F383202

General Info

Members Datasets Scaffolds Average Seq Length
279 141 274 351

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0820755|Ga0436363_0820755_1932_3101
Length 389
Sequence MIIPADPAGIPKRLEPVVHTPDLPHPADSVEAERLALSRRIARVVLAIALVALGAWILHRFLAALAWAGVLAIALWPLYRRVALALPGGKSRILAPLLVTLAVGLVFTVPFIYVAIEGAREVRIIVQFLSEAEHNGVPVPEWVSQLPVVGRAVEEWWRANLSDPNAAQELLGRINPRSVTASARLYGAEIIHRLIIFGFTLLTLFFLFRDGMLFSRQLLRVSDRLLGPDGERVGRHMVQAVLATVNGLVLVGLGEGALMGIAYIIAGLPHPVSVAALTGVLAVIPFGAPVAFGAAALYLAATGSTIAGVAVLCFGLVVVFVADHAVRPVIIGGAARLPFLWVLLGILGGLETFGIIGLFLGPAIMAALISLWRDWTELPGTGGGPLGET

Samples

Sample ID Description Type Environment
1 2643221556 Massilia sp. Root1485 Isolate Unclassified
2 2643221684 Massilia sp. Root133 Isolate Unclassified
3 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
4 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
25 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
26 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
37 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
38 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
39 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
40 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
41 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
42 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
43 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
44 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
45 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
46 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
47 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
48 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
49 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
50 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
51 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
52 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
53 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
54 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
55 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
56 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
57 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
58 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
59 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
60 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
61 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
62 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
63 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
64 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
65 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
66 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
67 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
68 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
69 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
70 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
71 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
72 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
73 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
74 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
75 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
76 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
77 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
78 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
79 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
80 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
81 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
82 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
83 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
84 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
85 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
86 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
87 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
88 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
89 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
92 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
93 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
98 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
101 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
102 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
103 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
104 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
105 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
106 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
107 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
108 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
109 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
110 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
111 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
115 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
116 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
117 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
118 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
119 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
120 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
123 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
124 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
135 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
136 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
137 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
138 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 0
Isolates 1.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.43
Nodule 0.36
Rhizoplane 4.3
Rhizosphere 85.66
Stem 0
Stem Tuber 0
Unclassified 8.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10037998 3300003322 Bacteria 2784
2 Ga0055525_1000006 3300003759 Bacteria 642912
3 Ga0070658_10301464 3300005327 Bacteria 1366
4 Ga0070680_100076362 3300005336 Bacteria 2758
5 Ga0068868_100226398 3300005338 Bacteria 1567
6 Ga0070709_10002383 3300005434 Bacteria 10178
7 Ga0070714_100021730 3300005435 Bacteria 5252
8 Ga0070713_100049280 3300005436 Unclassified 3474
9 Ga0070710_10009881 3300005437 Bacteria 4677
10 Ga0070711_100009199 3300005439 Bacteria 6073
11 Ga0070711_100052616 3300005439 Unclassified 2803
12 Ga0070681_10138870 3300005458 Bacteria 2360
13 Ga0070706_100104294 3300005467 Bacteria 2637
14 Ga0070698_100025307 3300005471 Bacteria 6185
15 Ga0070684_100278172 3300005535 Bacteria 1533
16 Ga0068855_100310599 3300005563 Bacteria 1744
17 Ga0068855_100420205 3300005563 Bacteria 1462
18 Ga0068856_100307240 3300005614 Bacteria 1604
19 Ga0081540_1005149 3300005983 Bacteria 9789
20 Ga0070717_10010692 3300006028 Bacteria 6940
21 Ga0070717_10039376 3300006028 Bacteria 3846
22 Ga0070717_10050217 3300006028 Unclassified 3427
23 Ga0070712_100010065 3300006175 Bacteria 5960
24 Ga0213872_10001516 3300021361 Bacteria 14943
25 Ga0213872_10007010 3300021361 Bacteria 5586
26 Ga0213875_10000392 3300021388 Bacteria 38933
27 Ga0213875_10002992 3300021388 Bacteria 9830
28 Ga0213875_10015366 3300021388 Bacteria 3725
29 Ga0209563_100022 3300025230 Bacteria 643318
30 Ga0209677_103600 3300025253 Bacteria 4913
31 Ga0207692_10029164 3300025898 Unclassified 2619
32 Ga0207692_10075091 3300025898 Unclassified 1792
33 Ga0207707_10271581 3300025912 Bacteria 1469
34 Ga0207693_10011799 3300025915 Bacteria 7061
35 Ga0207693_10014003 3300025915 Bacteria 6459
36 Ga0207693_10038518 3300025915 Bacteria 3764
37 Ga0207663_10009449 3300025916 Bacteria 5149
38 Ga0207700_10166620 3300025928 Unclassified 1834
39 Ga0207664_10017722 3300025929 Bacteria 5228
40 Ga0207664_10199710 3300025929 Unclassified 1725
41 Ga0207644_10176567 3300025931 Bacteria 1671
42 Ga0207648_10213439 3300026089 Bacteria 1714
43 Ga0265325_10012047 3300031241 Bacteria 4954
44 Ga0265339_10000133 3300031249 Bacteria 60726
45 Ga0265327_10014104 3300031251 Bacteria 5250
46 Ga0265313_10000491 3300031595 Bacteria 41687
47 Ga0373954_0008287 3300035118 Bacteria 4559
48 Ga0373956_0011106 3300035119 Unclassified 3708
49 Ga0373955_0008082 3300035172 Unclassified 4866
50 Ga0373933_0052609 3300035724 Bacteria 2437
51 Ga0373937_0000881 3300036401 Bacteria 25704
52 Ga0395899_0007325 3300037312 Bacteria 8534
53 Ga0395899_0031784 3300037312 Bacteria 3966
54 Ga0395900_0000242 3300037418 Bacteria 85924
55 Ga0395900_0103223 3300037418 Bacteria 2928
56 Ga0395905_0025875 3300037471 Bacteria 5530
57 Ga0436364_0510951 3300037853 Bacteria 3788
58 Ga0436364_0992577 3300037853 Bacteria 61189
59 Ga0436364_1224135 3300037853 Bacteria 88093
60 Ga0436364_1331333 3300037853 Bacteria 94585
61 Ga0395901_0076599 3300038443 Bacteria 3490
62 Ga0395901_0133735 3300038443 Bacteria 2606
63 Ga0436365_0074608 3300039437 Unclassified 1255
64 Ga0436365_0615796 3300039437 Bacteria 1816
65 Ga0436365_0970229 3300039437 Bacteria 1517
66 Ga0436360_0543923 3300039438 Bacteria 6973
67 Ga0436360_1377068 3300039438 Bacteria 1501
68 Ga0436361_0241438 3300039447 Bacteria 33856
69 Ga0436361_0736144 3300039447 Bacteria 2300
70 Ga0436361_0752633 3300039447 Bacteria 2924
71 Ga0436361_1128235 3300039447 Bacteria 1875
72 Ga0436363_0452113 3300039450 Bacteria 1634
73 Ga0436363_0600333 3300039450 Bacteria 3114
74 Ga0436363_0820755 3300039450 Bacteria 3460
75 Ga0436362_0387106 3300039453 Bacteria 3053
76 Ga0466972_0004240 3300044658 Bacteria 7167
77 Ga0466966_0066272 3300044684 Bacteria 2269
78 Ga0466968_0001152 3300044735 Bacteria 9370
79 Ga0466957_0057566 3300044842 Bacteria 2379
80 Ga0466967_0285505 3300045976 Bacteria 1584
81 Ga0495617_000004 3300046452 Bacteria 511274
82 Ga0495617_000014 3300046452 Bacteria 286979
83 Ga0495617_002043 3300046452 Bacteria 8380
84 Ga0495627_000061 3300046453 Bacteria 139366
85 Ga0495627_012363 3300046453 Bacteria 3032
86 Ga0495603_0013494 3300046455 Bacteria 4943
87 Ga0495590_0031949 3300046457 Bacteria 1842
88 Ga0495591_012615 3300046458 Bacteria 3136
89 Ga0495629_0006643 3300046459 Bacteria 8559
90 Ga0495629_0198247 3300046459 Bacteria 1388
91 Ga0495653_0000004 3300046463 Bacteria 376003
92 Ga0495653_0001498 3300046463 Bacteria 18244
93 Ga0495650_0000181 3300046471 Bacteria 137791
94 Ga0495650_0002183 3300046471 Bacteria 16549
95 Ga0495650_0028707 3300046471 Bacteria 2547
96 Ga0495650_0056256 3300046471 Bacteria 1597
97 Ga0495582_0030122 3300046473 Bacteria 2978
98 Ga0495605_0000039 3300046474 Bacteria 196802
99 Ga0495605_0001783 3300046474 Bacteria 13809
100 Ga0495605_0009567 3300046474 Bacteria 5442
101 Ga0495605_0022884 3300046474 Bacteria 3292
102 Ga0495584_0000136 3300046491 Bacteria 50554
103 Ga0495584_0000584 3300046491 Bacteria 24610
104 Ga0495584_0008170 3300046491 Bacteria 5435
105 Ga0495584_0023522 3300046491 Bacteria 3123
106 Ga0495584_0027427 3300046491 Bacteria 2886
107 Ga0495584_0036592 3300046491 Bacteria 2479
108 Ga0495584_0057763 3300046491 Bacteria 1952
109 Ga0495584_0144654 3300046491 Bacteria 1207
110 Ga0495585_0001078 3300046492 Bacteria 22503
111 Ga0495585_0001695 3300046492 Bacteria 16843
112 Ga0495585_0007298 3300046492 Bacteria 6783
113 Ga0495585_0021647 3300046492 Bacteria 3691
114 Ga0495585_0047584 3300046492 Bacteria 2388
115 Ga0495585_0053444 3300046492 Bacteria 2235
116 Ga0495585_0071928 3300046492 Bacteria 1885
117 Ga0495585_0073265 3300046492 Bacteria 1864
118 Ga0495594_0006059 3300046499 Bacteria 6213
119 Ga0495596_0003480 3300046500 Bacteria 7949
120 Ga0495596_0007740 3300046500 Bacteria 4825
121 Ga0495596_0009149 3300046500 Bacteria 4370
122 Ga0495596_0019492 3300046500 Bacteria 2786
123 Ga0495596_0028629 3300046500 Bacteria 2235
124 Ga0495596_0070062 3300046500 Bacteria 1363
125 Ga0495607_0001707 3300046501 Bacteria 18856
126 Ga0495607_0018817 3300046501 Bacteria 4393
127 Ga0495607_0020483 3300046501 Bacteria 4181
128 Ga0495583_0000102 3300046506 Bacteria 143105
129 Ga0495583_0018510 3300046506 Bacteria 3665
130 Ga0495583_0026426 3300046506 Bacteria 2878
131 Ga0495606_0016774 3300046507 Bacteria 5567
132 Ga0495606_0023852 3300046507 Bacteria 4423
133 Ga0495606_0032390 3300046507 Bacteria 3621
134 Ga0495606_0109744 3300046507 Bacteria 1666
135 Ga0495616_0006308 3300046513 Bacteria 7194
136 Ga0495616_0017967 3300046513 Bacteria 3894
137 Ga0495616_0023486 3300046513 Bacteria 3316
138 Ga0495616_0075463 3300046513 Bacteria 1622
139 Ga0495631_0004425 3300046518 Bacteria 7483
140 Ga0495631_0005874 3300046518 Bacteria 6394
141 Ga0495631_0014264 3300046518 Bacteria 3839
142 Ga0495631_0017125 3300046518 Bacteria 3434
143 Ga0495631_0017408 3300046518 Bacteria 3401
144 Ga0495631_0032361 3300046518 Bacteria 2359
145 Ga0495631_0060825 3300046518 Bacteria 1638
146 Ga0495632_0017244 3300046519 Bacteria 3992
147 Ga0495637_0031235 3300046520 Bacteria 2357
148 Ga0495637_0090540 3300046520 Bacteria 1207
149 Ga0495643_0013686 3300046522 Bacteria 4847
150 Ga0495643_0017662 3300046522 Bacteria 4165
151 Ga0495643_0018653 3300046522 Bacteria 4026
152 Ga0495643_0050114 3300046522 Bacteria 2249
153 Ga0495643_0054015 3300046522 Bacteria 2152
154 Ga0495644_0020251 3300046523 Bacteria 2538
155 Ga0495648_0011764 3300046524 Bacteria 6567
156 Ga0495648_0013138 3300046524 Bacteria 6139
157 Ga0495648_0040777 3300046524 Bacteria 2939
158 Ga0495648_0047414 3300046524 Bacteria 2656
159 Ga0495663_0009915 3300046525 Bacteria 2645
160 Ga0495666_0000384 3300046526 Bacteria 19312
161 Ga0495666_0030414 3300046526 Bacteria 2650
162 Ga0495642_0002483 3300046528 Bacteria 7501
163 Ga0495642_0016124 3300046528 Bacteria 2910
164 Ga0495642_0096719 3300046528 Bacteria 1253
165 Ga0495654_0013808 3300046530 Bacteria 4312
166 Ga0495654_0021046 3300046530 Bacteria 3396
167 Ga0495654_0105247 3300046530 Bacteria 1293
168 Ga0495665_0020805 3300046531 Bacteria 3523
169 Ga0495640_0099817 3300046533 Bacteria 1907
170 Ga0495586_0003140 3300046535 Bacteria 8886
171 Ga0495609_0004873 3300046538 Bacteria 7219
172 Ga0495609_0007136 3300046538 Bacteria 5617
173 Ga0495609_0015301 3300046538 Bacteria 3592
174 Ga0495609_0021839 3300046538 Bacteria 2952
175 Ga0495609_0055560 3300046538 Bacteria 1756
176 Ga0495597_0000171 3300046542 Bacteria 57667
177 Ga0495597_0000220 3300046542 Bacteria 52380
178 Ga0495597_0001471 3300046542 Bacteria 16883
179 Ga0495597_0001761 3300046542 Bacteria 14864
180 Ga0495597_0002860 3300046542 Bacteria 10549
181 Ga0495597_0005839 3300046542 Bacteria 6438
182 Ga0495597_0018103 3300046542 Bacteria 3309
183 Ga0495597_0020735 3300046542 Bacteria 3058
184 Ga0495597_0032984 3300046542 Bacteria 2348
185 Ga0495633_0007218 3300046558 Bacteria 6432
186 Ga0495633_0041380 3300046558 Bacteria 2191
187 Ga0495667_0031451 3300046559 Bacteria 3563
188 Ga0495656_0012094 3300046615 Bacteria 3179
189 Ga0495668_0002236 3300046616 Bacteria 16393
190 Ga0495668_0005507 3300046616 Bacteria 8545
191 Ga0495668_0005934 3300046616 Bacteria 8114
192 Ga0495668_0018555 3300046616 Bacteria 4020
193 Ga0495668_0020686 3300046616 Bacteria 3782
194 Ga0495668_0043208 3300046616 Bacteria 2508
195 Ga0495611_0007986 3300046648 Bacteria 4495
196 Ga0495611_0040695 3300046648 Bacteria 2072
197 Ga0495625_0022155 3300046660 Bacteria 4876
198 Ga0495625_0185377 3300046660 Bacteria 1381
199 Ga0495635_0022591 3300046663 Bacteria 4383
200 Ga0495659_0009901 3300046664 Bacteria 3048
201 Ga0495661_0000525 3300046665 Bacteria 39654
202 Ga0495661_0007970 3300046665 Bacteria 7354
203 Ga0495661_0013399 3300046665 Bacteria 5506
204 Ga0495588_0000296 3300046674 Bacteria 35678
205 Ga0495588_0007966 3300046674 Bacteria 4843
206 Ga0495588_0035668 3300046674 Bacteria 2521
207 Ga0495588_0135739 3300046674 Bacteria 1298
208 Ga0495623_0175953 3300046679 Bacteria 1247
209 Ga0495669_0003565 3300046684 Bacteria 6418
210 Ga0495670_0000634 3300046691 Bacteria 16822
211 Ga0495670_0008031 3300046691 Bacteria 5187
212 Ga0495670_0102688 3300046691 Bacteria 1473
213 Ga0495671_0001284 3300046692 Bacteria 17145
214 Ga0495589_0000047 3300046794 Bacteria 117810
215 Ga0495589_0009860 3300046794 Bacteria 4962
216 Ga0495660_0000170 3300046810 Bacteria 70588
217 Ga0495660_0003359 3300046810 Bacteria 9917
218 Ga0495604_0025469 3300047317 Bacteria 4714
219 Ga0495636_0002805 3300047318 Bacteria 6721
220 Ga0495672_0001814 3300047320 Bacteria 20431
221 Ga0495672_0004215 3300047320 Bacteria 11895
222 Ga0495676_0001854 3300047321 Bacteria 18552
223 Ga0495676_0030297 3300047321 Bacteria 4596
224 Ga0495676_0087725 3300047321 Bacteria 2336
225 Ga0495676_0094422 3300047321 Bacteria 2228
226 Ga0495680_0026803 3300047322 Bacteria 4745
227 Ga0495683_0052402 3300047323 Bacteria 2037
228 Ga0495683_0057251 3300047323 Bacteria 1938
229 Ga0495687_000283 3300047443 Bacteria 66901
230 Ga0495687_001268 3300047443 Bacteria 23860
231 Ga0495687_003896 3300047443 Bacteria 10463
232 Ga0495687_007319 3300047443 Bacteria 6533
233 Ga0495675_0018039 3300047444 Bacteria 4474
234 Ga0495677_0001292 3300047445 Bacteria 10007
235 Ga0495677_0004452 3300047445 Bacteria 5380
236 Ga0495677_0007406 3300047445 Bacteria 4104
237 Ga0495677_0008308 3300047445 Bacteria 3857
238 Ga0495677_0043948 3300047445 Bacteria 1638
239 Ga0495679_011004 3300047446 Bacteria 3518
240 Ga0495673_0000005 3300047469 Bacteria 943364
241 Ga0495673_0072552 3300047469 Bacteria 1444
242 Ga0495681_0003275 3300047470 Bacteria 11292
243 Ga0495681_0014445 3300047470 Bacteria 4524
244 Ga0495686_0053476 3300047472 Bacteria 2531
245 Ga0495593_0002661 3300047673 Bacteria 10744
246 Ga0495614_0002794 3300048089 Bacteria 7765
247 Ga0495626_0000047 3300048091 Bacteria 161939
248 Ga0495626_0015312 3300048091 Bacteria 3930
249 Ga0495626_0015936 3300048091 Bacteria 3834
250 Ga0496102_0000290 3300048905 Bacteria 64278
251 Ga0496102_0104660 3300048905 Bacteria 2632
252 Ga0496102_0206000 3300048905 Bacteria 1854
253 Ga0496103_0037756 3300048906 Bacteria 2961
254 Ga0496104_0373855 3300048907 Bacteria 1338
255 Ga0496105_0095122 3300048908 Bacteria 2461
256 Ga0496109_0197551 3300048912 Bacteria 1891
257 Ga0496110_0002319 3300048913 Bacteria 14225
258 Ga0496113_0050168 3300048916 Bacteria 3110
259 Ga0496115_0027377 3300048918 Bacteria 4457
260 Ga0496115_0340316 3300048918 Bacteria 1224
261 Ga0496115_0345832 3300048918 Bacteria 1213
262 Ga0496121_0082504 3300048924 Bacteria 2541
263 Ga0496121_0116467 3300048924 Bacteria 2027
264 Ga0496122_0010840 3300048925 Bacteria 9332
265 Ga0496122_0029902 3300048925 Bacteria 4579
266 Ga0496123_0017158 3300048926 Bacteria 5840
267 Ga0496124_0128750 3300048927 Bacteria 2014
268 Ga0496124_0177217 3300048927 Bacteria 1644
269 Ga0495678_000670 3300049459 Bacteria 31436
270 Ga0495678_004225 3300049459 Bacteria 8426
271 Ga0495678_009365 3300049459 Bacteria 4851
272 Ga0495682_0002085 3300049460 Bacteria 9755
273 Ga0501034_0274318 3300049571 Bacteria 1627
274 nmdc:mga0yw44_44252_c1 3300050492 Bacteria 2662

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047445 Ga0495677_0043948 Ga0495677_0043948_23_928 245
2 3300039447 Ga0436361_1128235 Ga0436361_1128235_362_1477 249
3 3300005439 Ga0070711_100052616 Ga0070711_1000526161 250
4 3300025898 Ga0207692_10075091 Ga0207692_100750911 250
5 3300025915 Ga0207693_10011799 Ga0207693_100117994 250
6 3300025916 Ga0207663_10009449 Ga0207663_100094496 250
7 3300025929 Ga0207664_10199710 Ga0207664_101997102 250
8 3300039447 Ga0436361_0736144 Ga0436361_0736144_1320_2285 256
9 3300050492 nmdc:mga0yw44_44252_c1 nmdc:mga0yw44_44252_c1_124_1293 257
10 3300046520 Ga0495637_0090540 Ga0495637_0090540_106_1182 259
11 3300046500 Ga0495596_0070062 Ga0495596_0070062_252_1295 262
12 3300021388 Ga0213875_10002992 Ga0213875_1000299210 263
13 3300037853 Ga0436364_0992577 Ga0436364_0992577_48191_49375 263
14 3300048905 Ga0496102_0104660 Ga0496102_0104660_13_1065 264
15 3300021388 Ga0213875_10000392 Ga0213875_1000039230 265
16 3300037853 Ga0436364_1331333 Ga0436364_1331333_54475_55635 265
17 3300039447 Ga0436361_0752633 Ga0436361_0752633_86_1156 265
18 3300021361 Ga0213872_10001516 Ga0213872_100015166 267
19 3300039447 Ga0436361_0241438 Ga0436361_0241438_4409_5479 267
20 3300025915 Ga0207693_10038518 Ga0207693_100385184 268
21 3300021361 Ga0213872_10007010 Ga0213872_100070103 271
22 3300045976 Ga0466967_0285505 Ga0466967_0285505_426_1502 271
23 3300047321 Ga0495676_0094422 Ga0495676_0094422_355_1419 271
24 3300039437 Ga0436365_0615796 Ga0436365_0615796_382_1566 272
25 3300039438 Ga0436360_1377068 Ga0436360_1377068_36_1199 274
26 3300005458 Ga0070681_10138870 Ga0070681_101388702 275
27 3300006028 Ga0070717_10039376 Ga0070717_100393763 275
28 3300025912 Ga0207707_10271581 Ga0207707_102715812 275
29 3300046530 Ga0495654_0013808 Ga0495654_0013808_762_1829 275
30 3300035119 Ga0373956_0011106 Ga0373956_0011106_2574_3668 276
31 3300039437 Ga0436365_0970229 Ga0436365_0970229_65_1231 277
32 3300039450 Ga0436363_0452113 Ga0436363_0452113_108_1274 277
33 3300035118 Ga0373954_0008287 Ga0373954_0008287_458_1615 280
34 3300035172 Ga0373955_0008082 Ga0373955_0008082_2767_3924 280
35 3300035724 Ga0373933_0052609 Ga0373933_0052609_846_2003 280
36 3300036401 Ga0373937_0000881 Ga0373937_0000881_15097_16254 280
37 3300046533 Ga0495640_0099817 Ga0495640_0099817_154_1311 280
38 3300046542 Ga0495597_0000220 Ga0495597_0000220_39228_40286 280
39 3300046559 Ga0495667_0031451 Ga0495667_0031451_17_1174 280
40 3300048924 Ga0496121_0082504 Ga0496121_0082504_1267_2343 280
41 3300031251 Ga0265327_10014104 Ga0265327_100141043 281
42 3300048091 Ga0495626_0015936 Ga0495626_0015936_510_1577 281
43 3300037471 Ga0395905_0025875 Ga0395905_0025875_716_1783 282
44 3300038443 Ga0395901_0076599 Ga0395901_0076599_1858_2925 282
45 3300046452 Ga0495617_000014 Ga0495617_000014_249665_250732 282
46 3300046453 Ga0495627_000061 Ga0495627_000061_10259_11326 282
47 3300046474 Ga0495605_0001783 Ga0495605_0001783_4857_5924 282
48 3300046492 Ga0495585_0007298 Ga0495585_0007298_2965_4032 282
49 3300046513 Ga0495616_0006308 Ga0495616_0006308_2736_3803 282
50 3300046518 Ga0495631_0004425 Ga0495631_0004425_3580_4647 282
51 3300046522 Ga0495643_0017662 Ga0495643_0017662_1183_2241 282
52 3300046525 Ga0495663_0009915 Ga0495663_0009915_1427_2491 282
53 3300046528 Ga0495642_0002483 Ga0495642_0002483_4196_5263 282
54 3300046538 Ga0495609_0015301 Ga0495609_0015301_603_1670 282
55 3300046615 Ga0495656_0012094 Ga0495656_0012094_377_1444 282
56 3300046616 Ga0495668_0005507 Ga0495668_0005507_4024_5091 282
57 3300046648 Ga0495611_0007986 Ga0495611_0007986_2357_3424 282
58 3300046665 Ga0495661_0007970 Ga0495661_0007970_3559_4626 282
59 3300046684 Ga0495669_0003565 Ga0495669_0003565_2127_3194 282
60 3300046692 Ga0495671_0001284 Ga0495671_0001284_11907_12974 282
61 3300046794 Ga0495589_0009860 Ga0495589_0009860_3580_4647 282
62 3300047445 Ga0495677_0004452 Ga0495677_0004452_1856_2923 282
63 3300047472 Ga0495686_0053476 Ga0495686_0053476_173_1240 282
64 3300005614 Ga0068856_100307240 Ga0068856_1003072402 283
65 3300046491 Ga0495584_0027427 Ga0495584_0027427_1491_2564 283
66 3300046491 Ga0495584_0144654 Ga0495584_0144654_94_1152 283
67 3300046492 Ga0495585_0001695 Ga0495585_0001695_7872_8945 283
68 3300046513 Ga0495616_0017967 Ga0495616_0017967_1670_2743 283
69 3300046513 Ga0495616_0023486 Ga0495616_0023486_422_1489 283
70 3300046518 Ga0495631_0005874 Ga0495631_0005874_2215_3288 283
71 3300046518 Ga0495631_0017408 Ga0495631_0017408_847_1923 283
72 3300046542 Ga0495597_0020735 Ga0495597_0020735_1642_2718 283
73 3300046558 Ga0495633_0007218 Ga0495633_0007218_2151_3224 283
74 3300046616 Ga0495668_0018555 Ga0495668_0018555_1962_3035 283
75 3300046665 Ga0495661_0000525 Ga0495661_0000525_7973_9046 283
76 3300046674 Ga0495588_0035668 Ga0495588_0035668_168_1241 283
77 3300046691 Ga0495670_0000634 Ga0495670_0000634_7851_8924 283
78 3300047321 Ga0495676_0001854 Ga0495676_0001854_3241_4314 283
79 3300047323 Ga0495683_0057251 Ga0495683_0057251_581_1648 283
80 3300047445 Ga0495677_0001292 Ga0495677_0001292_6959_8032 283
81 3300047445 Ga0495677_0008308 Ga0495677_0008308_2539_3615 283
82 3300047470 Ga0495681_0003275 Ga0495681_0003275_7977_9050 283
83 3300047470 Ga0495681_0014445 Ga0495681_0014445_1546_2613 283
84 3300048091 Ga0495626_0015312 Ga0495626_0015312_98_1174 283
85 3300049460 Ga0495682_0002085 Ga0495682_0002085_6490_7557 283
86 3300039438 Ga0436360_0543923 Ga0436360_0543923_3421_4548 284
87 3300046500 Ga0495596_0019492 Ga0495596_0019492_361_1428 284
88 3300046542 Ga0495597_0018103 Ga0495597_0018103_1265_2332 284
89 3300046492 Ga0495585_0053444 Ga0495585_0053444_601_1662 285
90 3300046660 Ga0495625_0185377 Ga0495625_0185377_261_1322 285
91 3300047443 Ga0495687_001268 Ga0495687_001268_15885_16946 285
92 3300005563 Ga0068855_100420205 Ga0068855_1004202052 286
93 3300046492 Ga0495585_0047584 Ga0495585_0047584_1102_2178 286
94 3300046500 Ga0495596_0028629 Ga0495596_0028629_747_1823 286
95 3300046507 Ga0495606_0032390 Ga0495606_0032390_131_1207 286
96 3300046519 Ga0495632_0017244 Ga0495632_0017244_2209_3285 286
97 3300047321 Ga0495676_0030297 Ga0495676_0030297_1050_2117 286
98 3300048907 Ga0496104_0373855 Ga0496104_0373855_92_1168 286
99 3300048912 Ga0496109_0197551 Ga0496109_0197551_25_1086 286
100 3300048916 Ga0496113_0050168 Ga0496113_0050168_1195_2271 286
101 3300048925 Ga0496122_0010840 Ga0496122_0010840_6327_7403 286
102 3300031241 Ga0265325_10012047 Ga0265325_100120473 287
103 3300031249 Ga0265339_10000133 Ga0265339_1000013353 287
104 3300031595 Ga0265313_10000491 Ga0265313_100004913 287
105 3300037418 Ga0395900_0103223 Ga0395900_0103223_245_1321 287
106 3300038443 Ga0395901_0133735 Ga0395901_0133735_795_1871 287
107 3300046471 Ga0495650_0028707 Ga0495650_0028707_1439_2494 287
108 3300003759 Ga0055525_1000006 Ga0055525_1000006198 288
109 3300025230 Ga0209563_100022 Ga0209563_100022197 288
110 3300025253 Ga0209677_103600 Ga0209677_1036005 288
111 3300037418 Ga0395900_0000242 Ga0395900_0000242_78269_79345 288
112 3300037853 Ga0436364_1224135 Ga0436364_1224135_73060_74163 288
113 3300046474 Ga0495605_0022884 Ga0495605_0022884_278_1336 288
114 3300046492 Ga0495585_0021647 Ga0495585_0021647_1533_2585 288
115 3300046506 Ga0495583_0018510 Ga0495583_0018510_2001_3059 288
116 3300046520 Ga0495637_0031235 Ga0495637_0031235_878_1936 288
117 3300046522 Ga0495643_0018653 Ga0495643_0018653_656_1714 288
118 3300046524 Ga0495648_0013138 Ga0495648_0013138_3311_4369 288
119 3300046530 Ga0495654_0105247 Ga0495654_0105247_62_1120 288
120 3300046616 Ga0495668_0005934 Ga0495668_0005934_3881_4939 288
121 3300046660 Ga0495625_0022155 Ga0495625_0022155_3332_4390 288
122 3300046674 Ga0495588_0135739 Ga0495588_0135739_110_1162 288
123 3300046691 Ga0495670_0008031 Ga0495670_0008031_2577_3647 288
124 3300047446 Ga0495679_011004 Ga0495679_011004_182_1240 288
125 3300049459 Ga0495678_000670 Ga0495678_000670_3147_4205 288
126 3300037312 Ga0395899_0031784 Ga0395899_0031784_244_1320 289
127 3300046501 Ga0495607_0018817 Ga0495607_0018817_12_1049 289
128 3300046501 Ga0495607_0020483 Ga0495607_0020483_3133_4170 289
129 3300046674 Ga0495588_0007966 Ga0495588_0007966_1068_2126 289
130 3300046473 Ga0495582_0030122 Ga0495582_0030122_366_1424 291
131 3300046491 Ga0495584_0008170 Ga0495584_0008170_2931_4025 291
132 3300046499 Ga0495594_0006059 Ga0495594_0006059_2326_3384 291
133 3300046526 Ga0495666_0030414 Ga0495666_0030414_204_1262 291
134 3300046538 Ga0495609_0007136 Ga0495609_0007136_931_1989 291
135 3300046542 Ga0495597_0000171 Ga0495597_0000171_52983_54041 291
136 3300046542 Ga0495597_0005839 Ga0495597_0005839_3672_4766 291
137 3300005338 Ga0068868_100226398 Ga0068868_1002263982 292
138 3300005434 Ga0070709_10002383 Ga0070709_100023834 292
139 3300005435 Ga0070714_100021730 Ga0070714_1000217304 292
140 3300005436 Ga0070713_100049280 Ga0070713_1000492804 292
141 3300005437 Ga0070710_10009881 Ga0070710_100098812 292
142 3300005439 Ga0070711_100009199 Ga0070711_1000091995 292
143 3300005467 Ga0070706_100104294 Ga0070706_1001042942 292
144 3300005471 Ga0070698_100025307 Ga0070698_1000253071 292
145 3300005535 Ga0070684_100278172 Ga0070684_1002781722 292
146 3300005983 Ga0081540_1005149 Ga0081540_10051498 292
147 3300006028 Ga0070717_10010692 Ga0070717_100106928 292
148 3300006028 Ga0070717_10050217 Ga0070717_100502173 292
149 3300006175 Ga0070712_100010065 Ga0070712_1000100655 292
150 3300021388 Ga0213875_10015366 Ga0213875_100153663 292
151 3300025898 Ga0207692_10029164 Ga0207692_100291642 292
152 3300025915 Ga0207693_10014003 Ga0207693_100140034 292
153 3300025928 Ga0207700_10166620 Ga0207700_101666201 292
154 3300025929 Ga0207664_10017722 Ga0207664_100177222 292
155 3300025931 Ga0207644_10176567 Ga0207644_101765672 292
156 3300037853 Ga0436364_0510951 Ga0436364_0510951_1373_2491 292
157 3300039437 Ga0436365_0074608 Ga0436365_0074608_33_1151 292
158 3300039450 Ga0436363_0600333 Ga0436363_0600333_1339_2457 292
159 3300039450 Ga0436363_0820755 Ga0436363_0820755_1932_3101 292
160 3300039453 Ga0436362_0387106 Ga0436362_0387106_1420_2547 292
161 3300049459 Ga0495678_009365 Ga0495678_009365_2268_3335 292
162 iso_pu_bacteria 2935908558 2935911214 292
163 iso_pu_bacteria 2643221556 2643796890 293
164 iso_pu_bacteria 2643221684 2644470005 293
165 iso_pu_bacteria 2808606418 2809147224 293
166 iso_pu_bacteria 8047673197 8047676836 293
167 3300046452 Ga0495617_000004 Ga0495617_000004_354445_355500 296
168 3300046463 Ga0495653_0000004 Ga0495653_0000004_214332_215408 296
169 3300046471 Ga0495650_0002183 Ga0495650_0002183_323_1399 296
170 3300046491 Ga0495584_0057763 Ga0495584_0057763_544_1635 296
171 3300047469 Ga0495673_0000005 Ga0495673_0000005_33004_34080 296
172 3300048918 Ga0496115_0340316 Ga0496115_0340316_81_1136 296
173 3300048927 Ga0496124_0128750 Ga0496124_0128750_538_1614 296
174 3300003322 rootL2_10037998 rootL2_100379982 297
175 3300005327 Ga0070658_10301464 Ga0070658_103014642 297
176 3300005336 Ga0070680_100076362 Ga0070680_1000763622 297
177 3300005563 Ga0068855_100310599 Ga0068855_1003105992 297
178 3300026089 Ga0207648_10213439 Ga0207648_102134392 297
179 3300037312 Ga0395899_0007325 Ga0395899_0007325_3161_4237 297
180 3300044658 Ga0466972_0004240 Ga0466972_0004240_5608_6663 297
181 3300044684 Ga0466966_0066272 Ga0466966_0066272_962_2038 297
182 3300044735 Ga0466968_0001152 Ga0466968_0001152_7775_8830 297
183 3300044842 Ga0466957_0057566 Ga0466957_0057566_1112_2167 297
184 3300046452 Ga0495617_002043 Ga0495617_002043_2333_3391 297
185 3300046453 Ga0495627_012363 Ga0495627_012363_723_1802 297
186 3300046455 Ga0495603_0013494 Ga0495603_0013494_3865_4923 297
187 3300046457 Ga0495590_0031949 Ga0495590_0031949_15_1076 297
188 3300046458 Ga0495591_012615 Ga0495591_012615_426_1499 297
189 3300046459 Ga0495629_0006643 Ga0495629_0006643_5472_6548 297
190 3300046459 Ga0495629_0198247 Ga0495629_0198247_29_1102 297
191 3300046463 Ga0495653_0001498 Ga0495653_0001498_8711_9784 297
192 3300046471 Ga0495650_0000181 Ga0495650_0000181_133041_134108 297
193 3300046471 Ga0495650_0056256 Ga0495650_0056256_501_1568 297
194 3300046474 Ga0495605_0000039 Ga0495605_0000039_321_1382 297
195 3300046474 Ga0495605_0009567 Ga0495605_0009567_2174_3247 297
196 3300046491 Ga0495584_0000136 Ga0495584_0000136_1558_2619 297
197 3300046491 Ga0495584_0000584 Ga0495584_0000584_2283_3344 297
198 3300046491 Ga0495584_0023522 Ga0495584_0023522_1228_2301 297
199 3300046491 Ga0495584_0036592 Ga0495584_0036592_1159_2223 297
200 3300046492 Ga0495585_0001078 Ga0495585_0001078_4437_5501 297
201 3300046492 Ga0495585_0071928 Ga0495585_0071928_301_1368 297
202 3300046492 Ga0495585_0073265 Ga0495585_0073265_447_1538 297
203 3300046500 Ga0495596_0003480 Ga0495596_0003480_2115_3182 297
204 3300046500 Ga0495596_0007740 Ga0495596_0007740_257_1321 297
205 3300046500 Ga0495596_0009149 Ga0495596_0009149_1804_2871 297
206 3300046501 Ga0495607_0001707 Ga0495607_0001707_2365_3450 297
207 3300046506 Ga0495583_0000102 Ga0495583_0000102_77100_78164 297
208 3300046506 Ga0495583_0026426 Ga0495583_0026426_1162_2226 297
209 3300046507 Ga0495606_0016774 Ga0495606_0016774_3631_4698 297
210 3300046507 Ga0495606_0023852 Ga0495606_0023852_580_1641 297
211 3300046507 Ga0495606_0109744 Ga0495606_0109744_484_1554 297
212 3300046513 Ga0495616_0075463 Ga0495616_0075463_288_1349 297
213 3300046518 Ga0495631_0014264 Ga0495631_0014264_1314_2375 297
214 3300046518 Ga0495631_0017125 Ga0495631_0017125_564_1676 297
215 3300046518 Ga0495631_0032361 Ga0495631_0032361_450_1514 297
216 3300046518 Ga0495631_0060825 Ga0495631_0060825_86_1153 297
217 3300046522 Ga0495643_0013686 Ga0495643_0013686_1776_2837 297
218 3300046522 Ga0495643_0050114 Ga0495643_0050114_1055_2119 297
219 3300046522 Ga0495643_0054015 Ga0495643_0054015_256_1320 297
220 3300046523 Ga0495644_0020251 Ga0495644_0020251_705_1769 297
221 3300046524 Ga0495648_0011764 Ga0495648_0011764_1177_2238 297
222 3300046524 Ga0495648_0040777 Ga0495648_0040777_82_1146 297
223 3300046524 Ga0495648_0047414 Ga0495648_0047414_89_1150 297
224 3300046526 Ga0495666_0000384 Ga0495666_0000384_1974_3041 297
225 3300046528 Ga0495642_0016124 Ga0495642_0016124_202_1269 297
226 3300046528 Ga0495642_0096719 Ga0495642_0096719_90_1157 297
227 3300046530 Ga0495654_0021046 Ga0495654_0021046_2076_3149 297
228 3300046531 Ga0495665_0020805 Ga0495665_0020805_2386_3447 297
229 3300046535 Ga0495586_0003140 Ga0495586_0003140_1930_3003 297
230 3300046538 Ga0495609_0004873 Ga0495609_0004873_2559_3623 297
231 3300046538 Ga0495609_0021839 Ga0495609_0021839_152_1246 297
232 3300046538 Ga0495609_0055560 Ga0495609_0055560_25_1113 297
233 3300046542 Ga0495597_0001471 Ga0495597_0001471_12669_13736 297
234 3300046542 Ga0495597_0001761 Ga0495597_0001761_2145_3218 297
235 3300046542 Ga0495597_0002860 Ga0495597_0002860_8201_9277 297
236 3300046542 Ga0495597_0032984 Ga0495597_0032984_22_1086 297
237 3300046558 Ga0495633_0041380 Ga0495633_0041380_932_1999 297
238 3300046616 Ga0495668_0002236 Ga0495668_0002236_13118_14191 297
239 3300046616 Ga0495668_0020686 Ga0495668_0020686_1222_2286 297
240 3300046616 Ga0495668_0043208 Ga0495668_0043208_594_1661 297
241 3300046648 Ga0495611_0040695 Ga0495611_0040695_208_1272 297
242 3300046663 Ga0495635_0022591 Ga0495635_0022591_2229_3302 297
243 3300046664 Ga0495659_0009901 Ga0495659_0009901_886_1950 297
244 3300046665 Ga0495661_0013399 Ga0495661_0013399_382_1449 297
245 3300046674 Ga0495588_0000296 Ga0495588_0000296_311_1372 297
246 3300046679 Ga0495623_0175953 Ga0495623_0175953_65_1123 297
247 3300046691 Ga0495670_0102688 Ga0495670_0102688_27_1088 297
248 3300046794 Ga0495589_0000047 Ga0495589_0000047_102944_104005 297
249 3300046810 Ga0495660_0000170 Ga0495660_0000170_46198_47259 297
250 3300046810 Ga0495660_0003359 Ga0495660_0003359_3700_4767 297
251 3300047317 Ga0495604_0025469 Ga0495604_0025469_1111_2184 297
252 3300047318 Ga0495636_0002805 Ga0495636_0002805_2118_3179 297
253 3300047320 Ga0495672_0001814 Ga0495672_0001814_14950_16011 297
254 3300047320 Ga0495672_0004215 Ga0495672_0004215_304_1377 297
255 3300047321 Ga0495676_0087725 Ga0495676_0087725_1056_2114 297
256 3300047322 Ga0495680_0026803 Ga0495680_0026803_1235_2308 297
257 3300047323 Ga0495683_0052402 Ga0495683_0052402_626_1687 297
258 3300047443 Ga0495687_000283 Ga0495687_000283_17842_18903 297
259 3300047443 Ga0495687_003896 Ga0495687_003896_5675_6733 297
260 3300047443 Ga0495687_007319 Ga0495687_007319_3421_4482 297
261 3300047444 Ga0495675_0018039 Ga0495675_0018039_2142_3215 297
262 3300047445 Ga0495677_0007406 Ga0495677_0007406_231_1292 297
263 3300047469 Ga0495673_0072552 Ga0495673_0072552_196_1260 297
264 3300047673 Ga0495593_0002661 Ga0495593_0002661_7937_9010 297
265 3300048089 Ga0495614_0002794 Ga0495614_0002794_4573_5646 297
266 3300048091 Ga0495626_0000047 Ga0495626_0000047_114650_115711 297
267 3300048905 Ga0496102_0000290 Ga0496102_0000290_61866_62930 297
268 3300048905 Ga0496102_0206000 Ga0496102_0206000_406_1470 297
269 3300048906 Ga0496103_0037756 Ga0496103_0037756_1604_2668 297
270 3300048908 Ga0496105_0095122 Ga0496105_0095122_200_1288 297
271 3300048913 Ga0496110_0002319 Ga0496110_0002319_10694_11782 297
272 3300048918 Ga0496115_0027377 Ga0496115_0027377_2468_3526 297
273 3300048918 Ga0496115_0345832 Ga0496115_0345832_122_1180 297
274 3300048924 Ga0496121_0116467 Ga0496121_0116467_405_1481 297
275 3300048925 Ga0496122_0029902 Ga0496122_0029902_1386_2447 297
276 3300048926 Ga0496123_0017158 Ga0496123_0017158_2572_3633 297
277 3300048927 Ga0496124_0177217 Ga0496124_0177217_255_1316 297
278 3300049459 Ga0495678_004225 Ga0495678_004225_3398_4462 297
279 3300049571 Ga0501034_0274318 Ga0501034_0274318_214_1275 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01594

AI-2E_transport

AI-2E family transporter

41

376

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ot9-assembly1.cif.gz_A structure of the ai-2 exporter family protein ydik from e. coli 0.5256 1 279
7ot9-assembly1.cif.gz_A structure of the ai-2 exporter family protein ydik from e. coli 0.5027 1 279
7nb6-assembly1.cif.gz_A structure of the autoinducer-2 exporter tqsa from e. coli 0.4896 1 296
7nb6-assembly1.cif.gz_A structure of the autoinducer-2 exporter tqsa from e. coli 0.4807 1 296
8ce1-assembly1.cif.gz_B cytochrome c maturation complex ccmabcd 0.1892 92 293
ID Description Score Start End Superfamily
af_F1R4Z4_193_280_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4492 209 280 1.25.40.10
af_B6SKI7_170_306_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.432 200 296 1.10.287.70
af_A4HVF4_316_410_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.419 207 281 1.25.40.10
af_F1R4Z4_193_280_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3812 209 280 1.25.40.10
af_P04918_18_122_1.10.132.110 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Serum amyloid A protein 0.351 206 271 1.10.132.110
ID Description Score Start End GO Terms
AF-G9ENY1-F1-model_v4 AI-2E family transporter 0.8773 146 296 GO:0016020
AF-A0A1H4UZ70-F1-model_v4 Predicted PurR-regulated permease PerM 0.7616 9 296 GO:0016020
AF-A0A158ALM1-F1-model_v4 Membrane protein 0.7587 2 296 GO:0016020
AF-A0A378JLG8-F1-model_v4 Transmembrane permease 0.7553 1 297 GO:0016020
AF-A0A378JLG8-F1-model_v4 Transmembrane permease 0.7529 1 297 GO:0016020

Feature Viewer

pLDDT pTM Quality
77.87 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map