 | 423 |
| 74 | 3300013308 | Ga0157375_10061386 | Ga0157375_100613862 | 423 |
| 75 | 3300025907 | Ga0207645_10005673 | Ga0207645_100056736 | 423 |
| 76 | 3300025909 | Ga0207705_10000112 | Ga0207705_1000011225 | 423 |
| 77 | 3300025911 | Ga0207654_10016175 | Ga0207654_100161755 | 423 |
| 78 | 3300025913 | Ga0207695_10047036 | Ga0207695_100470363 | 423 |
| 79 | 3300025914 | Ga0207671_10011013 | Ga0207671_1001101310 | 423 |
| 80 | 3300025914 | Ga0207671_10016803 | Ga0207671_100168034 | 423 |
| 81 | 3300025933 | Ga0207706_10000129 | Ga0207706_1000012964 | 423 |
| 82 | 3300026023 | Ga0207677_10125022 | Ga0207677_101250222 | 423 |
| 83 | 3300026089 | Ga0207648_10000241 | Ga0207648_1000024111 | 423 |
| 84 | 3300026121 | Ga0207683_10003055 | Ga0207683_100030554 | 423 |
| 85 | 3300026142 | Ga0207698_10034008 | Ga0207698_100340085 | 423 |
| 86 | 3300028379 | Ga0268266_10000095 | Ga0268266_10000095125 | 423 |
| 87 | 3300033180 | Ga0307510_10072222 | Ga0307510_100722223 | 423 |
| 88 | 3300037312 | Ga0395899_0009476 | Ga0395899_0009476_2573_3919 | 423 |
| 89 | 3300037418 | Ga0395900_0071583 | Ga0395900_0071583_1335_2681 | 423 |
| 90 | 3300038443 | Ga0395901_0009198 | Ga0395901_0009198_5809_7155 | 423 |
| 91 | iso_pu_bacteria | 2890737413 | 2890740073 | 423 |
| 92 | iso_pu_bacteria | 2896344016 | 2896347404 | 423 |
| 93 | 3300003316 | rootH1_10054365 | rootH1_100543652 | 424 |
| 94 | 3300005288 | Ga0065714_10066795 | Ga0065714_100667957 | 424 |
| 95 | 3300005563 | Ga0068855_100000009 | Ga0068855_100000009211 | 424 |
| 96 | 3300005614 | Ga0068856_100192374 | Ga0068856_1001923742 | 424 |
| 97 | 3300017792 | Ga0163161_10000085 | Ga0163161_1000008557 | 424 |
| 98 | 3300025949 | Ga0207667_10000045 | Ga0207667_1000004526 | 424 |
| 99 | 3300030742 | Ga0316183_1046144 | Ga0316183_10461448 | 424 |
| 100 | 3300030744 | Ga0316181_1057272 | Ga0316181_10572723 | 424 |
| 101 | 3300032004 | Ga0307414_10152203 | Ga0307414_101522032 | 424 |
| 102 | 3300046512 | Ga0495610_0001612 | Ga0495610_0001612_18067_19413 | 424 |
| 103 | iso_pu_bacteria | 2738543023 | 2739302467 | 424 |
| 104 | iso_pu_bacteria | 2919186247 | 2919189620 | 424 |
| 105 | iso_pu_bacteria | 2919437846 | 2919442359 | 424 |
| 106 | iso_pu_bacteria | 2939664404 | 2939667846 | 424 |
| 107 | iso_pu_bacteria | 2977232053 | 2977236842 | 424 |
| 108 | iso_pu_bacteria | 3003233435 | 3003235497 | 424 |
| 109 | 3300013104 | Ga0157370_10076971 | Ga0157370_100769712 | 425 |
| 110 | iso_pu_bacteria | 2585427687 | 2586207657 | 425 |
| 111 | iso_pu_bacteria | 2599185184 | 2599477006 | 425 |
| 112 | iso_pu_bacteria | 2738541283 | 2738757022 | 425 |
| 113 | iso_pu_bacteria | 2738541284 | 2738760359 | 425 |
| 114 | iso_pu_bacteria | 2738541302 | 2738851825 | 425 |
| 115 | iso_pu_bacteria | 2739367651 | 2739590723 | 425 |
| 116 | iso_pu_bacteria | 2739367656 | 2739617836 | 425 |
| 117 | iso_pu_bacteria | 2739367663 | 2739644216 | 425 |
| 118 | iso_pu_bacteria | 2775506987 | 2776612412 | 425 |
| 119 | iso_pu_bacteria | 2818991437 | 2819546395 | 425 |
| 120 | iso_pu_bacteria | 2842722452 | 2842725070 | 425 |
| 121 | iso_pu_bacteria | 2842909656 | 2842914236 | 425 |
| 122 | iso_pu_bacteria | 2849281842 | 2849285916 | 425 |
| 123 | iso_pu_bacteria | 2852623160 | 2852624059 | 425 |
| 124 | iso_pu_bacteria | 2852627209 | 2852630333 | 425 |
| 125 | iso_pu_bacteria | 2857627736 | 2857631098 | 425 |
| 126 | iso_pu_bacteria | 2884933994 | 2884937019 | 425 |
| 127 | iso_pu_bacteria | 2902048731 | 2902051209 | 425 |
| 128 | iso_pu_bacteria | 2904445276 | 2904448705 | 425 |
| 129 | iso_pu_bacteria | 2904780799 | 2904783621 | 425 |
| 130 | iso_pu_bacteria | 2919177583 | 2919182172 | 425 |
| 131 | iso_pu_bacteria | 2928078545 | 2928078923 | 425 |
| 132 | iso_pu_bacteria | 2928147474 | 2928148710 | 425 |
| 133 | iso_pu_bacteria | 2932082852 | 2932085577 | 425 |
| 134 | iso_pu_bacteria | 2945997725 | 2946002008 | 425 |
| 135 | iso_pu_bacteria | 2954016120 | 2954018890 | 425 |
| 136 | 3300005288 | Ga0065714_10003838 | Ga0065714_1000383810 | 426 |
| 137 | 3300025261 | Ga0209233_1021793 | Ga0209233_10217932 | 426 |
| 138 | 3300005288 | Ga0065714_10002618 | Ga0065714_1000261822 | 427 |
| 139 | 3300005288 | Ga0065714_10002669 | Ga0065714_1000266924 | 427 |
| 140 | 3300005289 | Ga0065704_10000210 | Ga0065704_1000021043 | 427 |
| 141 | 3300005289 | Ga0065704_10071313 | Ga0065704_100713138 | 427 |
| 142 | 3300006195 | Ga0075366_10000700 | Ga0075366_1000070010 | 427 |
| 143 | 3300013100 | Ga0157373_10000897 | Ga0157373_1000089714 | 427 |
| 144 | 3300013102 | Ga0157371_10000926 | Ga0157371_1000092614 | 427 |
| 145 | 3300013102 | Ga0157371_10004652 | Ga0157371_100046528 | 427 |
| 146 | 3300013104 | Ga0157370_10023916 | Ga0157370_100239162 | 427 |
| 147 | 3300014497 | Ga0182008_10000006 | Ga0182008_10000006280 | 427 |
| 148 | 3300031548 | Ga0307408_100006729 | Ga0307408_1000067292 | 427 |
| 149 | 3300031548 | Ga0307408_100011272 | Ga0307408_1000112723 | 427 |
| 150 | 3300031911 | Ga0307412_10006409 | Ga0307412_100064093 | 427 |
| 151 | 3300050493 | nmdc:mga0k408_111_c1 | nmdc:mga0k408_111_c1_22921_24396 | 427 |
| 152 | 3300053156 | Ga0500622_0001412 | Ga0500622_0001412_13082_14425 | 427 |
| 153 | iso_pu_bacteria | 8055588893 | 8055589971 | 427 |
| 154 | 3300002737 | JGI25162J39368_1000046 | JGI25162J39368_100004627 | 428 |
| 155 | 3300002737 | JGI25162J39368_1000948 | JGI25162J39368_100094812 | 428 |
| 156 | 3300003214 | JGI25165J46597_1003638 | JGI25165J46597_10036382 | 428 |
| 157 | 3300003320 | rootH2_10130860 | rootH2_101308606 | 428 |
| 158 | 3300003323 | rootH1_10010186 | rootH1_1001018617 | 428 |
| 159 | 3300005366 | Ga0070659_100053554 | Ga0070659_1000535544 | 428 |
| 160 | 3300005563 | Ga0068855_100000154 | Ga0068855_1000001544 | 428 |
| 161 | 3300005577 | Ga0068857_100065071 | Ga0068857_1000650713 | 428 |
| 162 | 3300005614 | Ga0068856_100004773 | Ga0068856_10000477315 | 428 |
| 163 | 3300005614 | Ga0068856_100199191 | Ga0068856_1001991912 | 428 |
| 164 | 3300005842 | Ga0068858_100133104 | Ga0068858_1001331042 | 428 |
| 165 | 3300006195 | Ga0075366_10000129 | Ga0075366_1000012927 | 428 |
| 166 | 3300009093 | Ga0105240_10000068 | Ga0105240_1000006851 | 428 |
| 167 | 3300009093 | Ga0105240_10029325 | Ga0105240_100293253 | 428 |
| 168 | 3300009174 | Ga0105241_10024533 | Ga0105241_100245332 | 428 |
| 169 | 3300009174 | Ga0105241_10037345 | Ga0105241_100373452 | 428 |
| 170 | 3300009545 | Ga0105237_10000274 | Ga0105237_1000027451 | 428 |
| 171 | 3300009545 | Ga0105237_10001416 | Ga0105237_1000141626 | 428 |
| 172 | 3300009545 | Ga0105237_10155160 | Ga0105237_101551602 | 428 |
| 173 | 3300010375 | Ga0105239_10000002 | Ga0105239_10000002102 | 428 |
| 174 | 3300010375 | Ga0105239_10000228 | Ga0105239_1000022824 | 428 |
| 175 | 3300010375 | Ga0105239_10005643 | Ga0105239_100056431 | 428 |
| 176 | 3300010375 | Ga0105239_10005856 | Ga0105239_100058563 | 428 |
| 177 | 3300010375 | Ga0105239_10023756 | Ga0105239_100237563 | 428 |
| 178 | 3300010375 | Ga0105239_10058117 | Ga0105239_100581174 | 428 |
| 179 | 3300013100 | Ga0157373_10005028 | Ga0157373_1000502811 | 428 |
| 180 | 3300013102 | Ga0157371_10000135 | Ga0157371_1000013598 | 428 |
| 181 | 3300013104 | Ga0157370_10004917 | Ga0157370_100049173 | 428 |
| 182 | 3300013105 | Ga0157369_10000475 | Ga0157369_1000047542 | 428 |
| 183 | 3300013307 | Ga0157372_10000061 | Ga0157372_1000006187 | 428 |
| 184 | 3300025231 | Ga0207427_100076 | Ga0207427_10007679 | 428 |
| 185 | 3300025233 | Ga0209437_100008 | Ga0209437_10000868 | 428 |
| 186 | 3300025233 | Ga0209437_100070 | Ga0209437_100070100 | 428 |
| 187 | 3300025261 | Ga0209233_1000024 | Ga0209233_1000024591 | 428 |
| 188 | 3300025272 | Ga0209455_1003554 | Ga0209455_10035544 | 428 |
| 189 | 3300025904 | Ga0207647_10000545 | Ga0207647_1000054516 | 428 |
| 190 | 3300025911 | Ga0207654_10072624 | Ga0207654_100726243 | 428 |
| 191 | 3300025913 | Ga0207695_10000131 | Ga0207695_1000013151 | 428 |
| 192 | 3300025913 | Ga0207695_10035783 | Ga0207695_100357833 | 428 |
| 193 | 3300025914 | Ga0207671_10004975 | Ga0207671_1000497511 | 428 |
| 194 | 3300025914 | Ga0207671_10006367 | Ga0207671_100063674 | 428 |
| 195 | 3300025914 | Ga0207671_10009968 | Ga0207671_100099687 | 428 |
| 196 | 3300025914 | Ga0207671_10052674 | Ga0207671_100526744 | 428 |
| 197 | 3300025949 | Ga0207667_10002915 | Ga0207667_100029158 | 428 |
| 198 | 3300026078 | Ga0207702_10085612 | Ga0207702_100856122 | 428 |
| 199 | 3300028786 | Ga0307517_10000719 | Ga0307517_1000071952 | 428 |
| 200 | 3300028794 | Ga0307515_10001923 | Ga0307515_1000192321 | 428 |
| 201 | 3300028794 | Ga0307515_10009923 | Ga0307515_100099232 | 428 |
| 202 | 3300031507 | Ga0307509_10098778 | Ga0307509_100987781 | 428 |
| 203 | 3300033179 | Ga0307507_10000510 | Ga0307507_1000051078 | 428 |
| 204 | 3300046492 | Ga0495585_0004145 | Ga0495585_0004145_7292_8761 | 428 |
| 205 | 3300046500 | Ga0495596_0013122 | Ga0495596_0013122_835_2184 | 428 |
| 206 | 3300046506 | Ga0495583_0020788 | Ga0495583_0020788_1719_3077 | 428 |
| 207 | 3300046507 | Ga0495606_0049940 | Ga0495606_0049940_338_1687 | 428 |
| 208 | 3300046513 | Ga0495616_0000533 | Ga0495616_0000533_474_1823 | 428 |
| 209 | 3300046524 | Ga0495648_0003414 | Ga0495648_0003414_9254_10723 | 428 |
| 210 | 3300046529 | Ga0495652_0082285 | Ga0495652_0082285_1231_2577 | 428 |
| 211 | 3300046558 | Ga0495633_0000097 | Ga0495633_0000097_57190_58545 | 428 |
| 212 | 3300046616 | Ga0495668_0000069 | Ga0495668_0000069_27237_28706 | 428 |
| 213 | 3300046660 | Ga0495625_0000097 | Ga0495625_0000097_57179_58648 | 428 |
| 214 | 3300046660 | Ga0495625_0002039 | Ga0495625_0002039_14633_15988 | 428 |
| 215 | 3300046660 | Ga0495625_0091799 | Ga0495625_0091799_362_1717 | 428 |
| 216 | 3300046660 | Ga0495625_0156253 | Ga0495625_0156253_12_1454 | 428 |
| 217 | 3300046665 | Ga0495661_0000997 | Ga0495661_0000997_7045_8403 | 428 |
| 218 | 3300047472 | Ga0495686_0003397 | Ga0495686_0003397_5267_6613 | 428 |
| 219 | 3300050493 | nmdc:mga0k408_209_c1 | nmdc:mga0k408_209_c1_6319_7740 | 428 |
| 220 | 3300053080 | Ga0500635_0000551 | Ga0500635_0000551_8344_9690 | 428 |
| 221 | 3300053122 | Ga0500608_001682 | Ga0500608_001682_1542_2897 | 428 |
| 222 | 3300053125 | Ga0500618_000158 | Ga0500618_000158_36457_37809 | 428 |
| 223 | 2162886007 | SwRhRL2b_contig_2014720 | SwRhRL2b_0167.00001680 | 429 |
| 224 | 3300001990 | JGI24737J22298_10002294 | JGI24737J22298_100022944 | 429 |
| 225 | 3300002067 | JGI24735J21928_10000006 | JGI24735J21928_10000006208 | 429 |
| 226 | 3300002773 | JGI25152J39213_1000049 | JGI25152J39213_100004950 | 429 |
| 227 | 3300002774 | JGI25150J39212_1000001 | JGI25150J39212_1000001423 | 429 |
| 228 | 3300003187 | JGI25151J46595_10000001 | JGI25151J46595_10000001379 | 429 |
| 229 | 3300003215 | JGI25153J46596_10000001 | JGI25153J46596_10000001268 | 429 |
| 230 | 3300005288 | Ga0065714_10005076 | Ga0065714_100050763 | 429 |
| 231 | 3300005288 | Ga0065714_10064545 | Ga0065714_1006454523 | 429 |
| 232 | 3300006195 | Ga0075366_10009269 | Ga0075366_100092695 | 429 |
| 233 | 3300009148 | Ga0105243_10000018 | Ga0105243_10000018110 | 429 |
| 234 | 3300009545 | Ga0105237_10005992 | Ga0105237_100059924 | 429 |
| 235 | 3300013102 | Ga0157371_10000016 | Ga0157371_1000001690 | 429 |
| 236 | 3300013102 | Ga0157371_10013481 | Ga0157371_100134814 | 429 |
| 237 | 3300013104 | Ga0157370_10012602 | Ga0157370_100126028 | 429 |
| 238 | 3300013104 | Ga0157370_10039225 | Ga0157370_100392256 | 429 |
| 239 | 3300013105 | Ga0157369_10000129 | Ga0157369_1000012959 | 429 |
| 240 | 3300013306 | Ga0163162_10000186 | Ga0163162_1000018627 | 429 |
| 241 | 3300013306 | Ga0163162_10027946 | Ga0163162_100279465 | 429 |
| 242 | 3300013307 | Ga0157372_10065624 | Ga0157372_100656244 | 429 |
| 243 | 3300014497 | Ga0182008_10000283 | Ga0182008_1000028323 | 429 |
| 244 | 3300014497 | Ga0182008_10012384 | Ga0182008_100123849 | 429 |
| 245 | 3300015261 | Ga0182006_1000301 | Ga0182006_100030145 | 429 |
| 246 | 3300015261 | Ga0182006_1002822 | Ga0182006_10028223 | 429 |
| 247 | 3300015261 | Ga0182006_1008558 | Ga0182006_10085585 | 429 |
| 248 | 3300015262 | Ga0182007_10000003 | Ga0182007_10000003330 | 429 |
| 249 | 3300017792 | Ga0163161_10000159 | Ga0163161_1000015950 | 429 |
| 250 | 3300017792 | Ga0163161_10047932 | Ga0163161_100479325 | 429 |
| 251 | 3300025245 | Ga0207425_1000002 | Ga0207425_1000002747 | 429 |
| 252 | 3300025258 | Ga0209129_1000002 | Ga0209129_1000002747 | 429 |
| 253 | 3300025294 | Ga0209025_1000004 | Ga0209025_1000004443 | 429 |
| 254 | 3300025297 | Ga0209758_1000006 | Ga0209758_1000006443 | 429 |
| 255 | 3300025914 | Ga0207671_10002363 | Ga0207671_100023637 | 429 |
| 256 | 3300025935 | Ga0207709_10000021 | Ga0207709_1000002186 | 429 |
| 257 | 3300028794 | Ga0307515_10042467 | Ga0307515_100424674 | 429 |
| 258 | 3300031548 | Ga0307408_100001373 | Ga0307408_10000137318 | 429 |
| 259 | 3300031731 | Ga0307405_10000003 | Ga0307405_10000003119 | 429 |
| 260 | 3300031903 | Ga0307407_10000008 | Ga0307407_1000000832 | 429 |
| 261 | 3300031911 | Ga0307412_10000055 | Ga0307412_1000005520 | 429 |
| 262 | 3300031995 | Ga0307409_100086786 | Ga0307409_1000867862 | 429 |
| 263 | 3300032002 | Ga0307416_100000009 | Ga0307416_100000009278 | 429 |
| 264 | 3300032004 | Ga0307414_10001536 | Ga0307414_1000153612 | 429 |
| 265 | 3300032004 | Ga0307414_10005470 | Ga0307414_100054703 | 429 |
| 266 | 3300046471 | Ga0495650_0000014 | Ga0495650_0000014_352389_353777 | 429 |
| 267 | 3300046492 | Ga0495585_0000081 | Ga0495585_0000081_22881_24278 | 429 |
| 268 | 3300046507 | Ga0495606_0000020 | Ga0495606_0000020_219027_220415 | 429 |
| 269 | 3300046512 | Ga0495610_0010246 | Ga0495610_0010246_119_1507 | 429 |
| 270 | 3300046513 | Ga0495616_0002796 | Ga0495616_0002796_482_1870 | 429 |
| 271 | 3300046558 | Ga0495633_0006858 | Ga0495633_0006858_731_2119 | 429 |
| 272 | 3300046558 | Ga0495633_0026078 | Ga0495633_0026078_378_1724 | 429 |
| 273 | 3300046660 | Ga0495625_0000009 | Ga0495625_0000009_273269_274657 | 429 |
| 274 | 3300046665 | Ga0495661_0074439 | Ga0495661_0074439_508_1860 | 429 |
| 275 | 3300046694 | Ga0495649_0000172 | Ga0495649_0000172_24384_25772 | 429 |
| 276 | 3300048925 | Ga0496122_0000404 | Ga0496122_0000404_86747_88060 | 429 |
| 277 | 3300048926 | Ga0496123_0001627 | Ga0496123_0001627_2751_4064 | 429 |
| 278 | 3300050493 | nmdc:mga0k408_58799_c1 | nmdc:mga0k408_58799_c1_470_1858 | 429 |
| 279 | 3300053093 | Ga0500651_0000839 | Ga0500651_0000839_3510_4832 | 429 |
| 280 | iso_pu_bacteria | 2721755487 | 2722726517 | 429 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fe2-assembly2.cif.gz_B | human dead-box rna helicase ddx5 (p68), conserved domain i in complex with adp | 0.966 | 4 | 208 |
| 4kbg-assembly1.cif.gz_A | almost closed conformation of the helicase core of the rna helicase hera | 0.9647 | 3 | 209 |
| 1qva-assembly1.cif.gz_A | yeast initiation factor 4a n-terminal domain | 0.9612 | 4 | 204 |
| 7ddx-assembly1.cif.gz_B | crystal structure of kank1 s1179f mutant in complex wtih eif4a1 | 0.961 | 2 | 207 |
| 4kbg-assembly1.cif.gz_A | almost closed conformation of the helicase core of the rna helicase hera | 0.9602 | 3 | 209 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P25888_1_211_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9816 | 3 | 208 | 3.40.50.300 |
| af_Q54CD8_165_435_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9806 | 4 | 205 | 3.40.50.300 |
| af_A3BT52_25_256_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9751 | 2 | 208 | 3.40.50.300 |
| af_P21693_1_208_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.972 | 3 | 208 | 3.40.50.300 |
| af_A0A1D6MHG8_113_357_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9704 | 11 | 205 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838TFF7-F1-model_v4 | DEAD/DEAH box helicase | 0.9809 | 22 | 195 |
GO:0003676
GO:0003724 GO:0005524 GO:0005829 |
| AF-A0A0N4XHA5-F1-model_v4 | RNA helicase (EC 3.6.4.13) | 0.9806 | 4 | 202 |
GO:0003723
GO:0003724 GO:0005524 GO:0005829 GO:0016787 |
| AF-A0A0X3P8J1-F1-model_v4 | RNA helicase (EC 3.6.4.13) | 0.9779 | 4 | 156 |
GO:0003676
GO:0003724 GO:0005524 GO:0005829 GO:0016787 |
| AF-A0A0P8LZI6-F1-model_v4 | deleted | 0.9735 | 1 | 207 |
|
| AF-A0A534HB63-F1-model_v4 | DEAD/DEAH box helicase | 0.9727 | 3 | 127 |
GO:0003676
GO:0003724 GO:0005524 GO:0005829 GO:0016787 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar