F383583

General Info

Members Datasets Scaffolds Average Seq Length
280 168 241 442

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10000700|Ga0075366_1000070010
Length 491
Sequence MGESREVRKTESRKEKEKKHSLVKKSSGLPVFPTSGLKKLSLPAMAAAFDDFNFNKQVLSAIADAGYTEPTPVQQKAIPPILNGQDVMGIAQTGTGKTAAYVLPIIMKLKYAQGEHARALIISPTRELAMQIEENVVAYSKYTDLRTVVLYGGLGPKTQIENIKKGVDIIVATPGRFMDIYLAGHIHTKPLQVLVLDEADKMMDMGFMPQINRILEIVPRKRQNLLFSATMSDKIHQLAGNFLEFPTVIEVTPQATPAQTIKQKLYYVPNVKTKINLLRRLLDEEDNAITKLIIFCKTRAVAEDVYKYLVRKYNQKEVKVLHANKGQNTRINSINSFKEDEVKILVATDVASRGIDVSNVSHVINFDVPVVYEDYVHRIGRTGRALQAGEAITFCNPTEVYYMGKIQKLIRQTVDVYPIPEGVFIEETPYEEKQDQNREIDLQKRKEDPDFKGAFHEKKTMSQHKKFDAKKLKANPRLGSKNPTKKFKKKH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
5 2738541283 Pedobacter sp. OK701 Isolate Unclassified
6 2738541284 Pedobacter sp. YR016 Isolate Unclassified
7 2738541302 Pedobacter sp. CF074 Isolate Unclassified
8 2738543023 Pedobacter sp. OK628 Isolate Unclassified
9 2739367651 Pedobacter sp. OK291 Isolate Unclassified
10 2739367656 Pedobacter sp. CF523 Isolate Unclassified
11 2739367663 Pedobacter sp. YR510 Isolate Unclassified
12 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
13 2818991437 Pedobacter terrae 518 Isolate Unclassified
14 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
15 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
16 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
17 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
18 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
19 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
20 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
21 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
22 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
23 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
24 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
25 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
26 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
27 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
28 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
29 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
30 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
31 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
32 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
33 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
34 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
35 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
36 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
37 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
38 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
39 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
40 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
41 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
42 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
43 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
44 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
45 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
46 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
47 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
48 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
49 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
50 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
51 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
52 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
53 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
54 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
55 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
56 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
57 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
96 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
123 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
124 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
125 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
126 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
149 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
160 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
161 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
164 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
165 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
166 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
167 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
168 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.07
Metatranscriptomes 0
Isolates 13.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.36
Nodule 0
Rhizoplane 0.36
Rhizosphere 76.43
Stem 0
Stem Tuber 0
Unclassified 12.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2014720 2162886007 Bacteria 5060
2 JGI24737J22298_10002294 3300001990 Bacteria 6798
3 JGI24735J21928_10000006 3300002067 Bacteria 339303
4 JGI24744J21845_10008743 3300002077 Bacteria 2081
5 JGI25162J39368_1000046 3300002737 Bacteria 169695
6 JGI25162J39368_1000948 3300002737 Bacteria 18580
7 JGI25152J39213_1000049 3300002773 Bacteria 83240
8 JGI25150J39212_1000001 3300002774 Bacteria 1318726
9 JGI25151J46595_10000001 3300003187 Bacteria 887211
10 JGI25165J46597_1003638 3300003214 Bacteria 3701
11 JGI25153J46596_10000001 3300003215 Bacteria 748985
12 rootH1_10054365 3300003316 Bacteria 1888
13 rootH2_10006566 3300003320 Bacteria 99379
14 rootH2_10130860 3300003320 Bacteria 7122
15 rootL2_10007319 3300003322 Bacteria 3096
16 rootH1_10010186 3300003323 Bacteria 30481
17 rootH1_10228380 3300003323 Bacteria 3456
18 Ga0055531_10001778 3300003794 Bacteria 15309
19 Ga0065714_10002618 3300005288 Bacteria 39500
20 Ga0065714_10002669 3300005288 Bacteria 17643
21 Ga0065714_10003838 3300005288 Bacteria 17859
22 Ga0065714_10005076 3300005288 Bacteria 5339
23 Ga0065714_10064545 3300005288 Bacteria 38585
24 Ga0065714_10066795 3300005288 Bacteria 6289
25 Ga0065704_10000210 3300005289 Bacteria 93612
26 Ga0065704_10071313 3300005289 Bacteria 11797
27 Ga0065704_10080129 3300005289 Bacteria 4003
28 Ga0070658_10000079 3300005327 Bacteria 90829
29 Ga0070676_10002652 3300005328 Bacteria 9219
30 Ga0070671_100005273 3300005355 Bacteria 10308
31 Ga0070659_100000675 3300005366 Bacteria 24835
32 Ga0070659_100053554 3300005366 Bacteria 3176
33 Ga0070659_100114830 3300005366 Bacteria 2176
34 Ga0070678_100007130 3300005456 Bacteria 6608
35 Ga0070662_100000030 3300005457 Bacteria 81418
36 Ga0068867_100003022 3300005459 Bacteria 11861
37 Ga0068853_100020413 3300005539 Bacteria 5510
38 Ga0068853_100037703 3300005539 Bacteria 4114
39 Ga0070665_100000083 3300005548 Bacteria 181044
40 Ga0068855_100000009 3300005563 Bacteria 246035
41 Ga0068855_100000154 3300005563 Bacteria 87746
42 Ga0068855_100039172 3300005563 Bacteria 5626
43 Ga0068857_100065071 3300005577 Bacteria 3241
44 Ga0068856_100000619 3300005614 Bacteria 38918
45 Ga0068856_100004773 3300005614 Bacteria 13436
46 Ga0068856_100192374 3300005614 Bacteria 2054
47 Ga0068856_100199191 3300005614 Bacteria 2017
48 Ga0068852_100009461 3300005616 Bacteria 7239
49 Ga0068866_10115672 3300005718 Bacteria 1503
50 Ga0068858_100133104 3300005842 Bacteria 2332
51 Ga0075366_10000129 3300006195 Bacteria 31405
52 Ga0075366_10000700 3300006195 Bacteria 15874
53 Ga0075366_10009269 3300006195 Bacteria 5496
54 Ga0097621_100000093 3300006237 Bacteria 49437
55 Ga0068871_100000181 3300006358 Bacteria 42792
56 Ga0068865_100000788 3300006881 Bacteria 17830
57 Ga0105240_10000068 3300009093 Bacteria 207756
58 Ga0105240_10003528 3300009093 Bacteria 24266
59 Ga0105240_10029325 3300009093 Bacteria 7172
60 Ga0105240_10132874 3300009093 Bacteria 2983
61 Ga0105243_10000018 3300009148 Bacteria 227618
62 Ga0105241_10001376 3300009174 Bacteria 18545
63 Ga0105241_10021104 3300009174 Bacteria 4815
64 Ga0105241_10024533 3300009174 Bacteria 4477
65 Ga0105241_10037345 3300009174 Bacteria 3659
66 Ga0105237_10000274 3300009545 Bacteria 72354
67 Ga0105237_10001246 3300009545 Bacteria 33969
68 Ga0105237_10001416 3300009545 Bacteria 31687
69 Ga0105237_10004430 3300009545 Bacteria 16270
70 Ga0105237_10005992 3300009545 Bacteria 13611
71 Ga0105237_10155160 3300009545 Bacteria 2286
72 Ga0105238_10046155 3300009551 Bacteria 4398
73 Ga0105239_10000002 3300010375 Bacteria 610298
74 Ga0105239_10000228 3300010375 Bacteria 82820
75 Ga0105239_10005643 3300010375 Bacteria 14625
76 Ga0105239_10005856 3300010375 Bacteria 14331
77 Ga0105239_10023756 3300010375 Bacteria 6750
78 Ga0105239_10058117 3300010375 Bacteria 4243
79 Ga0105246_10101761 3300011119 Bacteria 2093
80 Ga0157373_10000249 3300013100 Bacteria 44077
81 Ga0157373_10000897 3300013100 Bacteria 23049
82 Ga0157373_10004803 3300013100 Bacteria 10170
83 Ga0157373_10005028 3300013100 Bacteria 9932
84 Ga0157371_10000016 3300013102 Bacteria 330495
85 Ga0157371_10000135 3300013102 Bacteria 107607
86 Ga0157371_10000926 3300013102 Bacteria 32870
87 Ga0157371_10004652 3300013102 Bacteria 11883
88 Ga0157371_10013481 3300013102 Bacteria 6205
89 Ga0157371_10024380 3300013102 Bacteria 4418
90 Ga0157370_10000350 3300013104 Bacteria 58500
91 Ga0157370_10004917 3300013104 Bacteria 15134
92 Ga0157370_10012602 3300013104 Bacteria 8762
93 Ga0157370_10023916 3300013104 Bacteria 6058
94 Ga0157370_10039225 3300013104 Bacteria 4577
95 Ga0157370_10045710 3300013104 Bacteria 4200
96 Ga0157370_10076971 3300013104 Bacteria 3143
97 Ga0157369_10000129 3300013105 Bacteria 108473
98 Ga0157369_10000475 3300013105 Bacteria 53219
99 Ga0157374_10000755 3300013296 Bacteria 28230
100 Ga0157374_10012081 3300013296 Bacteria 7498
101 Ga0163162_10000186 3300013306 Bacteria 57565
102 Ga0163162_10000399 3300013306 Bacteria 39845
103 Ga0163162_10014175 3300013306 Bacteria 7790
104 Ga0163162_10027946 3300013306 Bacteria 5580
105 Ga0157372_10000017 3300013307 Bacteria 219543
106 Ga0157372_10000061 3300013307 Bacteria 119814
107 Ga0157372_10004976 3300013307 Bacteria 14115
108 Ga0157372_10065624 3300013307 Bacteria 4076
109 Ga0157375_10011368 3300013308 Bacteria 7859
110 Ga0157375_10061386 3300013308 Bacteria 3732
111 Ga0182008_10000006 3300014497 Bacteria 378521
112 Ga0182008_10000283 3300014497 Bacteria 39715
113 Ga0182008_10005721 3300014497 Bacteria 7039
114 Ga0182008_10012384 3300014497 Bacteria 4503
115 Ga0182006_1000301 3300015261 Bacteria 43124
116 Ga0182006_1002822 3300015261 Bacteria 9265
117 Ga0182006_1008558 3300015261 Bacteria 4637
118 Ga0182007_10000003 3300015262 Bacteria 548244
119 Ga0163161_10000074 3300017792 Bacteria 101784
120 Ga0163161_10000085 3300017792 Bacteria 93534
121 Ga0163161_10000159 3300017792 Bacteria 62460
122 Ga0163161_10047932 3300017792 Bacteria 3085
123 Ga0207427_100076 3300025231 Bacteria 149885
124 Ga0209437_100008 3300025233 Bacteria 921142
125 Ga0209437_100070 3300025233 Bacteria 306718
126 Ga0207425_1000002 3300025245 Bacteria 1362590
127 Ga0209129_1000002 3300025258 Bacteria 1359086
128 Ga0209233_1000024 3300025261 Bacteria 695418
129 Ga0209233_1021793 3300025261 Bacteria 1650
130 Ga0209455_1003554 3300025272 Bacteria 5454
131 Ga0209025_1000004 3300025294 Bacteria 1361782
132 Ga0209758_1000006 3300025297 Bacteria 1359562
133 Ga0207647_10000448 3300025904 Bacteria 33476
134 Ga0207647_10000545 3300025904 Bacteria 30015
135 Ga0207645_10005673 3300025907 Bacteria 9016
136 Ga0207705_10000112 3300025909 Bacteria 90821
137 Ga0207654_10016175 3300025911 Bacteria 3880
138 Ga0207654_10072624 3300025911 Bacteria 2049
139 Ga0207695_10000131 3300025913 Bacteria 223762
140 Ga0207695_10035783 3300025913 Bacteria 5378
141 Ga0207695_10047036 3300025913 Bacteria 4569
142 Ga0207671_10002363 3300025914 Bacteria 20310
143 Ga0207671_10004975 3300025914 Bacteria 12451
144 Ga0207671_10006367 3300025914 Bacteria 10528
145 Ga0207671_10009968 3300025914 Bacteria 7892
146 Ga0207671_10011013 3300025914 Bacteria 7404
147 Ga0207671_10016803 3300025914 Bacteria 5672
148 Ga0207671_10052674 3300025914 Bacteria 3015
149 Ga0207687_10014842 3300025927 Bacteria 5101
150 Ga0207690_10000439 3300025932 Bacteria 27079
151 Ga0207706_10000129 3300025933 Bacteria 81280
152 Ga0207709_10000021 3300025935 Bacteria 386722
153 Ga0207667_10000045 3300025949 Bacteria 246053
154 Ga0207667_10002915 3300025949 Bacteria 21237
155 Ga0207667_10009137 3300025949 Bacteria 11708
156 Ga0207677_10125022 3300026023 Bacteria 1942
157 Ga0207639_10023075 3300026041 Bacteria 4489
158 Ga0207702_10000899 3300026078 Bacteria 30910
159 Ga0207702_10085612 3300026078 Bacteria 2747
160 Ga0207648_10000241 3300026089 Bacteria 58974
161 Ga0207683_10003055 3300026121 Bacteria 14640
162 Ga0207698_10034008 3300026142 Bacteria 3711
163 Ga0207698_10085642 3300026142 Bacteria 2560
164 Ga0268266_10000095 3300028379 Bacteria 186169
165 Ga0307517_10000719 3300028786 Bacteria 56987
166 Ga0307515_10001923 3300028794 Bacteria 46075
167 Ga0307515_10009923 3300028794 Bacteria 18332
168 Ga0307515_10042467 3300028794 Bacteria 7111
169 Ga0316177_1212624 3300030731 Bacteria 8351
170 Ga0316176_1199340 3300030732 Bacteria 7919
171 Ga0316183_1046144 3300030742 Bacteria 19599
172 Ga0316181_1057272 3300030744 Bacteria 9497
173 Ga0307509_10031108 3300031507 Bacteria 5897
174 Ga0307509_10098778 3300031507 Bacteria 2962
175 Ga0307408_100001373 3300031548 Bacteria 18154
176 Ga0307408_100006729 3300031548 Bacteria 7620
177 Ga0307408_100011272 3300031548 Bacteria 5903
178 Ga0307405_10000003 3300031731 Bacteria 569064
179 Ga0307407_10000008 3300031903 Bacteria 191228
180 Ga0307412_10000055 3300031911 Bacteria 147100
181 Ga0307412_10006409 3300031911 Bacteria 6654
182 Ga0307409_100086786 3300031995 Bacteria 2548
183 Ga0307416_100000009 3300032002 Bacteria 374271
184 Ga0307414_10001536 3300032004 Bacteria 12011
185 Ga0307414_10005470 3300032004 Bacteria 6999
186 Ga0307414_10026129 3300032004 Bacteria 3753
187 Ga0307414_10152203 3300032004 Bacteria 1826
188 Ga0307507_10000510 3300033179 Bacteria 81853
189 Ga0307510_10072222 3300033180 Bacteria 3430
190 Ga0395899_0000033 3300037312 Bacteria 306589
191 Ga0395899_0000382 3300037312 Bacteria 52888
192 Ga0395899_0009476 3300037312 Bacteria 7475
193 Ga0395900_0000362 3300037418 Bacteria 65661
194 Ga0395900_0071583 3300037418 Bacteria 3564
195 Ga0395905_0001575 3300037471 Bacteria 27234
196 Ga0395901_0009198 3300038443 Bacteria 10010
197 Ga0395901_0014855 3300038443 Bacteria 7912
198 Ga0466969_0061178 3300044656 Bacteria 1830
199 Ga0466966_0041884 3300044684 Bacteria 2941
200 Ga0466959_0103951 3300045049 Bacteria 2032
201 Ga0495650_0000014 3300046471 Bacteria 581606
202 Ga0495585_0000081 3300046492 Bacteria 99243
203 Ga0495585_0004145 3300046492 Bacteria 9485
204 Ga0495596_0013122 3300046500 Bacteria 3524
205 Ga0495583_0020788 3300046506 Bacteria 3390
206 Ga0495606_0000020 3300046507 Bacteria 274490
207 Ga0495606_0049940 3300046507 Bacteria 2740
208 Ga0495610_0001612 3300046512 Bacteria 19839
209 Ga0495610_0010246 3300046512 Bacteria 5842
210 Ga0495616_0000533 3300046513 Bacteria 28740
211 Ga0495616_0002796 3300046513 Bacteria 11393
212 Ga0495631_0083885 3300046518 Bacteria 1373
213 Ga0495648_0003414 3300046524 Bacteria 13959
214 Ga0495652_0082285 3300046529 Bacteria 2654
215 Ga0495633_0000097 3300046558 Bacteria 117316
216 Ga0495633_0006858 3300046558 Bacteria 6670
217 Ga0495633_0026078 3300046558 Bacteria 2871
218 Ga0495668_0000069 3300046616 Bacteria 174287
219 Ga0495625_0000009 3300046660 Bacteria 404954
220 Ga0495625_0000097 3300046660 Bacteria 141191
221 Ga0495625_0002039 3300046660 Bacteria 22734
222 Ga0495625_0091799 3300046660 Bacteria 2099
223 Ga0495625_0156253 3300046660 Bacteria 1530
224 Ga0495661_0000997 3300046665 Bacteria 25537
225 Ga0495661_0074439 3300046665 Bacteria 1976
226 Ga0495649_0000172 3300046694 Bacteria 56537
227 Ga0495686_0002807 3300047472 Bacteria 15809
228 Ga0495686_0003397 3300047472 Bacteria 13853
229 Ga0496117_0001260 3300048920 Bacteria 37607
230 Ga0496122_0000404 3300048925 Bacteria 91618
231 Ga0496122_0004732 3300048925 Bacteria 16698
232 Ga0496123_0001627 3300048926 Bacteria 30246
233 Ga0496123_0041356 3300048926 Bacteria 3197
234 nmdc:mga0k408_111_c1 3300050493 Bacteria 39614
235 nmdc:mga0k408_209_c1 3300050493 Bacteria 27944
236 nmdc:mga0k408_58799_c1 3300050493 Bacteria 2233
237 Ga0500635_0000551 3300053080 Bacteria 10027
238 Ga0500651_0000839 3300053093 Bacteria 15089
239 Ga0500608_001682 3300053122 Bacteria 7929
240 Ga0500618_000158 3300053125 Bacteria 56115
241 Ga0500622_0001412 3300053156 Bacteria 19356

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014497 Ga0182008_10005721 Ga0182008_100057211 367
2 3300046518 Ga0495631_0083885 Ga0495631_0083885_120_1340 385
3 3300005366 Ga0070659_100000675 Ga0070659_1000006755 402
4 3300025932 Ga0207690_10000439 Ga0207690_100004393 402
5 3300025904 Ga0207647_10000448 Ga0207647_1000044812 410
6 3300005614 Ga0068856_100000619 Ga0068856_10000061928 414
7 3300013100 Ga0157373_10000249 Ga0157373_1000024927 414
8 3300013306 Ga0163162_10000399 Ga0163162_1000039913 414
9 3300013307 Ga0157372_10004976 Ga0157372_1000497612 414
10 3300026078 Ga0207702_10000899 Ga0207702_1000089912 414
11 3300032004 Ga0307414_10026129 Ga0307414_100261292 414
12 3300037418 Ga0395900_0000362 Ga0395900_0000362_25986_27350 414
13 3300013100 Ga0157373_10004803 Ga0157373_100048035 415
14 3300037312 Ga0395899_0000382 Ga0395899_0000382_30612_31967 415
15 3300003322 rootL2_10007319 rootL2_100073192 416
16 3300003323 rootH1_10228380 rootH1_102283802 416
17 3300013104 Ga0157370_10000350 Ga0157370_1000035013 416
18 3300025927 Ga0207687_10014842 Ga0207687_100148423 416
19 3300031507 Ga0307509_10031108 Ga0307509_100311085 416
20 3300037471 Ga0395905_0001575 Ga0395905_0001575_2838_4319 416
21 3300038443 Ga0395901_0014855 Ga0395901_0014855_6405_7886 416
22 3300037312 Ga0395899_0000033 Ga0395899_0000033_225958_227298 417
23 3300003794 Ga0055531_10001778 Ga0055531_100017787 418
24 3300005539 Ga0068853_100020413 Ga0068853_1000204132 418
25 3300030731 Ga0316177_1212624 Ga0316177_12126245 418
26 3300030732 Ga0316176_1199340 Ga0316176_11993404 418
27 3300003320 rootH2_10006566 rootH2_1000656682 419
28 3300005289 Ga0065704_10080129 Ga0065704_100801292 419
29 3300009093 Ga0105240_10132874 Ga0105240_101328743 419
30 3300017792 Ga0163161_10000074 Ga0163161_1000007469 419
31 3300026041 Ga0207639_10023075 Ga0207639_100230752 419
32 iso_pu_bacteria 2898713307 2898716625 419
33 3300005563 Ga0068855_100039172 Ga0068855_1000391722 420
34 3300025949 Ga0207667_10009137 Ga0207667_100091371 420
35 3300047472 Ga0495686_0002807 Ga0495686_0002807_11705_13066 420
36 iso_pu_bacteria 2842903701 2842903907 420
37 3300013102 Ga0157371_10024380 Ga0157371_100243805 421
38 3300013306 Ga0163162_10014175 Ga0163162_100141756 421
39 3300013307 Ga0157372_10000017 Ga0157372_10000017193 421
40 3300026142 Ga0207698_10085642 Ga0207698_100856421 421
41 3300044656 Ga0466969_0061178 Ga0466969_0061178_23_1378 421
42 3300044684 Ga0466966_0041884 Ga0466966_0041884_1150_2505 421
43 3300045049 Ga0466959_0103951 Ga0466959_0103951_163_1518 421
44 iso_pu_bacteria 2896317667 2896319421 421
45 3300005548 Ga0070665_100000083 Ga0070665_100000083121 422
46 3300009093 Ga0105240_10003528 Ga0105240_1000352811 422
47 3300048920 Ga0496117_0001260 Ga0496117_0001260_32935_34365 422
48 3300048925 Ga0496122_0004732 Ga0496122_0004732_14483_15913 422
49 3300048926 Ga0496123_0041356 Ga0496123_0041356_1308_2738 422
50 3300002077 JGI24744J21845_10008743 JGI24744J21845_100087432 423
51 3300005327 Ga0070658_10000079 Ga0070658_1000007925 423
52 3300005328 Ga0070676_10002652 Ga0070676_100026528 423
53 3300005355 Ga0070671_100005273 Ga0070671_1000052737 423
54 3300005366 Ga0070659_100114830 Ga0070659_1001148302 423
55 3300005456 Ga0070678_100007130 Ga0070678_1000071304 423
56 3300005457 Ga0070662_100000030 Ga0070662_10000003025 423
57 3300005459 Ga0068867_100003022 Ga0068867_1000030225 423
58 3300005539 Ga0068853_100037703 Ga0068853_1000377032 423
59 3300005616 Ga0068852_100009461 Ga0068852_1000094615 423
60 3300005718 Ga0068866_10115672 Ga0068866_101156721 423
61 3300006237 Ga0097621_100000093 Ga0097621_1000000933 423
62 3300006358 Ga0068871_100000181 Ga0068871_10000018138 423
63 3300006881 Ga0068865_100000788 Ga0068865_10000078815 423
64 3300009174 Ga0105241_10001376 Ga0105241_100013762 423
65 3300009174 Ga0105241_10021104 Ga0105241_100211046 423
66 3300009545 Ga0105237_10001246 Ga0105237_100012463 423
67 3300009545 Ga0105237_10004430 Ga0105237_1000443012 423
68 3300009551 Ga0105238_10046155 Ga0105238_100461556 423
69 3300011119 Ga0105246_10101761 Ga0105246_101017612 423
70 3300013104 Ga0157370_10045710 Ga0157370_100457104 423
71 3300013296 Ga0157374_10000755 Ga0157374_1000075519 423
72 3300013296 Ga0157374_10012081 Ga0157374_100120815 423
73 3300013308 Ga0157375_10011368 Ga0157375_100113684 423
74 3300013308 Ga0157375_10061386 Ga0157375_100613862 423
75 3300025907 Ga0207645_10005673 Ga0207645_100056736 423
76 3300025909 Ga0207705_10000112 Ga0207705_1000011225 423
77 3300025911 Ga0207654_10016175 Ga0207654_100161755 423
78 3300025913 Ga0207695_10047036 Ga0207695_100470363 423
79 3300025914 Ga0207671_10011013 Ga0207671_1001101310 423
80 3300025914 Ga0207671_10016803 Ga0207671_100168034 423
81 3300025933 Ga0207706_10000129 Ga0207706_1000012964 423
82 3300026023 Ga0207677_10125022 Ga0207677_101250222 423
83 3300026089 Ga0207648_10000241 Ga0207648_1000024111 423
84 3300026121 Ga0207683_10003055 Ga0207683_100030554 423
85 3300026142 Ga0207698_10034008 Ga0207698_100340085 423
86 3300028379 Ga0268266_10000095 Ga0268266_10000095125 423
87 3300033180 Ga0307510_10072222 Ga0307510_100722223 423
88 3300037312 Ga0395899_0009476 Ga0395899_0009476_2573_3919 423
89 3300037418 Ga0395900_0071583 Ga0395900_0071583_1335_2681 423
90 3300038443 Ga0395901_0009198 Ga0395901_0009198_5809_7155 423
91 iso_pu_bacteria 2890737413 2890740073 423
92 iso_pu_bacteria 2896344016 2896347404 423
93 3300003316 rootH1_10054365 rootH1_100543652 424
94 3300005288 Ga0065714_10066795 Ga0065714_100667957 424
95 3300005563 Ga0068855_100000009 Ga0068855_100000009211 424
96 3300005614 Ga0068856_100192374 Ga0068856_1001923742 424
97 3300017792 Ga0163161_10000085 Ga0163161_1000008557 424
98 3300025949 Ga0207667_10000045 Ga0207667_1000004526 424
99 3300030742 Ga0316183_1046144 Ga0316183_10461448 424
100 3300030744 Ga0316181_1057272 Ga0316181_10572723 424
101 3300032004 Ga0307414_10152203 Ga0307414_101522032 424
102 3300046512 Ga0495610_0001612 Ga0495610_0001612_18067_19413 424
103 iso_pu_bacteria 2738543023 2739302467 424
104 iso_pu_bacteria 2919186247 2919189620 424
105 iso_pu_bacteria 2919437846 2919442359 424
106 iso_pu_bacteria 2939664404 2939667846 424
107 iso_pu_bacteria 2977232053 2977236842 424
108 iso_pu_bacteria 3003233435 3003235497 424
109 3300013104 Ga0157370_10076971 Ga0157370_100769712 425
110 iso_pu_bacteria 2585427687 2586207657 425
111 iso_pu_bacteria 2599185184 2599477006 425
112 iso_pu_bacteria 2738541283 2738757022 425
113 iso_pu_bacteria 2738541284 2738760359 425
114 iso_pu_bacteria 2738541302 2738851825 425
115 iso_pu_bacteria 2739367651 2739590723 425
116 iso_pu_bacteria 2739367656 2739617836 425
117 iso_pu_bacteria 2739367663 2739644216 425
118 iso_pu_bacteria 2775506987 2776612412 425
119 iso_pu_bacteria 2818991437 2819546395 425
120 iso_pu_bacteria 2842722452 2842725070 425
121 iso_pu_bacteria 2842909656 2842914236 425
122 iso_pu_bacteria 2849281842 2849285916 425
123 iso_pu_bacteria 2852623160 2852624059 425
124 iso_pu_bacteria 2852627209 2852630333 425
125 iso_pu_bacteria 2857627736 2857631098 425
126 iso_pu_bacteria 2884933994 2884937019 425
127 iso_pu_bacteria 2902048731 2902051209 425
128 iso_pu_bacteria 2904445276 2904448705 425
129 iso_pu_bacteria 2904780799 2904783621 425
130 iso_pu_bacteria 2919177583 2919182172 425
131 iso_pu_bacteria 2928078545 2928078923 425
132 iso_pu_bacteria 2928147474 2928148710 425
133 iso_pu_bacteria 2932082852 2932085577 425
134 iso_pu_bacteria 2945997725 2946002008 425
135 iso_pu_bacteria 2954016120 2954018890 425
136 3300005288 Ga0065714_10003838 Ga0065714_1000383810 426
137 3300025261 Ga0209233_1021793 Ga0209233_10217932 426
138 3300005288 Ga0065714_10002618 Ga0065714_1000261822 427
139 3300005288 Ga0065714_10002669 Ga0065714_1000266924 427
140 3300005289 Ga0065704_10000210 Ga0065704_1000021043 427
141 3300005289 Ga0065704_10071313 Ga0065704_100713138 427
142 3300006195 Ga0075366_10000700 Ga0075366_1000070010 427
143 3300013100 Ga0157373_10000897 Ga0157373_1000089714 427
144 3300013102 Ga0157371_10000926 Ga0157371_1000092614 427
145 3300013102 Ga0157371_10004652 Ga0157371_100046528 427
146 3300013104 Ga0157370_10023916 Ga0157370_100239162 427
147 3300014497 Ga0182008_10000006 Ga0182008_10000006280 427
148 3300031548 Ga0307408_100006729 Ga0307408_1000067292 427
149 3300031548 Ga0307408_100011272 Ga0307408_1000112723 427
150 3300031911 Ga0307412_10006409 Ga0307412_100064093 427
151 3300050493 nmdc:mga0k408_111_c1 nmdc:mga0k408_111_c1_22921_24396 427
152 3300053156 Ga0500622_0001412 Ga0500622_0001412_13082_14425 427
153 iso_pu_bacteria 8055588893 8055589971 427
154 3300002737 JGI25162J39368_1000046 JGI25162J39368_100004627 428
155 3300002737 JGI25162J39368_1000948 JGI25162J39368_100094812 428
156 3300003214 JGI25165J46597_1003638 JGI25165J46597_10036382 428
157 3300003320 rootH2_10130860 rootH2_101308606 428
158 3300003323 rootH1_10010186 rootH1_1001018617 428
159 3300005366 Ga0070659_100053554 Ga0070659_1000535544 428
160 3300005563 Ga0068855_100000154 Ga0068855_1000001544 428
161 3300005577 Ga0068857_100065071 Ga0068857_1000650713 428
162 3300005614 Ga0068856_100004773 Ga0068856_10000477315 428
163 3300005614 Ga0068856_100199191 Ga0068856_1001991912 428
164 3300005842 Ga0068858_100133104 Ga0068858_1001331042 428
165 3300006195 Ga0075366_10000129 Ga0075366_1000012927 428
166 3300009093 Ga0105240_10000068 Ga0105240_1000006851 428
167 3300009093 Ga0105240_10029325 Ga0105240_100293253 428
168 3300009174 Ga0105241_10024533 Ga0105241_100245332 428
169 3300009174 Ga0105241_10037345 Ga0105241_100373452 428
170 3300009545 Ga0105237_10000274 Ga0105237_1000027451 428
171 3300009545 Ga0105237_10001416 Ga0105237_1000141626 428
172 3300009545 Ga0105237_10155160 Ga0105237_101551602 428
173 3300010375 Ga0105239_10000002 Ga0105239_10000002102 428
174 3300010375 Ga0105239_10000228 Ga0105239_1000022824 428
175 3300010375 Ga0105239_10005643 Ga0105239_100056431 428
176 3300010375 Ga0105239_10005856 Ga0105239_100058563 428
177 3300010375 Ga0105239_10023756 Ga0105239_100237563 428
178 3300010375 Ga0105239_10058117 Ga0105239_100581174 428
179 3300013100 Ga0157373_10005028 Ga0157373_1000502811 428
180 3300013102 Ga0157371_10000135 Ga0157371_1000013598 428
181 3300013104 Ga0157370_10004917 Ga0157370_100049173 428
182 3300013105 Ga0157369_10000475 Ga0157369_1000047542 428
183 3300013307 Ga0157372_10000061 Ga0157372_1000006187 428
184 3300025231 Ga0207427_100076 Ga0207427_10007679 428
185 3300025233 Ga0209437_100008 Ga0209437_10000868 428
186 3300025233 Ga0209437_100070 Ga0209437_100070100 428
187 3300025261 Ga0209233_1000024 Ga0209233_1000024591 428
188 3300025272 Ga0209455_1003554 Ga0209455_10035544 428
189 3300025904 Ga0207647_10000545 Ga0207647_1000054516 428
190 3300025911 Ga0207654_10072624 Ga0207654_100726243 428
191 3300025913 Ga0207695_10000131 Ga0207695_1000013151 428
192 3300025913 Ga0207695_10035783 Ga0207695_100357833 428
193 3300025914 Ga0207671_10004975 Ga0207671_1000497511 428
194 3300025914 Ga0207671_10006367 Ga0207671_100063674 428
195 3300025914 Ga0207671_10009968 Ga0207671_100099687 428
196 3300025914 Ga0207671_10052674 Ga0207671_100526744 428
197 3300025949 Ga0207667_10002915 Ga0207667_100029158 428
198 3300026078 Ga0207702_10085612 Ga0207702_100856122 428
199 3300028786 Ga0307517_10000719 Ga0307517_1000071952 428
200 3300028794 Ga0307515_10001923 Ga0307515_1000192321 428
201 3300028794 Ga0307515_10009923 Ga0307515_100099232 428
202 3300031507 Ga0307509_10098778 Ga0307509_100987781 428
203 3300033179 Ga0307507_10000510 Ga0307507_1000051078 428
204 3300046492 Ga0495585_0004145 Ga0495585_0004145_7292_8761 428
205 3300046500 Ga0495596_0013122 Ga0495596_0013122_835_2184 428
206 3300046506 Ga0495583_0020788 Ga0495583_0020788_1719_3077 428
207 3300046507 Ga0495606_0049940 Ga0495606_0049940_338_1687 428
208 3300046513 Ga0495616_0000533 Ga0495616_0000533_474_1823 428
209 3300046524 Ga0495648_0003414 Ga0495648_0003414_9254_10723 428
210 3300046529 Ga0495652_0082285 Ga0495652_0082285_1231_2577 428
211 3300046558 Ga0495633_0000097 Ga0495633_0000097_57190_58545 428
212 3300046616 Ga0495668_0000069 Ga0495668_0000069_27237_28706 428
213 3300046660 Ga0495625_0000097 Ga0495625_0000097_57179_58648 428
214 3300046660 Ga0495625_0002039 Ga0495625_0002039_14633_15988 428
215 3300046660 Ga0495625_0091799 Ga0495625_0091799_362_1717 428
216 3300046660 Ga0495625_0156253 Ga0495625_0156253_12_1454 428
217 3300046665 Ga0495661_0000997 Ga0495661_0000997_7045_8403 428
218 3300047472 Ga0495686_0003397 Ga0495686_0003397_5267_6613 428
219 3300050493 nmdc:mga0k408_209_c1 nmdc:mga0k408_209_c1_6319_7740 428
220 3300053080 Ga0500635_0000551 Ga0500635_0000551_8344_9690 428
221 3300053122 Ga0500608_001682 Ga0500608_001682_1542_2897 428
222 3300053125 Ga0500618_000158 Ga0500618_000158_36457_37809 428
223 2162886007 SwRhRL2b_contig_2014720 SwRhRL2b_0167.00001680 429
224 3300001990 JGI24737J22298_10002294 JGI24737J22298_100022944 429
225 3300002067 JGI24735J21928_10000006 JGI24735J21928_10000006208 429
226 3300002773 JGI25152J39213_1000049 JGI25152J39213_100004950 429
227 3300002774 JGI25150J39212_1000001 JGI25150J39212_1000001423 429
228 3300003187 JGI25151J46595_10000001 JGI25151J46595_10000001379 429
229 3300003215 JGI25153J46596_10000001 JGI25153J46596_10000001268 429
230 3300005288 Ga0065714_10005076 Ga0065714_100050763 429
231 3300005288 Ga0065714_10064545 Ga0065714_1006454523 429
232 3300006195 Ga0075366_10009269 Ga0075366_100092695 429
233 3300009148 Ga0105243_10000018 Ga0105243_10000018110 429
234 3300009545 Ga0105237_10005992 Ga0105237_100059924 429
235 3300013102 Ga0157371_10000016 Ga0157371_1000001690 429
236 3300013102 Ga0157371_10013481 Ga0157371_100134814 429
237 3300013104 Ga0157370_10012602 Ga0157370_100126028 429
238 3300013104 Ga0157370_10039225 Ga0157370_100392256 429
239 3300013105 Ga0157369_10000129 Ga0157369_1000012959 429
240 3300013306 Ga0163162_10000186 Ga0163162_1000018627 429
241 3300013306 Ga0163162_10027946 Ga0163162_100279465 429
242 3300013307 Ga0157372_10065624 Ga0157372_100656244 429
243 3300014497 Ga0182008_10000283 Ga0182008_1000028323 429
244 3300014497 Ga0182008_10012384 Ga0182008_100123849 429
245 3300015261 Ga0182006_1000301 Ga0182006_100030145 429
246 3300015261 Ga0182006_1002822 Ga0182006_10028223 429
247 3300015261 Ga0182006_1008558 Ga0182006_10085585 429
248 3300015262 Ga0182007_10000003 Ga0182007_10000003330 429
249 3300017792 Ga0163161_10000159 Ga0163161_1000015950 429
250 3300017792 Ga0163161_10047932 Ga0163161_100479325 429
251 3300025245 Ga0207425_1000002 Ga0207425_1000002747 429
252 3300025258 Ga0209129_1000002 Ga0209129_1000002747 429
253 3300025294 Ga0209025_1000004 Ga0209025_1000004443 429
254 3300025297 Ga0209758_1000006 Ga0209758_1000006443 429
255 3300025914 Ga0207671_10002363 Ga0207671_100023637 429
256 3300025935 Ga0207709_10000021 Ga0207709_1000002186 429
257 3300028794 Ga0307515_10042467 Ga0307515_100424674 429
258 3300031548 Ga0307408_100001373 Ga0307408_10000137318 429
259 3300031731 Ga0307405_10000003 Ga0307405_10000003119 429
260 3300031903 Ga0307407_10000008 Ga0307407_1000000832 429
261 3300031911 Ga0307412_10000055 Ga0307412_1000005520 429
262 3300031995 Ga0307409_100086786 Ga0307409_1000867862 429
263 3300032002 Ga0307416_100000009 Ga0307416_100000009278 429
264 3300032004 Ga0307414_10001536 Ga0307414_1000153612 429
265 3300032004 Ga0307414_10005470 Ga0307414_100054703 429
266 3300046471 Ga0495650_0000014 Ga0495650_0000014_352389_353777 429
267 3300046492 Ga0495585_0000081 Ga0495585_0000081_22881_24278 429
268 3300046507 Ga0495606_0000020 Ga0495606_0000020_219027_220415 429
269 3300046512 Ga0495610_0010246 Ga0495610_0010246_119_1507 429
270 3300046513 Ga0495616_0002796 Ga0495616_0002796_482_1870 429
271 3300046558 Ga0495633_0006858 Ga0495633_0006858_731_2119 429
272 3300046558 Ga0495633_0026078 Ga0495633_0026078_378_1724 429
273 3300046660 Ga0495625_0000009 Ga0495625_0000009_273269_274657 429
274 3300046665 Ga0495661_0074439 Ga0495661_0074439_508_1860 429
275 3300046694 Ga0495649_0000172 Ga0495649_0000172_24384_25772 429
276 3300048925 Ga0496122_0000404 Ga0496122_0000404_86747_88060 429
277 3300048926 Ga0496123_0001627 Ga0496123_0001627_2751_4064 429
278 3300050493 nmdc:mga0k408_58799_c1 nmdc:mga0k408_58799_c1_470_1858 429
279 3300053093 Ga0500651_0000839 Ga0500651_0000839_3510_4832 429
280 iso_pu_bacteria 2721755487 2722726517 429

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00270

DEAD

DEAD/DEAH box helicase

71

238

0.95

PF00271

Helicase_C

Helicase conserved C-terminal domain

273

386

0.95

PF04851

ResIII

Type III restriction enzyme, res subunit

67

233

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fe2-assembly2.cif.gz_B human dead-box rna helicase ddx5 (p68), conserved domain i in complex with adp 0.966 4 208
4kbg-assembly1.cif.gz_A almost closed conformation of the helicase core of the rna helicase hera 0.9647 3 209
1qva-assembly1.cif.gz_A yeast initiation factor 4a n-terminal domain 0.9612 4 204
7ddx-assembly1.cif.gz_B crystal structure of kank1 s1179f mutant in complex wtih eif4a1 0.961 2 207
4kbg-assembly1.cif.gz_A almost closed conformation of the helicase core of the rna helicase hera 0.9602 3 209
ID Description Score Start End Superfamily
af_P25888_1_211_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9816 3 208 3.40.50.300
af_Q54CD8_165_435_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9806 4 205 3.40.50.300
af_A3BT52_25_256_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9751 2 208 3.40.50.300
af_P21693_1_208_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.972 3 208 3.40.50.300
af_A0A1D6MHG8_113_357_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9704 11 205 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A838TFF7-F1-model_v4 DEAD/DEAH box helicase 0.9809 22 195 GO:0003676
GO:0003724
GO:0005524
GO:0005829
AF-A0A0N4XHA5-F1-model_v4 RNA helicase (EC 3.6.4.13) 0.9806 4 202 GO:0003723
GO:0003724
GO:0005524
GO:0005829
GO:0016787
AF-A0A0X3P8J1-F1-model_v4 RNA helicase (EC 3.6.4.13) 0.9779 4 156 GO:0003676
GO:0003724
GO:0005524
GO:0005829
GO:0016787
AF-A0A0P8LZI6-F1-model_v4 deleted 0.9735 1 207
AF-A0A534HB63-F1-model_v4 DEAD/DEAH box helicase 0.9727 3 127 GO:0003676
GO:0003724
GO:0005524
GO:0005829
GO:0016787

Feature Viewer

pLDDT pTM Quality
81.87 0.52 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map