F383233

General Info

Members Datasets Scaffolds Average Seq Length
279 147 558 290

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0244826|Ga0466959_0244826_115_1074
Length 319
Sequence MRPLITENRLDATWLPVFFSADEAIPRLVSAESPVQCVADVHAVLGEGPVWVARETALYWLDIQGRKIFRLDSQGQRAEWPTPRRIGSLAPRRSGGFIGGTENGIAAIDPQAGRFDILFNPEEDKPGNRFNDGKLDRQGRFWAGTMDDAEKATTGTLYRIDADLSCRAIDSGYKVTNGPAFSPDGKLMYHNDSARSVTYVYDLNADGTATNRRVFLQFKDGEGHPDGMTVDADGCLWVCLWDGWAVRRYSPQGEWLETIKMPVQRPTSCTFGGRDLDRLYISSASKDLDDEARKMQPNAGALFMITPGVRGLADVPFAG

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
45 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
115 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
116 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
117 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
118 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
124 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
125 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
126 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
138 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
139 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
140 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
141 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
142 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
143 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
144 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
145 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 4.3
Rhizosphere 95.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0244826 3300045049 Bacteria 1237
2 JGI24740J21852_10047117 3300001979 Bacteria 1261
3 JGI24751J29686_10019480 3300002459 Bacteria 1405
4 Ga0070658_10019049 3300005327 Bacteria 5497
5 Ga0070658_10120871 3300005327 Bacteria 2176
6 Ga0070676_10061747 3300005328 Bacteria 2228
7 Ga0070676_10135427 3300005328 Bacteria 1562
8 Ga0070683_100495432 3300005329 Bacteria 1167
9 Ga0068868_100022300 3300005338 Bacteria 4776
10 Ga0068868_100107438 3300005338 Bacteria 2265
11 Ga0070660_100004510 3300005339 Bacteria 9625
12 Ga0070660_100116599 3300005339 Bacteria 2129
13 Ga0070660_100226620 3300005339 Bacteria 1520
14 Ga0070660_100284873 3300005339 Bacteria 1352
15 Ga0070661_100035368 3300005344 Bacteria 3627
16 Ga0070661_100050609 3300005344 Bacteria 3040
17 Ga0070668_100007660 3300005347 Bacteria 8014
18 Ga0070669_100040262 3300005353 Bacteria 3397
19 Ga0070669_100100661 3300005353 Bacteria 2179
20 Ga0070669_100403815 3300005353 Bacteria 1118
21 Ga0070675_100190130 3300005354 Bacteria 1778
22 Ga0070671_100003781 3300005355 Bacteria 11876
23 Ga0070671_100031062 3300005355 Bacteria 4411
24 Ga0070671_100088453 3300005355 Bacteria 2592
25 Ga0070671_100131190 3300005355 Bacteria 2111
26 Ga0070674_100164823 3300005356 Bacteria 1685
27 Ga0070673_100017746 3300005364 Bacteria 5070
28 Ga0070673_100078291 3300005364 Bacteria 2674
29 Ga0070659_100060457 3300005366 Bacteria 2992
30 Ga0070659_100108797 3300005366 Bacteria 2237
31 Ga0070659_100298476 3300005366 Bacteria 1343
32 Ga0070659_100344302 3300005366 Bacteria 1250
33 Ga0070667_100003528 3300005367 Bacteria 13330
34 Ga0070667_100036328 3300005367 Bacteria 4130
35 Ga0070667_100182895 3300005367 Bacteria 1854
36 Ga0070694_100018841 3300005444 Bacteria 4385
37 Ga0070663_100006862 3300005455 Bacteria 6890
38 Ga0070663_100020110 3300005455 Bacteria 4415
39 Ga0070663_100100191 3300005455 Bacteria 2161
40 Ga0070663_100303471 3300005455 Bacteria 1279
41 Ga0070662_100087724 3300005457 Bacteria 2330
42 Ga0070662_100099830 3300005457 Bacteria 2195
43 Ga0070662_100141587 3300005457 Bacteria 1864
44 Ga0068867_100028424 3300005459 Bacteria 4026
45 Ga0070679_100254026 3300005530 Bacteria 1713
46 Ga0070679_100361954 3300005530 Bacteria 1398
47 Ga0070679_100575180 3300005530 Bacteria 1070
48 Ga0068853_100092743 3300005539 Bacteria 2657
49 Ga0068853_100110128 3300005539 Bacteria 2445
50 Ga0068853_100311237 3300005539 Bacteria 1458
51 Ga0070672_100038689 3300005543 Bacteria 3647
52 Ga0070672_100489831 3300005543 Bacteria 1062
53 Ga0070695_100008351 3300005545 Bacteria 6143
54 Ga0070696_100003105 3300005546 Bacteria 11047
55 Ga0070693_100119749 3300005547 Bacteria 1631
56 Ga0068855_100534231 3300005563 Bacteria 1271
57 Ga0068855_100586295 3300005563 Bacteria 1204
58 Ga0070664_100009377 3300005564 Bacteria 7936
59 Ga0070664_100052331 3300005564 Bacteria 3458
60 Ga0070664_100333724 3300005564 Bacteria 1376
61 Ga0068854_100016808 3300005578 Bacteria 4883
62 Ga0068852_100141018 3300005616 Bacteria 2230
63 Ga0068852_100608527 3300005616 Bacteria 1097
64 Ga0068859_100022894 3300005617 Bacteria 6264
65 Ga0068859_100116252 3300005617 Bacteria 2739
66 Ga0068859_100625068 3300005617 Bacteria 1170
67 Ga0068864_100000291 3300005618 Bacteria 44522
68 Ga0068864_100001458 3300005618 Bacteria 19498
69 Ga0068861_100412131 3300005719 Bacteria 1202
70 Ga0068851_10003637 3300005834 Bacteria 6881
71 Ga0068851_10073600 3300005834 Bacteria 1772
72 Ga0068863_100000816 3300005841 Bacteria 31200
73 Ga0068863_100114124 3300005841 Bacteria 2574
74 Ga0068858_100002150 3300005842 Bacteria 19979
75 Ga0068860_100001926 3300005843 Bacteria 21977
76 Ga0068860_100017319 3300005843 Bacteria 7020
77 Ga0068860_100232816 3300005843 Bacteria 1790
78 Ga0068862_100016468 3300005844 Bacteria 6153
79 Ga0068862_100059667 3300005844 Bacteria 3276
80 Ga0097621_100107561 3300006237 Bacteria 2353
81 Ga0097621_100505714 3300006237 Bacteria 1095
82 Ga0068871_100140425 3300006358 Bacteria 2054
83 Ga0068871_100366704 3300006358 Bacteria 1277
84 Ga0068865_100005327 3300006881 Bacteria 7788
85 Ga0068865_100016371 3300006881 Bacteria 4744
86 Ga0097620_100022895 3300006931 Bacteria 6264
87 Ga0097620_100116267 3300006931 Bacteria 2739
88 Ga0097620_100625080 3300006931 Bacteria 1170
89 Ga0105251_10018248 3300009011 Bacteria 3735
90 Ga0105250_10020677 3300009092 Bacteria 2659
91 Ga0111539_10089126 3300009094 Bacteria 3625
92 Ga0105243_10114036 3300009148 Bacteria 2267
93 Ga0105241_10073410 3300009174 Bacteria 2661
94 Ga0105248_10000123 3300009177 Bacteria 89301
95 Ga0105248_10001489 3300009177 Bacteria 26067
96 Ga0105249_10081940 3300009553 Bacteria 3001
97 Ga0157373_10051806 3300013100 Bacteria 2922
98 Ga0157373_10065134 3300013100 Bacteria 2579
99 Ga0157373_10099593 3300013100 Bacteria 2045
100 Ga0157371_10029402 3300013102 Bacteria 3974
101 Ga0157370_10027228 3300013104 Bacteria 5637
102 Ga0157370_10358918 3300013104 Bacteria 1343
103 Ga0157374_10179125 3300013296 Bacteria 2070
104 Ga0157374_10183091 3300013296 Bacteria 2047
105 Ga0157378_10383703 3300013297 Bacteria 1380
106 Ga0163162_10226300 3300013306 Bacteria 2000
107 Ga0157375_10102029 3300013308 Bacteria 2953
108 Ga0157375_10114472 3300013308 Bacteria 2799
109 Ga0157375_10290682 3300013308 Bacteria 1797
110 Ga0163163_10002107 3300014325 Bacteria 16792
111 Ga0157379_10002249 3300014968 Bacteria 16076
112 Ga0207696_1024031 3300025711 Bacteria 1914
113 Ga0207680_10037306 3300025903 Bacteria 2805
114 Ga0207645_10016623 3300025907 Bacteria 4867
115 Ga0207645_10063393 3300025907 Bacteria 2362
116 Ga0207705_10006422 3300025909 Bacteria 8707
117 Ga0207705_10011481 3300025909 Bacteria 6406
118 Ga0207705_10019940 3300025909 Bacteria 4796
119 Ga0207705_10099943 3300025909 Bacteria 2133
120 Ga0207660_10479375 3300025917 Bacteria 1008
121 Ga0207657_10000267 3300025919 Bacteria 55426
122 Ga0207657_10009316 3300025919 Bacteria 9888
123 Ga0207657_10042503 3300025919 Bacteria 4009
124 Ga0207657_10072964 3300025919 Bacteria 2902
125 Ga0207657_10132061 3300025919 Bacteria 2046
126 Ga0207657_10138042 3300025919 Bacteria 1994
127 Ga0207657_10200931 3300025919 Bacteria 1603
128 Ga0207657_10251387 3300025919 Bacteria 1409
129 Ga0207652_10133361 3300025921 Bacteria 2216
130 Ga0207652_10373178 3300025921 Bacteria 1288
131 Ga0207681_10097271 3300025923 Bacteria 2115
132 Ga0207681_10290527 3300025923 Bacteria 1290
133 Ga0207694_10492308 3300025924 Bacteria 1026
134 Ga0207659_10042746 3300025926 Bacteria 3179
135 Ga0207644_10000954 3300025931 Bacteria 18456
136 Ga0207644_10020085 3300025931 Bacteria 4538
137 Ga0207644_10102729 3300025931 Bacteria 2150
138 Ga0207644_10229293 3300025931 Bacteria 1475
139 Ga0207690_10030566 3300025932 Bacteria 3437
140 Ga0207690_10164927 3300025932 Bacteria 1655
141 Ga0207690_10176131 3300025932 Bacteria 1606
142 Ga0207690_10214678 3300025932 Bacteria 1469
143 Ga0207706_10010395 3300025933 Bacteria 8502
144 Ga0207706_10062451 3300025933 Bacteria 3280
145 Ga0207706_10260468 3300025933 Bacteria 1514
146 Ga0207706_10321814 3300025933 Bacteria 1346
147 Ga0207669_10081980 3300025937 Bacteria 2069
148 Ga0207669_10217508 3300025937 Bacteria 1399
149 Ga0207691_10153581 3300025940 Bacteria 2023
150 Ga0207691_10228885 3300025940 Bacteria 1610
151 Ga0207691_10236040 3300025940 Bacteria 1582
152 Ga0207711_10000100 3300025941 Bacteria 91024
153 Ga0207711_10005132 3300025941 Bacteria 11104
154 Ga0207711_10096526 3300025941 Bacteria 2609
155 Ga0207711_10097343 3300025941 Bacteria 2598
156 Ga0207711_10247626 3300025941 Bacteria 1635
157 Ga0207689_10181318 3300025942 Bacteria 1736
158 Ga0207661_10343166 3300025944 Bacteria 1346
159 Ga0207679_10007146 3300025945 Bacteria 7071
160 Ga0207667_10190369 3300025949 Bacteria 2105
161 Ga0207651_10073858 3300025960 Bacteria 2426
162 Ga0207651_10522921 3300025960 Bacteria 1028
163 Ga0207712_10321757 3300025961 Bacteria 1276
164 Ga0207668_10000080 3300025972 Bacteria 72198
165 Ga0207668_10011413 3300025972 Bacteria 5397
166 Ga0207668_10242048 3300025972 Bacteria 1460
167 Ga0207640_10287913 3300025981 Bacteria 1294
168 Ga0207658_10003101 3300025986 Bacteria 11895
169 Ga0207658_10005467 3300025986 Bacteria 8714
170 Ga0207658_10098828 3300025986 Bacteria 2281
171 Ga0207658_10368894 3300025986 Bacteria 1254
172 Ga0207677_10216676 3300026023 Bacteria 1532
173 Ga0207703_10019609 3300026035 Bacteria 5285
174 Ga0207639_10064641 3300026041 Bacteria 2837
175 Ga0207639_10065283 3300026041 Bacteria 2825
176 Ga0207639_10520452 3300026041 Bacteria 1089
177 Ga0207678_10015898 3300026067 Bacteria 6611
178 Ga0207678_10020554 3300026067 Bacteria 5788
179 Ga0207678_10036410 3300026067 Bacteria 4283
180 Ga0207641_10000221 3300026088 Bacteria 74390
181 Ga0207648_10008887 3300026089 Bacteria 9672
182 Ga0207648_10110602 3300026089 Bacteria 2412
183 Ga0207676_10003162 3300026095 Bacteria 11751
184 Ga0207676_10023058 3300026095 Bacteria 4585
185 Ga0207674_10062411 3300026116 Bacteria 3764
186 Ga0207675_100116048 3300026118 Bacteria 2530
187 Ga0207675_100429333 3300026118 Bacteria 1306
188 Ga0207683_10064992 3300026121 Bacteria 3216
189 Ga0207698_10100364 3300026142 Bacteria 2397
190 Ga0207698_10316446 3300026142 Bacteria 1460
191 Ga0268266_10160959 3300028379 Bacteria 2031
192 Ga0268265_10002770 3300028380 Bacteria 12931
193 Ga0268265_10220436 3300028380 Bacteria 1659
194 Ga0268264_10001272 3300028381 Bacteria 23913
195 Ga0268264_10003351 3300028381 Bacteria 13846
196 Ga0268264_10049208 3300028381 Bacteria 3506
197 Ga0307408_100119598 3300031548 Bacteria 2039
198 Ga0307413_10058348 3300031824 Bacteria 2365
199 Ga0307413_10065356 3300031824 Bacteria 2265
200 Ga0307413_10106963 3300031824 Bacteria 1863
201 Ga0307410_10094739 3300031852 Bacteria 2127
202 Ga0307410_10154045 3300031852 Bacteria 1714
203 Ga0307410_10251760 3300031852 Bacteria 1373
204 Ga0307410_10252280 3300031852 Bacteria 1372
205 Ga0307406_10053713 3300031901 Bacteria 2567
206 Ga0307406_10122632 3300031901 Bacteria 1810
207 Ga0307406_10134605 3300031901 Bacteria 1740
208 Ga0307407_10203087 3300031903 Bacteria 1329
209 Ga0307409_100006386 3300031995 Bacteria 6921
210 Ga0307409_100135046 3300031995 Bacteria 2115
211 Ga0307409_100139133 3300031995 Bacteria 2088
212 Ga0307409_100196791 3300031995 Bacteria 1799
213 Ga0307409_100611494 3300031995 Bacteria 1078
214 Ga0307416_100001051 3300032002 Bacteria 14704
215 Ga0307414_10056260 3300032004 Bacteria 2758
216 Ga0307414_10102893 3300032004 Bacteria 2153
217 Ga0307414_10291195 3300032004 Bacteria 1376
218 Ga0307411_10030684 3300032005 Bacteria 3298
219 Ga0307411_10038930 3300032005 Bacteria 3004
220 Ga0307411_10091737 3300032005 Bacteria 2122
221 Ga0307411_10173851 3300032005 Bacteria 1627
222 Ga0307411_10245888 3300032005 Bacteria 1403
223 Ga0307415_100385332 3300032126 Bacteria 1192
224 Ga0395899_0005357 3300037312 Bacteria 9967
225 Ga0395900_0000447 3300037418 Bacteria 59069
226 Ga0395898_0005900 3300037466 Bacteria 13169
227 Ga0395898_0008790 3300037466 Bacteria 10643
228 Ga0395898_0165010 3300037466 Bacteria 2118
229 Ga0395905_0000974 3300037471 Bacteria 36725
230 Ga0395905_0028956 3300037471 Bacteria 5220
231 Ga0395905_0081425 3300037471 Bacteria 3034
232 Ga0395905_0150459 3300037471 Bacteria 2190
233 Ga0395905_0173985 3300037471 Bacteria 2022
234 Ga0395901_0000324 3300038443 Bacteria 59134
235 Ga0395901_0099105 3300038443 Bacteria 3055
236 Ga0395901_0251129 3300038443 Bacteria 1842
237 Ga0439432_018925 3300042006 Bacteria 2298
238 Ga0450917_000833 3300042120 Bacteria 2269
239 Ga0450890_007322 3300042127 Bacteria 1409
240 Ga0450905_002764 3300042142 Bacteria 2274
241 Ga0450889_000635 3300042144 Bacteria 3884
242 Ga0466963_0062116 3300044694 Bacteria 2499
243 Ga0466970_0039058 3300044765 Bacteria 2519
244 Ga0466958_0113642 3300045836 Bacteria 1691
245 Ga0466967_0047831 3300045976 Bacteria 3731
246 Ga0466967_0079237 3300045976 Bacteria 2961
247 Ga0466967_0091727 3300045976 Bacteria 2761
248 Ga0466967_0245065 3300045976 Bacteria 1710
249 Ga0495663_0011388 3300046525 Bacteria 2475
250 Ga0495642_0082917 3300046528 Bacteria 1352
251 Ga0495621_0038545 3300046539 Bacteria 1668
252 Ga0495669_0029822 3300046684 Bacteria 2393
253 Ga0495669_0032910 3300046684 Bacteria 2280
254 Ga0495669_0169556 3300046684 Bacteria 1038
255 Ga0495670_0130965 3300046691 Bacteria 1307
256 Ga0495677_0011983 3300047445 Bacteria 3164
257 Ga0496105_0106791 3300048908 Bacteria 2311
258 Ga0496107_0067643 3300048910 Bacteria 2592
259 Ga0496108_0021480 3300048911 Bacteria 5305
260 Ga0496108_0022113 3300048911 Bacteria 5228
261 Ga0496109_0003841 3300048912 Bacteria 12548
262 Ga0496109_0762982 3300048912 Bacteria 905
263 Ga0496110_0112124 3300048913 Bacteria 2452
264 Ga0496110_0120687 3300048913 Bacteria 2361
265 Ga0496112_0018585 3300048915 Bacteria 6549
266 Ga0496112_0116106 3300048915 Bacteria 2647
267 Ga0496113_0018129 3300048916 Bacteria 4899
268 Ga0496115_0000691 3300048918 Bacteria 25050
269 Ga0501250_002121 3300049680 Bacteria 1757
270 Ga0501257_029744 3300049686 Bacteria 1313
271 Ga0501221_004678 3300049704 Bacteria 2271
272 Ga0501225_0019653 3300049705 Bacteria 1869
273 Ga0501229_006556 3300049706 Bacteria 1440
274 Ga0501263_012921 3300049760 Bacteria 1052
275 Ga0501268_000563 3300049765 Bacteria 4104
276 Ga0501270_001285 3300049767 Bacteria 2368
277 Ga0501273_002790 3300049770 Bacteria 1807
278 nmdc:mga08y16_103313_c1 3300050511 Bacteria 2967
279 Ga0500658_0000173 3300053134 Bacteria 30720
280 Ga0466959_0244826
281 JGI24740J21852_10047117
282 JGI24751J29686_10019480
283 Ga0070658_10019049
284 Ga0070658_10120871
285 Ga0070676_10061747
286 Ga0070676_10135427
287 Ga0070683_100495432
288 Ga0068868_100022300
289 Ga0068868_100107438
290 Ga0070660_100004510
291 Ga0070660_100116599
292 Ga0070660_100226620
293 Ga0070660_100284873
294 Ga0070661_100035368
295 Ga0070661_100050609
296 Ga0070668_100007660
297 Ga0070669_100040262
298 Ga0070669_100100661
299 Ga0070669_100403815
300 Ga0070675_100190130
301 Ga0070671_100003781
302 Ga0070671_100031062
303 Ga0070671_100088453
304 Ga0070671_100131190
305 Ga0070674_100164823
306 Ga0070673_100017746
307 Ga0070673_100078291
308 Ga0070659_100060457
309 Ga0070659_100108797
310 Ga0070659_100298476
311 Ga0070659_100344302
312 Ga0070667_100003528
313 Ga0070667_100036328
314 Ga0070667_100182895
315 Ga0070694_100018841
316 Ga0070663_100006862
317 Ga0070663_100020110
318 Ga0070663_100100191
319 Ga0070663_100303471
320 Ga0070662_100087724
321 Ga0070662_100099830
322 Ga0070662_100141587
323 Ga0068867_100028424
324 Ga0070679_100254026
325 Ga0070679_100361954
326 Ga0070679_100575180
327 Ga0068853_100092743
328 Ga0068853_100110128
329 Ga0068853_100311237
330 Ga0070672_100038689
331 Ga0070672_100489831
332 Ga0070695_100008351
333 Ga0070696_100003105
334 Ga0070693_100119749
335 Ga0068855_100534231
336 Ga0068855_100586295
337 Ga0070664_100009377
338 Ga0070664_100052331
339 Ga0070664_100333724
340 Ga0068854_100016808
341 Ga0068852_100141018
342 Ga0068852_100608527
343 Ga0068859_100022894
344 Ga0068859_100116252
345 Ga0068859_100625068
346 Ga0068864_100000291
347 Ga0068864_100001458
348 Ga0068861_100412131
349 Ga0068851_10003637
350 Ga0068851_10073600
351 Ga0068863_100000816
352 Ga0068863_100114124
353 Ga0068858_100002150
354 Ga0068860_100001926
355 Ga0068860_100017319
356 Ga0068860_100232816
357 Ga0068862_100016468
358 Ga0068862_100059667
359 Ga0097621_100107561
360 Ga0097621_100505714
361 Ga0068871_100140425
362 Ga0068871_100366704
363 Ga0068865_100005327
364 Ga0068865_100016371
365 Ga0097620_100022895
366 Ga0097620_100116267
367 Ga0097620_100625080
368 Ga0105251_10018248
369 Ga0105250_10020677
370 Ga0111539_10089126
371 Ga0105243_10114036
372 Ga0105241_10073410
373 Ga0105248_10000123
374 Ga0105248_10001489
375 Ga0105249_10081940
376 Ga0157373_10051806
377 Ga0157373_10065134
378 Ga0157373_10099593
379 Ga0157371_10029402
380 Ga0157370_10027228
381 Ga0157370_10358918
382 Ga0157374_10179125
383 Ga0157374_10183091
384 Ga0157378_10383703
385 Ga0163162_10226300
386 Ga0157375_10102029
387 Ga0157375_10114472
388 Ga0157375_10290682
389 Ga0163163_10002107
390 Ga0157379_10002249
391 Ga0207696_1024031
392 Ga0207680_10037306
393 Ga0207645_10016623
394 Ga0207645_10063393
395 Ga0207705_10006422
396 Ga0207705_10011481
397 Ga0207705_10019940
398 Ga0207705_10099943
399 Ga0207660_10479375
400 Ga0207657_10000267
401 Ga0207657_10009316
402 Ga0207657_10042503
403 Ga0207657_10072964
404 Ga0207657_10132061
405 Ga0207657_10138042
406 Ga0207657_10200931
407 Ga0207657_10251387
408 Ga0207652_10133361
409 Ga0207652_10373178
410 Ga0207681_10097271
411 Ga0207681_10290527
412 Ga0207694_10492308
413 Ga0207659_10042746
414 Ga0207644_10000954
415 Ga0207644_10020085
416 Ga0207644_10102729
417 Ga0207644_10229293
418 Ga0207690_10030566
419 Ga0207690_10164927
420 Ga0207690_10176131
421 Ga0207690_10214678
422 Ga0207706_10010395
423 Ga0207706_10062451
424 Ga0207706_10260468
425 Ga0207706_10321814
426 Ga0207669_10081980
427 Ga0207669_10217508
428 Ga0207691_10153581
429 Ga0207691_10228885
430 Ga0207691_10236040
431 Ga0207711_10000100
432 Ga0207711_10005132
433 Ga0207711_10096526
434 Ga0207711_10097343
435 Ga0207711_10247626
436 Ga0207689_10181318
437 Ga0207661_10343166
438 Ga0207679_10007146
439 Ga0207667_10190369
440 Ga0207651_10073858
441 Ga0207651_10522921
442 Ga0207712_10321757
443 Ga0207668_10000080
444 Ga0207668_10011413
445 Ga0207668_10242048
446 Ga0207640_10287913
447 Ga0207658_10003101
448 Ga0207658_10005467
449 Ga0207658_10098828
450 Ga0207658_10368894
451 Ga0207677_10216676
452 Ga0207703_10019609
453 Ga0207639_10064641
454 Ga0207639_10065283
455 Ga0207639_10520452
456 Ga0207678_10015898
457 Ga0207678_10020554
458 Ga0207678_10036410
459 Ga0207641_10000221
460 Ga0207648_10008887
461 Ga0207648_10110602
462 Ga0207676_10003162
463 Ga0207676_10023058
464 Ga0207674_10062411
465 Ga0207675_100116048
466 Ga0207675_100429333
467 Ga0207683_10064992
468 Ga0207698_10100364
469 Ga0207698_10316446
470 Ga0268266_10160959
471 Ga0268265_10002770
472 Ga0268265_10220436
473 Ga0268264_10001272
474 Ga0268264_10003351
475 Ga0268264_10049208
476 Ga0307408_100119598
477 Ga0307413_10058348
478 Ga0307413_10065356
479 Ga0307413_10106963
480 Ga0307410_10094739
481 Ga0307410_10154045
482 Ga0307410_10251760
483 Ga0307410_10252280
484 Ga0307406_10053713
485 Ga0307406_10122632
486 Ga0307406_10134605
487 Ga0307407_10203087
488 Ga0307409_100006386
489 Ga0307409_100135046
490 Ga0307409_100139133
491 Ga0307409_100196791
492 Ga0307409_100611494
493 Ga0307416_100001051
494 Ga0307414_10056260
495 Ga0307414_10102893
496 Ga0307414_10291195
497 Ga0307411_10030684
498 Ga0307411_10038930
499 Ga0307411_10091737
500 Ga0307411_10173851
501 Ga0307411_10245888
502 Ga0307415_100385332
503 Ga0395899_0005357
504 Ga0395900_0000447
505 Ga0395898_0005900
506 Ga0395898_0008790
507 Ga0395898_0165010
508 Ga0395905_0000974
509 Ga0395905_0028956
510 Ga0395905_0081425
511 Ga0395905_0150459
512 Ga0395905_0173985
513 Ga0395901_0000324
514 Ga0395901_0099105
515 Ga0395901_0251129
516 Ga0439432_018925
517 Ga0450917_000833
518 Ga0450890_007322
519 Ga0450905_002764
520 Ga0450889_000635
521 Ga0466963_0062116
522 Ga0466970_0039058
523 Ga0466958_0113642
524 Ga0466967_0047831
525 Ga0466967_0079237
526 Ga0466967_0091727
527 Ga0466967_0245065
528 Ga0495663_0011388
529 Ga0495642_0082917
530 Ga0495621_0038545
531 Ga0495669_0029822
532 Ga0495669_0032910
533 Ga0495669_0169556
534 Ga0495670_0130965
535 Ga0495677_0011983
536 Ga0496105_0106791
537 Ga0496107_0067643
538 Ga0496108_0021480
539 Ga0496108_0022113
540 Ga0496109_0003841
541 Ga0496109_0762982
542 Ga0496110_0112124
543 Ga0496110_0120687
544 Ga0496112_0018585
545 Ga0496112_0116106
546 Ga0496113_0018129
547 Ga0496115_0000691
548 Ga0501250_002121
549 Ga0501257_029744
550 Ga0501221_004678
551 Ga0501225_0019653
552 Ga0501229_006556
553 Ga0501263_012921
554 Ga0501268_000563
555 Ga0501270_001285
556 Ga0501273_002790
557 nmdc:mga08y16_103313_c1
558 Ga0500658_0000173

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08450

SGL

SMP-30/Gluconolactonase/LRE-like region

45

285

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g4e-assembly1.cif.gz_A crystal structure of human senescence marker protein-30(smp30)(calcium bound) 0.9721 7 291
4gna-assembly1.cif.gz_A mouse smp30/gnl-xylitol complex 0.9662 7 291
7plc-assembly4.cif.gz_D caulobacter crescentus xylonolactonase with d-xylose, p21 space group 0.9638 7 290
2ghs-assembly1.cif.gz_A crystal structure of a calcium-binding protein, regucalcin (agr_c_1268) from agrobacterium tumefaciens str. c58 at 1.55 a resolution 0.9558 5 289
7plc-assembly4.cif.gz_D caulobacter crescentus xylonolactonase with d-xylose, p21 space group 0.9506 7 290
ID Description Score Start End Superfamily
af_Q6TLF6_1_295_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9647 7 291 2.120.10.30
2ghsA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9431 5 289 2.120.10.30
af_Q6TLF6_1_295_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9421 7 291 2.120.10.30
5xfeA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9356 7 290 2.120.10.30
af_Q54ZP3_33_320_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9278 6 291 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A7X5Y303-F1-model_v4 Sugar lactone lactonase YvrE 0.9896 6 291 GO:0004341
GO:0005509
GO:0019853
AF-A0A2D6PZI3-F1-model_v4 Gluconolaconase 0.9892 6 291 GO:0004341
GO:0005509
GO:0019853
AF-A0A7Y4J7I3-F1-model_v4 deleted 0.9888 160 291
AF-A0A520I4Q6-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9878 145 288 GO:0004341
GO:0005509
GO:0019853
AF-A0A2A5D1M4-F1-model_v4 Gluconolaconase 0.9878 125 254 GO:0004341
GO:0005509
GO:0019853

Map