F383197

General Info

Members Datasets Scaffolds Average Seq Length
279 208 558 179

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0941801|Ga0436365_0941801_115_756
Length 213
Sequence MRPRCATKLHCDLCIISAEGATVCENDLATPERRLRVRTKNLVMAPIIAASLAVFGDNTLAQQDRYTLKVPDGLAFSEFAGYESWEDVAVSETEGSVKAILGNPAMIRAYKEGIPDNGKPFPEGVKIVKIEWVKKKNTVSPYFVEIPDTLKTVSFIEKDSNRFPNTHGWAYAQFDYDTESKTFKPSGTGSECGYACHTRVASRDYIFTTYPPR

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
154 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
155 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
156 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
157 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
203 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
204 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
205 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
206 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
207 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
208 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.45
Nodule 0
Rhizoplane 8.24
Rhizosphere 84.23
Stem 0
Stem Tuber 0
Unclassified 8.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0941801 3300039437 Unclassified 802
2 JGI24739J22299_10081992 3300001989 Bacteria 990
3 JGI24743J22301_10005197 3300001991 Bacteria 2163
4 JGI24750J21931_1018118 3300002070 Bacteria 968
5 JGI24748J21848_1022049 3300002074 Bacteria 770
6 JGI24738J21930_10044573 3300002075 Bacteria 902
7 JGI24744J21845_10010884 3300002077 Bacteria 1862
8 JGI24033J26618_1019658 3300002155 Bacteria 857
9 JGI24742J22300_10002114 3300002244 Bacteria 3161
10 JGI24742J22300_10017579 3300002244 Bacteria 1209
11 rootH1_10117029 3300003316 Unclassified 1206
12 Ga0065704_10161528 3300005289 Bacteria 1351
13 Ga0065707_10002564 3300005295 Bacteria 4769
14 Ga0065707_10205881 3300005295 Unclassified 1272
15 Ga0070683_100811617 3300005329 Unclassified 897
16 Ga0070683_100815806 3300005329 Bacteria 894
17 Ga0070666_10069736 3300005335 Bacteria 2391
18 Ga0070680_100003937 3300005336 Bacteria 11107
19 Ga0070682_100075886 3300005337 Bacteria 2163
20 Ga0070682_101251889 3300005337 Unclassified 628
21 Ga0068868_100083358 3300005338 Bacteria 2566
22 Ga0070660_100091652 3300005339 Bacteria 2398
23 Ga0070689_100174456 3300005340 Bacteria 1743
24 Ga0070687_100082360 3300005343 Bacteria 1759
25 Ga0070668_100180390 3300005347 Bacteria 1724
26 Ga0070669_100119247 3300005353 Bacteria 2011
27 Ga0070671_100131918 3300005355 Bacteria 2104
28 Ga0070674_100058524 3300005356 Bacteria 2679
29 Ga0070688_100493445 3300005365 Bacteria 922
30 Ga0070659_100939503 3300005366 Unclassified 757
31 Ga0070667_100041283 3300005367 Bacteria 3870
32 Ga0070709_10415130 3300005434 Unclassified 1007
33 Ga0070714_101649856 3300005435 Bacteria 626
34 Ga0070713_100308473 3300005436 Bacteria 1459
35 Ga0070713_100442891 3300005436 Bacteria 1219
36 Ga0070701_10041593 3300005438 Bacteria 2343
37 Ga0070711_100071003 3300005439 Bacteria 2453
38 Ga0070711_100293820 3300005439 Bacteria 1290
39 Ga0070711_100340487 3300005439 Unclassified 1203
40 Ga0070700_100009075 3300005441 Bacteria 5451
41 Ga0070694_100136507 3300005444 Bacteria 1778
42 Ga0070708_100128674 3300005445 Bacteria 2342
43 Ga0070663_100086541 3300005455 Bacteria 2314
44 Ga0070663_100508993 3300005455 Bacteria 1001
45 Ga0070681_10026297 3300005458 Bacteria 5849
46 Ga0070681_10168372 3300005458 Bacteria 2113
47 Ga0068867_100090971 3300005459 Bacteria 2316
48 Ga0070699_100033616 3300005518 Bacteria 4430
49 Ga0070699_100135614 3300005518 Bacteria 2171
50 Ga0070679_100003370 3300005530 Bacteria 14644
51 Ga0070679_100059542 3300005530 Bacteria 3806
52 Ga0070684_101433716 3300005535 Bacteria 650
53 Ga0070697_100238662 3300005536 Bacteria 1552
54 Ga0070686_100319904 3300005544 Bacteria 1156
55 Ga0070665_100152710 3300005548 Bacteria 2311
56 Ga0070704_100094371 3300005549 Bacteria 2238
57 Ga0070704_100267746 3300005549 Bacteria 1410
58 Ga0068855_100004376 3300005563 Bacteria 17260
59 Ga0068855_100804610 3300005563 Bacteria 999
60 Ga0070664_100073561 3300005564 Bacteria 2933
61 Ga0068857_100371276 3300005577 Bacteria 1327
62 Ga0068854_100198714 3300005578 Bacteria 1575
63 Ga0068856_100045699 3300005614 Bacteria 4313
64 Ga0070702_100023132 3300005615 Bacteria 3297
65 Ga0070702_100092750 3300005615 Bacteria 1835
66 Ga0068852_100014268 3300005616 Bacteria 6109
67 Ga0068852_100356299 3300005616 Bacteria 1430
68 Ga0068859_100000002 3300005617 Bacteria 541370
69 Ga0068859_100174889 3300005617 Bacteria 2229
70 Ga0068864_100043142 3300005618 Bacteria 3861
71 Ga0068861_100007631 3300005719 Bacteria 7424
72 Ga0068851_10120875 3300005834 Bacteria 1407
73 Ga0068863_100031640 3300005841 Bacteria 5048
74 Ga0068863_100058228 3300005841 Bacteria 3657
75 Ga0068858_100053792 3300005842 Bacteria 3723
76 Ga0068860_100028306 3300005843 Bacteria 5393
77 Ga0068862_100104410 3300005844 Bacteria 2482
78 Ga0081540_1021705 3300005983 Bacteria 3812
79 Ga0081539_10226324 3300005985 Bacteria 847
80 Ga0075365_10012801 3300006038 Bacteria 4997
81 Ga0075365_10361954 3300006038 Unclassified 1023
82 Ga0075364_10576566 3300006051 Bacteria 769
83 Ga0070712_100015083 3300006175 Bacteria 4969
84 Ga0070712_100125361 3300006175 Bacteria 1939
85 Ga0075366_10171607 3300006195 Bacteria 1316
86 Ga0097621_100058368 3300006237 Bacteria 3157
87 Ga0097621_100119625 3300006237 Bacteria 2233
88 Ga0097621_100177000 3300006237 Bacteria 1842
89 Ga0075370_10321395 3300006353 Bacteria 922
90 Ga0068871_100013658 3300006358 Bacteria 6033
91 Ga0068871_100197334 3300006358 Bacteria 1736
92 Ga0068871_100382151 3300006358 Unclassified 1251
93 Ga0075433_10045288 3300006852 Bacteria 3824
94 Ga0075434_100027798 3300006871 Bacteria 5553
95 Ga0075434_100069588 3300006871 Bacteria 3509
96 Ga0075429_100508103 3300006880 Bacteria 1056
97 Ga0068865_100073098 3300006881 Bacteria 2437
98 Ga0068865_100200330 3300006881 Bacteria 1549
99 Ga0097620_100000002 3300006931 Bacteria 541370
100 Ga0097620_100174903 3300006931 Bacteria 2229
101 Ga0099794_10048856 3300007265 Bacteria 2032
102 Ga0099795_10085140 3300007788 Unclassified 1216
103 Ga0105251_10295481 3300009011 Bacteria 734
104 Ga0105240_10008053 3300009093 Bacteria 15164
105 Ga0111539_10030012 3300009094 Bacteria 6615
106 Ga0111539_10118577 3300009094 Bacteria 3102
107 Ga0105245_10252263 3300009098 Bacteria 1714
108 Ga0105247_10020535 3300009101 Bacteria 3971
109 Ga0114129_10000369 3300009147 Bacteria 52251
110 Ga0114129_10279970 3300009147 Bacteria 2229
111 Ga0105243_10016791 3300009148 Bacteria 5533
112 Ga0105242_10016332 3300009176 Bacteria 5773
113 Ga0105242_10333043 3300009176 Bacteria 1396
114 Ga0105248_10029826 3300009177 Bacteria 6086
115 Ga0105237_10039764 3300009545 Unclassified 4746
116 Ga0105237_10423209 3300009545 Bacteria 1337
117 Ga0105238_10002087 3300009551 Bacteria 20169
118 Ga0105238_10003859 3300009551 Bacteria 14883
119 Ga0105238_10267861 3300009551 Bacteria 1689
120 Ga0099796_10217035 3300010159 Unclassified 782
121 Ga0105239_10565757 3300010375 Bacteria 1295
122 Ga0105239_12220414 3300010375 Bacteria 638
123 Ga0157370_10002002 3300013104 Bacteria 25038
124 Ga0157370_10074870 3300013104 Bacteria 3193
125 Ga0157370_10425680 3300013104 Bacteria 1221
126 Ga0157369_10005140 3300013105 Bacteria 15318
127 Ga0157374_10075829 3300013296 Bacteria 3178
128 Ga0157374_10119939 3300013296 Unclassified 2537
129 Ga0157374_11534689 3300013296 Unclassified 690
130 Ga0157378_10100210 3300013297 Bacteria 2644
131 Ga0157378_10311088 3300013297 Bacteria 1528
132 Ga0157378_10369944 3300013297 Bacteria 1405
133 Ga0157378_11728763 3300013297 Bacteria 673
134 Ga0163162_10667956 3300013306 Bacteria 1162
135 Ga0157375_10040087 3300013308 Bacteria 4513
136 Ga0157375_10373393 3300013308 Bacteria 1592
137 Ga0163163_10053376 3300014325 Bacteria 3989
138 Ga0157380_10416391 3300014326 Bacteria 1280
139 Ga0157379_10109603 3300014968 Bacteria 2480
140 Ga0157376_10037812 3300014969 Bacteria 3923
141 Ga0157376_10446133 3300014969 Bacteria 1261
142 Ga0163161_10020692 3300017792 Bacteria 4621
143 Ga0207653_10211665 3300025885 Bacteria 734
144 Ga0207692_10211000 3300025898 Unclassified 1147
145 Ga0207710_10143731 3300025900 Bacteria 1153
146 Ga0207680_10068502 3300025903 Bacteria 2189
147 Ga0207647_10182253 3300025904 Bacteria 1219
148 Ga0207699_10259307 3300025906 Unclassified 1201
149 Ga0207645_10567656 3300025907 Bacteria 770
150 Ga0207643_10002163 3300025908 Bacteria 10771
151 Ga0207705_10588750 3300025909 Bacteria 865
152 Ga0207684_10076473 3300025910 Bacteria 2845
153 Ga0207684_10287675 3300025910 Bacteria 1417
154 Ga0207684_10389088 3300025910 Unclassified 1199
155 Ga0207707_10000052 3300025912 Bacteria 117200
156 Ga0207707_10284829 3300025912 Bacteria 1431
157 Ga0207695_10011219 3300025913 Bacteria 10868
158 Ga0207671_10256222 3300025914 Bacteria 1376
159 Ga0207663_10265680 3300025916 Bacteria 1269
160 Ga0207663_10312045 3300025916 Bacteria 1179
161 Ga0207660_10054442 3300025917 Bacteria 2855
162 Ga0207660_10714868 3300025917 Bacteria 817
163 Ga0207662_10055753 3300025918 Bacteria 2359
164 Ga0207657_10642833 3300025919 Bacteria 826
165 Ga0207652_10015939 3300025921 Bacteria 6125
166 Ga0207646_10305915 3300025922 Bacteria 1436
167 Ga0207646_10582433 3300025922 Bacteria 1005
168 Ga0207681_10175680 3300025923 Bacteria 1627
169 Ga0207694_10013723 3300025924 Bacteria 6106
170 Ga0207694_10017639 3300025924 Bacteria 5396
171 Ga0207700_11224637 3300025928 Bacteria 670
172 Ga0207644_10096445 3300025931 Bacteria 2213
173 Ga0207706_10095160 3300025933 Bacteria 2620
174 Ga0207686_10393170 3300025934 Bacteria 1054
175 Ga0207709_10292571 3300025935 Bacteria 1208
176 Ga0207670_10148353 3300025936 Bacteria 1737
177 Ga0207669_10025697 3300025937 Bacteria 3188
178 Ga0207704_10082172 3300025938 Bacteria 2086
179 Ga0207711_10058197 3300025941 Bacteria 3325
180 Ga0207689_10029922 3300025942 Bacteria 4541
181 Ga0207651_10092689 3300025960 Bacteria 2216
182 Ga0207712_10024213 3300025961 Bacteria 4018
183 Ga0207668_10006988 3300025972 Bacteria 6693
184 Ga0207658_10042038 3300025986 Bacteria 3313
185 Ga0207677_10014104 3300026023 Bacteria 4654
186 Ga0207703_10014552 3300026035 Bacteria 6138
187 Ga0207678_10004242 3300026067 Bacteria 12859
188 Ga0207708_10003173 3300026075 Bacteria 12104
189 Ga0207702_10455906 3300026078 Bacteria 1241
190 Ga0207641_10058361 3300026088 Bacteria 3284
191 Ga0207641_10096677 3300026088 Bacteria 2594
192 Ga0207648_10011788 3300026089 Bacteria 8216
193 Ga0207676_10044018 3300026095 Bacteria 3441
194 Ga0207674_10275638 3300026116 Bacteria 1630
195 Ga0207674_10328580 3300026116 Bacteria 1479
196 Ga0207675_100017003 3300026118 Bacteria 6797
197 Ga0207683_10021008 3300026121 Bacteria 5587
198 Ga0207698_10038203 3300026142 Bacteria 3544
199 Ga0207698_10539960 3300026142 Bacteria 1141
200 Ga0209588_1040158 3300027671 Bacteria 1509
201 Ga0207428_10252884 3300027907 Bacteria 1314
202 Ga0207428_10287571 3300027907 Bacteria 1219
203 Ga0268266_10162669 3300028379 Bacteria 2020
204 Ga0268265_10039622 3300028380 Bacteria 3474
205 Ga0268264_10114658 3300028381 Bacteria 2366
206 Ga0268264_10451298 3300028381 Bacteria 1246
207 Ga0265332_10010414 3300031238 Bacteria 4138
208 Ga0265328_10162545 3300031239 Bacteria 842
209 Ga0265320_10010610 3300031240 Bacteria 5471
210 Ga0265325_10002105 3300031241 Bacteria 13601
211 Ga0265325_10005446 3300031241 Bacteria 7854
212 Ga0265340_10003565 3300031247 Bacteria 8762
213 Ga0265340_10036618 3300031247 Bacteria 2431
214 Ga0265331_10052383 3300031250 Bacteria 1950
215 Ga0265331_10085048 3300031250 Bacteria 1466
216 Ga0265342_10022221 3300031712 Bacteria 4037
217 Ga0307406_10952700 3300031901 Bacteria 734
218 Ga0373953_0436838 3300035117 Bacteria 578
219 Ga0373931_0428343 3300035691 Unclassified 842
220 Ga0373947_0115956 3300035725 Bacteria 1698
221 Ga0373937_0502650 3300036401 Bacteria 1152
222 Ga0373925_0083985 3300037068 Bacteria 2426
223 Ga0373925_0156839 3300037068 Unclassified 1791
224 Ga0495582_0469138 3300046473 Unclassified 727
225 Ga0495630_0656682 3300046517 Bacteria 803
226 Ga0495637_0147688 3300046520 Bacteria 889
227 Ga0495652_0164583 3300046529 Bacteria 1718
228 Ga0495586_0022388 3300046535 Bacteria 3373
229 Ga0495587_0315128 3300046536 Bacteria 874
230 Ga0495613_0293390 3300046689 Bacteria 1127
231 Ga0495679_075300 3300047446 Bacteria 966
232 Ga0496100_0052501 3300048903 Bacteria 2650
233 Ga0496101_0049239 3300048904 Bacteria 3030
234 Ga0496102_0014118 3300048905 Bacteria 6938
235 Ga0496103_0021574 3300048906 Bacteria 3875
236 Ga0496103_0142246 3300048906 Bacteria 1535
237 Ga0496104_0131251 3300048907 Bacteria 2406
238 Ga0496105_0003396 3300048908 Bacteria 11775
239 Ga0496106_0007092 3300048909 Bacteria 8283
240 Ga0496107_0083416 3300048910 Bacteria 2330
241 Ga0496108_0018256 3300048911 Bacteria 5744
242 Ga0496109_0096532 3300048912 Bacteria 2738
243 Ga0496109_0485239 3300048912 Bacteria 1167
244 Ga0496110_0039623 3300048913 Bacteria 4103
245 Ga0496111_0022237 3300048914 Bacteria 4436
246 Ga0496111_0356663 3300048914 Bacteria 1082
247 Ga0496111_0505545 3300048914 Bacteria 889
248 Ga0496112_0045032 3300048915 Bacteria 4324
249 Ga0496112_0234521 3300048915 Bacteria 1789
250 Ga0496113_0030551 3300048916 Bacteria 3900
251 Ga0496114_0032942 3300048917 Bacteria 4267
252 Ga0496114_0134517 3300048917 Bacteria 2137
253 Ga0496115_0001230 3300048918 Bacteria 18392
254 Ga0496115_0404654 3300048918 Bacteria 1107
255 Ga0496118_0110173 3300048921 Bacteria 1830
256 Ga0501080_0615704 3300049742 Unclassified 963
257 nmdc:mga0yw44_119966_c1 3300050492 Bacteria 1693
258 nmdc:mga0yw44_23800_c1 3300050492 Bacteria 3456
259 nmdc:mga0yw44_59648_c1 3300050492 Bacteria 2335
260 nmdc:mga0k408_165876_c1 3300050493 Bacteria 1316
261 nmdc:mga06z11_80325_c1 3300050494 Bacteria 1748
262 nmdc:mga04h51_214210_c1 3300050495 Bacteria 761
263 nmdc:mga05p37_62_c1 3300050507 Bacteria 94760
264 nmdc:mga08y16_173101_c1 3300050511 Bacteria 2242
265 nmdc:mga08y16_28741_c1 3300050511 Bacteria 5860
266 nmdc:mga0n895_43487_c1 3300050512 Bacteria 4377
267 nmdc:mga0n895_68199_c1 3300050512 Bacteria 3523
268 nmdc:mga0rr50_288584_c1 3300050513 Bacteria 1370
269 nmdc:mga0a205_16342_c1 3300050515 Bacteria 5040
270 Ga0495601_0142775 3300053077 Unclassified 1562
271 Ga0495601_0245128 3300053077 Unclassified 1170
272 Ga0495655_0122718 3300053083 Bacteria 792
273 Ga0500643_000123 3300053087 Bacteria 80567
274 Ga0500583_0011037 3300053092 Bacteria 3385
275 Ga0500583_0028365 3300053092 Bacteria 2427
276 Ga0500572_000426 3300053111 Bacteria 14819
277 Ga0500559_0000737 3300053136 Bacteria 21461
278 Ga0500645_031199 3300053730 Bacteria 1602
279 Ga0500596_006783 3300053735 Bacteria 1913
280 Ga0436365_0941801
281 JGI24739J22299_10081992
282 JGI24743J22301_10005197
283 JGI24750J21931_1018118
284 JGI24748J21848_1022049
285 JGI24738J21930_10044573
286 JGI24744J21845_10010884
287 JGI24033J26618_1019658
288 JGI24742J22300_10002114
289 JGI24742J22300_10017579
290 rootH1_10117029
291 Ga0065704_10161528
292 Ga0065707_10002564
293 Ga0065707_10205881
294 Ga0070683_100811617
295 Ga0070683_100815806
296 Ga0070666_10069736
297 Ga0070680_100003937
298 Ga0070682_100075886
299 Ga0070682_101251889
300 Ga0068868_100083358
301 Ga0070660_100091652
302 Ga0070689_100174456
303 Ga0070687_100082360
304 Ga0070668_100180390
305 Ga0070669_100119247
306 Ga0070671_100131918
307 Ga0070674_100058524
308 Ga0070688_100493445
309 Ga0070659_100939503
310 Ga0070667_100041283
311 Ga0070709_10415130
312 Ga0070714_101649856
313 Ga0070713_100308473
314 Ga0070713_100442891
315 Ga0070701_10041593
316 Ga0070711_100071003
317 Ga0070711_100293820
318 Ga0070711_100340487
319 Ga0070700_100009075
320 Ga0070694_100136507
321 Ga0070708_100128674
322 Ga0070663_100086541
323 Ga0070663_100508993
324 Ga0070681_10026297
325 Ga0070681_10168372
326 Ga0068867_100090971
327 Ga0070699_100033616
328 Ga0070699_100135614
329 Ga0070679_100003370
330 Ga0070679_100059542
331 Ga0070684_101433716
332 Ga0070697_100238662
333 Ga0070686_100319904
334 Ga0070665_100152710
335 Ga0070704_100094371
336 Ga0070704_100267746
337 Ga0068855_100004376
338 Ga0068855_100804610
339 Ga0070664_100073561
340 Ga0068857_100371276
341 Ga0068854_100198714
342 Ga0068856_100045699
343 Ga0070702_100023132
344 Ga0070702_100092750
345 Ga0068852_100014268
346 Ga0068852_100356299
347 Ga0068859_100000002
348 Ga0068859_100174889
349 Ga0068864_100043142
350 Ga0068861_100007631
351 Ga0068851_10120875
352 Ga0068863_100031640
353 Ga0068863_100058228
354 Ga0068858_100053792
355 Ga0068860_100028306
356 Ga0068862_100104410
357 Ga0081540_1021705
358 Ga0081539_10226324
359 Ga0075365_10012801
360 Ga0075365_10361954
361 Ga0075364_10576566
362 Ga0070712_100015083
363 Ga0070712_100125361
364 Ga0075366_10171607
365 Ga0097621_100058368
366 Ga0097621_100119625
367 Ga0097621_100177000
368 Ga0075370_10321395
369 Ga0068871_100013658
370 Ga0068871_100197334
371 Ga0068871_100382151
372 Ga0075433_10045288
373 Ga0075434_100027798
374 Ga0075434_100069588
375 Ga0075429_100508103
376 Ga0068865_100073098
377 Ga0068865_100200330
378 Ga0097620_100000002
379 Ga0097620_100174903
380 Ga0099794_10048856
381 Ga0099795_10085140
382 Ga0105251_10295481
383 Ga0105240_10008053
384 Ga0111539_10030012
385 Ga0111539_10118577
386 Ga0105245_10252263
387 Ga0105247_10020535
388 Ga0114129_10000369
389 Ga0114129_10279970
390 Ga0105243_10016791
391 Ga0105242_10016332
392 Ga0105242_10333043
393 Ga0105248_10029826
394 Ga0105237_10039764
395 Ga0105237_10423209
396 Ga0105238_10002087
397 Ga0105238_10003859
398 Ga0105238_10267861
399 Ga0099796_10217035
400 Ga0105239_10565757
401 Ga0105239_12220414
402 Ga0157370_10002002
403 Ga0157370_10074870
404 Ga0157370_10425680
405 Ga0157369_10005140
406 Ga0157374_10075829
407 Ga0157374_10119939
408 Ga0157374_11534689
409 Ga0157378_10100210
410 Ga0157378_10311088
411 Ga0157378_10369944
412 Ga0157378_11728763
413 Ga0163162_10667956
414 Ga0157375_10040087
415 Ga0157375_10373393
416 Ga0163163_10053376
417 Ga0157380_10416391
418 Ga0157379_10109603
419 Ga0157376_10037812
420 Ga0157376_10446133
421 Ga0163161_10020692
422 Ga0207653_10211665
423 Ga0207692_10211000
424 Ga0207710_10143731
425 Ga0207680_10068502
426 Ga0207647_10182253
427 Ga0207699_10259307
428 Ga0207645_10567656
429 Ga0207643_10002163
430 Ga0207705_10588750
431 Ga0207684_10076473
432 Ga0207684_10287675
433 Ga0207684_10389088
434 Ga0207707_10000052
435 Ga0207707_10284829
436 Ga0207695_10011219
437 Ga0207671_10256222
438 Ga0207663_10265680
439 Ga0207663_10312045
440 Ga0207660_10054442
441 Ga0207660_10714868
442 Ga0207662_10055753
443 Ga0207657_10642833
444 Ga0207652_10015939
445 Ga0207646_10305915
446 Ga0207646_10582433
447 Ga0207681_10175680
448 Ga0207694_10013723
449 Ga0207694_10017639
450 Ga0207700_11224637
451 Ga0207644_10096445
452 Ga0207706_10095160
453 Ga0207686_10393170
454 Ga0207709_10292571
455 Ga0207670_10148353
456 Ga0207669_10025697
457 Ga0207704_10082172
458 Ga0207711_10058197
459 Ga0207689_10029922
460 Ga0207651_10092689
461 Ga0207712_10024213
462 Ga0207668_10006988
463 Ga0207658_10042038
464 Ga0207677_10014104
465 Ga0207703_10014552
466 Ga0207678_10004242
467 Ga0207708_10003173
468 Ga0207702_10455906
469 Ga0207641_10058361
470 Ga0207641_10096677
471 Ga0207648_10011788
472 Ga0207676_10044018
473 Ga0207674_10275638
474 Ga0207674_10328580
475 Ga0207675_100017003
476 Ga0207683_10021008
477 Ga0207698_10038203
478 Ga0207698_10539960
479 Ga0209588_1040158
480 Ga0207428_10252884
481 Ga0207428_10287571
482 Ga0268266_10162669
483 Ga0268265_10039622
484 Ga0268264_10114658
485 Ga0268264_10451298
486 Ga0265332_10010414
487 Ga0265328_10162545
488 Ga0265320_10010610
489 Ga0265325_10002105
490 Ga0265325_10005446
491 Ga0265340_10003565
492 Ga0265340_10036618
493 Ga0265331_10052383
494 Ga0265331_10085048
495 Ga0265342_10022221
496 Ga0307406_10952700
497 Ga0373953_0436838
498 Ga0373931_0428343
499 Ga0373947_0115956
500 Ga0373937_0502650
501 Ga0373925_0083985
502 Ga0373925_0156839
503 Ga0495582_0469138
504 Ga0495630_0656682
505 Ga0495637_0147688
506 Ga0495652_0164583
507 Ga0495586_0022388
508 Ga0495587_0315128
509 Ga0495613_0293390
510 Ga0495679_075300
511 Ga0496100_0052501
512 Ga0496101_0049239
513 Ga0496102_0014118
514 Ga0496103_0021574
515 Ga0496103_0142246
516 Ga0496104_0131251
517 Ga0496105_0003396
518 Ga0496106_0007092
519 Ga0496107_0083416
520 Ga0496108_0018256
521 Ga0496109_0096532
522 Ga0496109_0485239
523 Ga0496110_0039623
524 Ga0496111_0022237
525 Ga0496111_0356663
526 Ga0496111_0505545
527 Ga0496112_0045032
528 Ga0496112_0234521
529 Ga0496113_0030551
530 Ga0496114_0032942
531 Ga0496114_0134517
532 Ga0496115_0001230
533 Ga0496115_0404654
534 Ga0496118_0110173
535 Ga0501080_0615704
536 nmdc:mga0yw44_119966_c1
537 nmdc:mga0yw44_23800_c1
538 nmdc:mga0yw44_59648_c1
539 nmdc:mga0k408_165876_c1
540 nmdc:mga06z11_80325_c1
541 nmdc:mga04h51_214210_c1
542 nmdc:mga05p37_62_c1
543 nmdc:mga08y16_173101_c1
544 nmdc:mga08y16_28741_c1
545 nmdc:mga0n895_43487_c1
546 nmdc:mga0n895_68199_c1
547 nmdc:mga0rr50_288584_c1
548 nmdc:mga0a205_16342_c1
549 Ga0495601_0142775
550 Ga0495601_0245128
551 Ga0495655_0122718
552 Ga0500643_000123
553 Ga0500583_0011037
554 Ga0500583_0028365
555 Ga0500572_000426
556 Ga0500559_0000737
557 Ga0500645_031199
558 Ga0500596_006783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16694

Cytochrome_P460

Cytochrome P460

79

208

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hiu-assembly1.cif.gz_A cytochrome p460 from methylococcus capsulatus (bath) 0.8318 32 177
6hiu-assembly1.cif.gz_A cytochrome p460 from methylococcus capsulatus (bath) 0.8158 32 177
8brk-assembly1.cif.gz_A room temperature crystal structure of cytochrome c' from thermus thermophilus 0.767 44 176
8gar-assembly1.cif.gz_A nitrosomonas europaea cytochrome p460 arg44ala 0.7464 44 162
7zs4-assembly1.cif.gz_A f32v cytochrome c prime beta from methylococcus capsulatus (bath) 0.745 42 176
ID Description Score Start End Superfamily
2je3A00 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase;Cytochrome P460 0.716 44 162 3.50.70.20
af_P91634_344_513_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.6456 84 126 2.60.40.150
2rk0B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.6122 41 67 3.10.180.10
af_Q9R1Q9_252_414_2.40.160.110 Mainly Beta;Beta Barrel;Porin; 0.5415 41 149 2.40.160.110
2je3A00 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase;Cytochrome P460 0.5372 44 162 3.50.70.20
ID Description Score Start End GO Terms
AF-A0A2V2R107-F1-model_v4 deleted 0.9384 20 177
AF-A0A2V7MFV7-F1-model_v4 Cytochrome P460 0.9315 28 177
AF-A0A2N2GAF9-F1-model_v4 Cytochrome p460 0.9148 20 177
AF-A0A2V6QIC1-F1-model_v4 Cytochrome P460 0.9058 66 177
AF-D1CTB2-F1-model_v4 Putative cytochrome P460 0.8909 83 177

Map