F383139

General Info

Members Datasets Scaffolds Average Seq Length
279 159 279 601

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10001049|Ga0265338_1000104927
Length 628
Sequence MNMKNKNSRNLAYALAGIIILGLALYLTSSTATKPTSVSLSQVISQAKTGQVDHINITSDKLDVYLRDGTHEQAFKETGSSLASYGIDYSKVKVVPQNPDSGSSRWLDVLLAFAPIVLIIGFFYFMMRQAQGSNNAAMSFGKSKARVFGLDRGNVKFKDVAGVAEAKQELGEVVEFLRYPTKFEALGAKIPKGVLLIGSPGTGKTMLARAVAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFNKAKKNSPCIVFIDEIDAVGRQRGTGLGGGHDEREQTLNQILVEMDGFEQGTNVIVMAATNRPDVLDPALLRPGRFDRRVVLDLPDMNNRAEILQVHTEKKPLASDVNLKDIARKTPGLAGADLANITNEAAXXXXRRDKKKISQAELSDAVEKVALGPERHSNILNDKEKEITAYHEAGHAILSHLLPNCNPVHKVTIIGRGMALGVTWSLPMEDKHLHSVADFKDDIAMSLGGRVAEEMVFGEITTGASNDLKHVNETAHQMVTEYGMSPQLSNLVFHDNEGSIFLGKSMMEGRHYSDEVAAKIDVEIAAIVDEATGRARKVMLDNRDKLDLIAKKLLESETIEGPEFEKLMSSLNKKRPAGDGLPPVEDVDTSPSVNSPAGV

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
84 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
85 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
86 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
87 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
88 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
89 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
92 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
93 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
110 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
127 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
128 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
129 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
133 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
137 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
138 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
139 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
140 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
141 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
142 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
143 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
144 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
145 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
146 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
147 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
148 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
149 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
150 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
151 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
152 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
153 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
154 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
155 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
156 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
157 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
158 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.58
Nodule 0
Rhizoplane 0.36
Rhizosphere 76.7
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1002526 3300001904 Bacteria 3231
2 JGI24741J21665_1000035 3300001915 Bacteria 32655
3 JGI24741J21665_1001193 3300001915 Bacteria 7664
4 JGI24737J22298_10000108 3300001990 Bacteria 25113
5 JGI24735J21928_10000053 3300002067 Bacteria 50333
6 JGI24742J22300_10000025 3300002244 Bacteria 24761
7 rootH2_10000311 3300003320 Bacteria 277677
8 Ga0070658_10000051 3300005327 Bacteria 118657
9 Ga0070658_10000867 3300005327 Bacteria 25848
10 Ga0070676_10001731 3300005328 Bacteria 11101
11 Ga0070683_100000120 3300005329 Bacteria 51000
12 Ga0070683_100000183 3300005329 Bacteria 41586
13 Ga0070690_100001026 3300005330 Bacteria 14286
14 Ga0070677_10012136 3300005333 Bacteria 2986
15 Ga0070666_10000225 3300005335 Bacteria 38681
16 Ga0070680_100002885 3300005336 Bacteria 12782
17 Ga0070682_100001974 3300005337 Bacteria 11444
18 Ga0070682_100004222 3300005337 Bacteria 7972
19 Ga0070660_100000054 3300005339 Bacteria 67207
20 Ga0070660_100003267 3300005339 Bacteria 11129
21 Ga0070674_100004086 3300005356 Bacteria 8292
22 Ga0070681_10022945 3300005458 Bacteria 6272
23 Ga0070681_10037952 3300005458 Bacteria 4831
24 Ga0070679_100000233 3300005530 Bacteria 45952
25 Ga0070679_100005792 3300005530 Bacteria 11467
26 Ga0070679_100009008 3300005530 Bacteria 9413
27 Ga0070679_100009657 3300005530 Bacteria 9127
28 Ga0070679_100023460 3300005530 Bacteria 6040
29 Ga0070679_100028770 3300005530 Bacteria 5481
30 Ga0070679_100040720 3300005530 Bacteria 4622
31 Ga0070679_100045473 3300005530 Bacteria 4375
32 Ga0070684_100000284 3300005535 Bacteria 35219
33 Ga0070684_100067538 3300005535 Bacteria 3141
34 Ga0068853_100008477 3300005539 Bacteria 8262
35 Ga0068853_100043993 3300005539 Bacteria 3821
36 Ga0070686_100001991 3300005544 Bacteria 11337
37 Ga0070665_100027894 3300005548 Bacteria 5685
38 Ga0068855_100000001 3300005563 Bacteria 818777
39 Ga0068855_100002961 3300005563 Bacteria 20765
40 Ga0068857_100008140 3300005577 Bacteria 9051
41 Ga0068856_100000002 3300005614 Bacteria 372816
42 Ga0068856_100000568 3300005614 Bacteria 40410
43 Ga0068856_100019298 3300005614 Bacteria 6618
44 Ga0068856_100102548 3300005614 Bacteria 2855
45 Ga0068861_100018206 3300005719 Bacteria 4999
46 Ga0068863_100008358 3300005841 Bacteria 10110
47 Ga0068858_100049461 3300005842 Bacteria 3894
48 Ga0068862_100016308 3300005844 Bacteria 6182
49 Ga0075365_10000016 3300006038 Bacteria 71640
50 Ga0075365_10000321 3300006038 Bacteria 16961
51 Ga0075365_10004899 3300006038 Bacteria 7155
52 Ga0075368_10002314 3300006042 Bacteria 6184
53 Ga0075363_100004160 3300006048 Bacteria 6284
54 Ga0075364_10000371 3300006051 Bacteria 22078
55 Ga0075364_10011415 3300006051 Bacteria 5397
56 Ga0075364_10022552 3300006051 Bacteria 3977
57 Ga0075364_10056228 3300006051 Bacteria 2576
58 Ga0075362_10000142 3300006177 Bacteria 19546
59 Ga0075367_10000166 3300006178 Bacteria 20919
60 Ga0075367_10000569 3300006178 Bacteria 14063
61 Ga0075369_10000006 3300006186 Bacteria 132271
62 Ga0075369_10000140 3300006186 Bacteria 20048
63 Ga0075366_10000002 3300006195 Bacteria 153795
64 Ga0075366_10000004 3300006195 Bacteria 111331
65 Ga0075366_10000007 3300006195 Bacteria 104412
66 Ga0075366_10000223 3300006195 Bacteria 25208
67 Ga0075428_100007612 3300006844 Bacteria 12007
68 Ga0075430_100003706 3300006846 Bacteria 12837
69 Ga0105240_10000003 3300009093 Bacteria 1183681
70 Ga0105240_10009060 3300009093 Bacteria 14130
71 Ga0111539_10002649 3300009094 Bacteria 23725
72 Ga0105245_10000001 3300009098 Bacteria 939270
73 Ga0105245_10000094 3300009098 Bacteria 85857
74 Ga0105245_10010058 3300009098 Bacteria 8242
75 Ga0105243_10000001 3300009148 Bacteria 1156578
76 Ga0105241_10000003 3300009174 Bacteria 839043
77 Ga0105241_10000372 3300009174 Bacteria 34165
78 Ga0105241_10013026 3300009174 Bacteria 6099
79 Ga0105242_10000001 3300009176 Bacteria 574039
80 Ga0105242_10007229 3300009176 Bacteria 8559
81 Ga0105237_10080465 3300009545 Bacteria 3248
82 Ga0105238_10000042 3300009551 Bacteria 154892
83 Ga0105249_10000715 3300009553 Bacteria 30169
84 Ga0105239_10013862 3300010375 Bacteria 8946
85 Ga0157373_10000059 3300013100 Bacteria 95794
86 Ga0157371_10000181 3300013102 Bacteria 92599
87 Ga0157369_10000054 3300013105 Bacteria 162631
88 Ga0157369_10006004 3300013105 Bacteria 14108
89 Ga0157369_10014716 3300013105 Bacteria 8826
90 Ga0157374_10000133 3300013296 Bacteria 68141
91 Ga0157374_10008765 3300013296 Bacteria 8654
92 Ga0157374_10009665 3300013296 Bacteria 8282
93 Ga0157374_10134815 3300013296 Bacteria 2393
94 Ga0157372_10000212 3300013307 Bacteria 65077
95 Ga0157372_10034534 3300013307 Bacteria 5560
96 Ga0157377_10016676 3300014745 Bacteria 3783
97 Ga0207680_10000659 3300025903 Bacteria 16317
98 Ga0207647_10000004 3300025904 Bacteria 307217
99 Ga0207647_10000167 3300025904 Bacteria 52189
100 Ga0207645_10002806 3300025907 Bacteria 13534
101 Ga0207705_10000019 3300025909 Bacteria 317770
102 Ga0207705_10004070 3300025909 Bacteria 11096
103 Ga0207654_10000002 3300025911 Bacteria 1460142
104 Ga0207654_10004582 3300025911 Bacteria 6980
105 Ga0207707_10005828 3300025912 Bacteria 10766
106 Ga0207707_10006585 3300025912 Bacteria 10133
107 Ga0207707_10101642 3300025912 Bacteria 2513
108 Ga0207695_10000005 3300025913 Bacteria 1196715
109 Ga0207695_10010248 3300025913 Bacteria 11487
110 Ga0207695_10033147 3300025913 Bacteria 5641
111 Ga0207671_10061102 3300025914 Bacteria 2796
112 Ga0207660_10002649 3300025917 Bacteria 11741
113 Ga0207660_10022060 3300025917 Bacteria 4287
114 Ga0207657_10001171 3300025919 Bacteria 27817
115 Ga0207657_10001767 3300025919 Bacteria 23331
116 Ga0207649_10082698 3300025920 Bacteria 2082
117 Ga0207652_10002980 3300025921 Bacteria 14143
118 Ga0207652_10008693 3300025921 Bacteria 8178
119 Ga0207652_10010282 3300025921 Bacteria 7531
120 Ga0207652_10020620 3300025921 Bacteria 5431
121 Ga0207652_10032186 3300025921 Bacteria 4406
122 Ga0207652_10074542 3300025921 Bacteria 2955
123 Ga0207646_10063210 3300025922 Bacteria 3305
124 Ga0207694_10004146 3300025924 Bacteria 11382
125 Ga0207687_10000001 3300025927 Bacteria 1130810
126 Ga0207687_10000004 3300025927 Bacteria 841177
127 Ga0207687_10000060 3300025927 Bacteria 84771
128 Ga0207686_10000001 3300025934 Bacteria 1169580
129 Ga0207686_10003434 3300025934 Bacteria 8503
130 Ga0207709_10000002 3300025935 Bacteria 1171536
131 Ga0207709_10019174 3300025935 Bacteria 3841
132 Ga0207661_10000310 3300025944 Bacteria 31041
133 Ga0207661_10001660 3300025944 Bacteria 15169
134 Ga0207667_10000003 3300025949 Bacteria 822935
135 Ga0207667_10003050 3300025949 Bacteria 20784
136 Ga0207667_10008943 3300025949 Bacteria 11844
137 Ga0207712_10000557 3300025961 Bacteria 30165
138 Ga0207658_10008183 3300025986 Bacteria 7121
139 Ga0207658_10050346 3300025986 Bacteria 3065
140 Ga0207703_10062472 3300026035 Bacteria 3051
141 Ga0207702_10000001 3300026078 Bacteria 895738
142 Ga0207702_10001830 3300026078 Bacteria 20937
143 Ga0207702_10014190 3300026078 Bacteria 6618
144 Ga0207674_10002165 3300026116 Bacteria 24844
145 Ga0207675_100035190 3300026118 Bacteria 4671
146 Ga0209813_10001011 3300027866 Bacteria 6314
147 Ga0268266_10002124 3300028379 Bacteria 21889
148 Ga0265337_1000055 3300028556 Bacteria 51887
149 Ga0265337_1000643 3300028556 Bacteria 18479
150 Ga0265337_1001500 3300028556 Bacteria 11453
151 Ga0265337_1003157 3300028556 Bacteria 7239
152 Ga0265326_10000037 3300028558 Bacteria 89044
153 Ga0265319_1013889 3300028563 Bacteria 3181
154 Ga0265334_10000004 3300028573 Bacteria 243436
155 Ga0265334_10000013 3300028573 Bacteria 155968
156 Ga0265334_10007141 3300028573 Bacteria 4793
157 Ga0265334_10014776 3300028573 Bacteria 3250
158 Ga0265318_10014060 3300028577 Bacteria 3364
159 Ga0265322_10006214 3300028654 Bacteria 3512
160 Ga0265322_10006783 3300028654 Bacteria 3360
161 Ga0265336_10000020 3300028666 Bacteria 213480
162 Ga0265336_10002666 3300028666 Bacteria 7239
163 Ga0265336_10003070 3300028666 Bacteria 6649
164 Ga0265336_10029846 3300028666 Bacteria 1699
165 Ga0265338_10000003 3300028800 Bacteria 733923
166 Ga0265338_10000039 3300028800 Bacteria 236135
167 Ga0265338_10000060 3300028800 Bacteria 197991
168 Ga0265338_10000074 3300028800 Bacteria 181183
169 Ga0265338_10000655 3300028800 Bacteria 59919
170 Ga0265338_10000666 3300028800 Bacteria 59320
171 Ga0265338_10000807 3300028800 Bacteria 52873
172 Ga0265338_10001049 3300028800 Bacteria 46172
173 Ga0265338_10008280 3300028800 Bacteria 12655
174 Ga0265338_10008899 3300028800 Bacteria 12092
175 Ga0265338_10009651 3300028800 Bacteria 11453
176 Ga0265338_10024800 3300028800 Bacteria 6111
177 Ga0265338_10050931 3300028800 Bacteria 3736
178 Ga0265324_10002012 3300029957 Bacteria 10837
179 Ga0265332_10003520 3300031238 Bacteria 7527
180 Ga0265320_10022068 3300031240 Bacteria 3413
181 Ga0265340_10037277 3300031247 Bacteria 2409
182 Ga0265339_10012921 3300031249 Bacteria 5075
183 Ga0265327_10002059 3300031251 Bacteria 22551
184 Ga0265327_10006196 3300031251 Bacteria 9647
185 Ga0265327_10034641 3300031251 Bacteria 2799
186 Ga0265316_10000472 3300031344 Bacteria 45874
187 Ga0265314_10033104 3300031711 Bacteria 3795
188 Ga0395899_0012383 3300037312 Bacteria 6531
189 Ga0395899_0033985 3300037312 Bacteria 3828
190 Ga0395900_0001098 3300037418 Bacteria 34408
191 Ga0395900_0009245 3300037418 Bacteria 10104
192 Ga0395900_0011217 3300037418 Bacteria 9165
193 Ga0395898_0008529 3300037466 Bacteria 10826
194 Ga0395898_0015573 3300037466 Bacteria 7796
195 Ga0395898_0056093 3300037466 Bacteria 3842
196 Ga0395905_0005249 3300037471 Bacteria 13257
197 Ga0395905_0083593 3300037471 Bacteria 2991
198 Ga0395901_0006794 3300038443 Bacteria 11559
199 Ga0395901_0043911 3300038443 Bacteria 4636
200 Ga0395901_0060399 3300038443 Bacteria 3945
201 Ga0451577_0138185 3300042876 Bacteria 2189
202 Ga0451576_0000028 3300045051 Unclassified 408351
203 Ga0451576_0003820 3300045051 Bacteria 20264
204 Ga0451576_0012275 3300045051 Bacteria 9642
205 Ga0495622_0000008 3300046557 Bacteria 232461
206 Ga0495588_0000169 3300046674 Bacteria 83978
207 Ga0495658_0002580 3300046683 Bacteria 9112
208 Ga0495649_0000170 3300046694 Bacteria 57001
209 Ga0495600_0003830 3300046809 Bacteria 8914
210 Ga0496112_0048784 3300048915 Bacteria 4149
211 Ga0501031_0000183 3300049568 Bacteria 35195
212 Ga0501032_0000176 3300049569 Bacteria 52456
213 Ga0501032_0046848 3300049569 Bacteria 2921
214 Ga0501034_0003440 3300049571 Bacteria 18076
215 Ga0501034_0045768 3300049571 Bacteria 4420
216 Ga0501037_0000909 3300049573 Bacteria 22090
217 Ga0501037_0002478 3300049573 Bacteria 13335
218 Ga0501038_0004016 3300049574 Bacteria 13669
219 Ga0501043_0000062 3300049579 Bacteria 95664
220 Ga0501043_0034155 3300049579 Bacteria 4001
221 Ga0501046_0000059 3300049580 Bacteria 126801
222 Ga0501047_0000057 3300049581 Bacteria 140059
223 Ga0501047_0022931 3300049581 Bacteria 5992
224 Ga0501048_0000001 3300049582 Bacteria 132132
225 Ga0501048_0008817 3300049582 Bacteria 7597
226 Ga0501070_0005688 3300049586 Bacteria 10628
227 Ga0501070_0008149 3300049586 Bacteria 8863
228 Ga0501083_0018600 3300049744 Bacteria 4841
229 Ga0501276_000478 3300049773 Bacteria 2458
230 Ga0501035_0000005 3300049822 Bacteria 392980
231 Ga0501035_0021212 3300049822 Bacteria 5971
232 Ga0501044_0011300 3300049823 Bacteria 9677
233 nmdc:mga03683_205_c1 3300050489 Bacteria 19563
234 nmdc:mga03n38_4623_c1 3300050490 Bacteria 4586
235 nmdc:mga00v17_20647_c1 3300050491 Bacteria 3776
236 nmdc:mga00v17_2549_c1 3300050491 Bacteria 9338
237 nmdc:mga00v17_27397_c1 3300050491 Bacteria 3326
238 nmdc:mga0yw44_21749_c1 3300050492 Bacteria 3584
239 nmdc:mga0yw44_76_c1 3300050492 Bacteria 35478
240 nmdc:mga0yw44_8_c1 3300050492 Bacteria 237802
241 nmdc:mga0k408_11_c1 3300050493 Bacteria 130371
242 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
243 nmdc:mga0k408_261_c1 3300050493 Bacteria 28772
244 nmdc:mga0k408_902_c1 3300050493 Bacteria 16227
245 nmdc:mga06z11_21_c1 3300050494 Bacteria 69936
246 nmdc:mga06z11_5_c1 3300050494 Bacteria 61643
247 nmdc:mga04h51_1068_c1 3300050495 Bacteria 6313
248 nmdc:mga07m45_6859_c1 3300050496 Bacteria 5792
249 nmdc:mga0qj67_22923_c1 3300050509 Bacteria 4797
250 nmdc:mga08y16_2389_c1 3300050511 Bacteria 19267
251 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
252 nmdc:mga0sz30_3_c2 3300050516 Bacteria 66048
253 Ga0500643_000034 3300053087 Bacteria 185705
254 Ga0500644_0001091 3300053088 Bacteria 8009
255 Ga0500646_0000461 3300053090 Bacteria 12033
256 Ga0500583_0000040 3300053092 Bacteria 85274
257 Ga0500583_0017595 3300053092 Bacteria 2884
258 Ga0500651_0000011 3300053093 Bacteria 246573
259 Ga0500566_0000001 3300053094 Bacteria 1101031
260 Ga0500650_0000001 3300053098 Bacteria 818797
261 Ga0500555_000001 3300053103 Bacteria 1353713
262 Ga0500562_000002 3300053108 Bacteria 977234
263 Ga0500593_000001 3300053117 Bacteria 784404
264 Ga0500594_0000001 3300053118 Bacteria 1178472
265 Ga0500594_0000070 3300053118 Bacteria 32225
266 Ga0500614_000001 3300053123 Bacteria 1274484
267 Ga0500614_000490 3300053123 Bacteria 10306
268 Ga0500628_000019 3300053129 Bacteria 82128
269 Ga0500628_001248 3300053129 Bacteria 4392
270 Ga0500655_000873 3300053133 Bacteria 5851
271 Ga0500561_0000002 3300053137 Bacteria 394147
272 Ga0500568_0001926 3300053139 Bacteria 12718
273 Ga0500579_024015 3300053143 Bacteria 3942
274 Ga0500589_000056 3300053147 Bacteria 19930
275 Ga0500616_0000005 3300053153 Bacteria 961725
276 Ga0500649_000003 3300053722 Bacteria 140482
277 Ga0500570_000170 3300053724 Bacteria 20309
278 Ga0500611_000543 3300053727 Bacteria 3819
279 Ga0501082_0071192 3300060353 Bacteria 2994

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028666 Ga0265336_10029846 Ga0265336_100298461 488
2 3300037312 Ga0395899_0033985 Ga0395899_0033985_1437_3248 541
3 3300026035 Ga0207703_10062472 Ga0207703_100624721 543
4 3300005530 Ga0070679_100023460 Ga0070679_1000234604 545
5 3300037312 Ga0395899_0012383 Ga0395899_0012383_96_1961 548
6 3300037418 Ga0395900_0009245 Ga0395900_0009245_7928_9793 548
7 3300037466 Ga0395898_0008529 Ga0395898_0008529_2799_4664 548
8 3300037471 Ga0395905_0005249 Ga0395905_0005249_7271_9136 548
9 3300038443 Ga0395901_0006794 Ga0395901_0006794_7821_9686 548
10 3300037418 Ga0395900_0001098 Ga0395900_0001098_17819_19687 549
11 3300037466 Ga0395898_0056093 Ga0395898_0056093_1348_3216 549
12 3300005530 Ga0070679_100009008 Ga0070679_1000090085 550
13 3300025904 Ga0207647_10000167 Ga0207647_100001671 554
14 3300053092 Ga0500583_0017595 Ga0500583_0017595_34_1797 554
15 3300009098 Ga0105245_10000001 Ga0105245_10000001734 555
16 3300025927 Ga0207687_10000001 Ga0207687_10000001295 555
17 3300025927 Ga0207687_10000004 Ga0207687_10000004538 555
18 3300031251 Ga0265327_10002059 Ga0265327_1000205916 555
19 3300049568 Ga0501031_0000183 Ga0501031_0000183_31324_33198 555
20 3300049569 Ga0501032_0000176 Ga0501032_0000176_19161_21035 555
21 3300049571 Ga0501034_0045768 Ga0501034_0045768_333_2207 555
22 3300049573 Ga0501037_0000909 Ga0501037_0000909_12048_13922 555
23 3300049574 Ga0501038_0004016 Ga0501038_0004016_6695_8569 555
24 3300049579 Ga0501043_0000062 Ga0501043_0000062_30188_32062 555
25 3300049580 Ga0501046_0000059 Ga0501046_0000059_94068_95942 555
26 3300049581 Ga0501047_0022931 Ga0501047_0022931_3615_5489 555
27 3300049582 Ga0501048_0000001 Ga0501048_0000001_50367_52241 555
28 3300049586 Ga0501070_0005688 Ga0501070_0005688_8301_10175 555
29 3300049822 Ga0501035_0021212 Ga0501035_0021212_1076_2950 555
30 3300060353 Ga0501082_0071192 Ga0501082_0071192_191_2065 555
31 3300005614 Ga0068856_100000002 Ga0068856_100000002125 556
32 3300026078 Ga0207702_10000001 Ga0207702_10000001305 556
33 3300005614 Ga0068856_100102548 Ga0068856_1001025482 558
34 3300006038 Ga0075365_10000321 Ga0075365_1000032114 558
35 3300006051 Ga0075364_10056228 Ga0075364_100562282 558
36 3300050491 nmdc:mga00v17_20647_c1 nmdc:mga00v17_20647_c1_1573_3444 558
37 3300050492 nmdc:mga0yw44_76_c1 nmdc:mga0yw44_76_c1_4379_6250 558
38 3300006042 Ga0075368_10002314 Ga0075368_100023142 560
39 3300006048 Ga0075363_100004160 Ga0075363_1000041602 560
40 3300006178 Ga0075367_10000569 Ga0075367_100005698 560
41 3300013102 Ga0157371_10000181 Ga0157371_1000018137 560
42 3300025935 Ga0207709_10019174 Ga0207709_100191742 560
43 3300027866 Ga0209813_10001011 Ga0209813_100010113 560
44 3300050490 nmdc:mga03n38_4623_c1 nmdc:mga03n38_4623_c1_1852_3720 560
45 3300050494 nmdc:mga06z11_5_c1 nmdc:mga06z11_5_c1_1836_3704 560
46 3300050495 nmdc:mga04h51_1068_c1 nmdc:mga04h51_1068_c1_2605_4473 560
47 3300006186 Ga0075369_10000140 Ga0075369_100001403 561
48 3300006195 Ga0075366_10000002 Ga0075366_1000000251 561
49 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_269354_271219 561
50 3300050516 nmdc:mga0sz30_3_c2 nmdc:mga0sz30_3_c2_59695_61560 561
51 3300049569 Ga0501032_0046848 Ga0501032_0046848_689_2503 564
52 3300049571 Ga0501034_0003440 Ga0501034_0003440_14195_16009 564
53 3300049573 Ga0501037_0002478 Ga0501037_0002478_5441_7255 564
54 3300049579 Ga0501043_0034155 Ga0501043_0034155_474_2288 564
55 3300049581 Ga0501047_0000057 Ga0501047_0000057_137041_138855 564
56 3300049582 Ga0501048_0008817 Ga0501048_0008817_259_2073 564
57 3300049822 Ga0501035_0000005 Ga0501035_0000005_247247_249061 564
58 3300049823 Ga0501044_0011300 Ga0501044_0011300_1839_3653 564
59 3300006051 Ga0075364_10022552 Ga0075364_100225522 565
60 3300013307 Ga0157372_10034534 Ga0157372_100345346 565
61 3300028573 Ga0265334_10000013 Ga0265334_10000013100 565
62 3300028800 Ga0265338_10000060 Ga0265338_10000060113 565
63 3300050491 nmdc:mga00v17_27397_c1 nmdc:mga00v17_27397_c1_251_2122 565
64 3300005563 Ga0068855_100002961 Ga0068855_1000029617 566
65 3300005841 Ga0068863_100008358 Ga0068863_1000083584 566
66 3300025949 Ga0207667_10003050 Ga0207667_1000305018 566
67 3300048915 Ga0496112_0048784 Ga0496112_0048784_737_2602 566
68 3300053087 Ga0500643_000034 Ga0500643_000034_99017_100885 568
69 3300053139 Ga0500568_0001926 Ga0500568_0001926_3398_5266 568
70 3300005530 Ga0070679_100000233 Ga0070679_10000023330 569
71 3300013307 Ga0157372_10000212 Ga0157372_1000021225 570
72 3300005327 Ga0070658_10000867 Ga0070658_100008675 572
73 3300005329 Ga0070683_100000183 Ga0070683_10000018321 572
74 3300005336 Ga0070680_100002885 Ga0070680_1000028856 572
75 3300005339 Ga0070660_100003267 Ga0070660_10000326710 572
76 3300005458 Ga0070681_10037952 Ga0070681_100379523 572
77 3300005530 Ga0070679_100005792 Ga0070679_1000057927 572
78 3300005535 Ga0070684_100000284 Ga0070684_1000002842 572
79 3300025909 Ga0207705_10004070 Ga0207705_100040705 572
80 3300025912 Ga0207707_10101642 Ga0207707_101016421 572
81 3300025917 Ga0207660_10002649 Ga0207660_100026498 572
82 3300025919 Ga0207657_10001171 Ga0207657_1000117133 572
83 3300025921 Ga0207652_10002980 Ga0207652_100029805 572
84 3300025944 Ga0207661_10001660 Ga0207661_100016603 572
85 3300038443 Ga0395901_0043911 Ga0395901_0043911_930_2795 572
86 3300045051 Ga0451576_0000028 Ga0451576_0000028_56681_58510 572
87 3300002244 JGI24742J22300_10000025 JGI24742J22300_1000002525 574
88 3300005328 Ga0070676_10001731 Ga0070676_1000173111 574
89 3300025907 Ga0207645_10002806 Ga0207645_1000280611 574
90 3300025919 Ga0207657_10001767 Ga0207657_1000176714 574
91 3300005458 Ga0070681_10022945 Ga0070681_100229453 575
92 3300009094 Ga0111539_10002649 Ga0111539_1000264928 575
93 3300025912 Ga0207707_10005828 Ga0207707_1000582814 575
94 3300050511 nmdc:mga08y16_2389_c1 nmdc:mga08y16_2389_c1_1612_3483 575
95 3300005614 Ga0068856_100019298 Ga0068856_1000192983 576
96 3300006177 Ga0075362_10000142 Ga0075362_100001422 576
97 3300006186 Ga0075369_10000006 Ga0075369_1000000664 576
98 3300026078 Ga0207702_10014190 Ga0207702_100141903 576
99 3300050489 nmdc:mga03683_205_c1 nmdc:mga03683_205_c1_2672_4537 576
100 3300050516 nmdc:mga0sz30_2_c1 nmdc:mga0sz30_2_c1_327004_328881 576
101 3300001915 JGI24741J21665_1000035 JGI24741J21665_100003511 577
102 3300006038 Ga0075365_10000016 Ga0075365_1000001660 577
103 3300006051 Ga0075364_10000371 Ga0075364_1000037121 577
104 3300025986 Ga0207658_10008183 Ga0207658_100081835 577
105 3300050491 nmdc:mga00v17_2549_c1 nmdc:mga00v17_2549_c1_986_2854 577
106 3300050492 nmdc:mga0yw44_8_c1 nmdc:mga0yw44_8_c1_7210_9078 577
107 3300050496 nmdc:mga07m45_6859_c1 nmdc:mga07m45_6859_c1_1804_3672 577
108 3300003320 rootH2_10000311 rootH2_1000031187 578
109 3300005333 Ga0070677_10012136 Ga0070677_100121362 578
110 3300006195 Ga0075366_10000007 Ga0075366_1000000714 578
111 3300046557 Ga0495622_0000008 Ga0495622_0000008_65668_67533 578
112 3300046674 Ga0495588_0000169 Ga0495588_0000169_56731_58602 578
113 3300046683 Ga0495658_0002580 Ga0495658_0002580_5072_6937 578
114 3300046809 Ga0495600_0003830 Ga0495600_0003830_4903_6768 578
115 3300049586 Ga0501070_0008149 Ga0501070_0008149_5990_7858 578
116 3300049773 Ga0501276_000478 Ga0501276_000478_147_2003 578
117 3300050493 nmdc:mga0k408_261_c1 nmdc:mga0k408_261_c1_15348_17219 578
118 3300053092 Ga0500583_0000040 Ga0500583_0000040_83054_84928 578
119 3300053094 Ga0500566_0000001 Ga0500566_0000001_225897_227762 578
120 3300053118 Ga0500594_0000070 Ga0500594_0000070_5702_7573 578
121 3300053123 Ga0500614_000001 Ga0500614_000001_789139_791010 578
122 3300053129 Ga0500628_000019 Ga0500628_000019_11614_13485 578
123 3300053147 Ga0500589_000056 Ga0500589_000056_2071_3945 578
124 3300053722 Ga0500649_000003 Ga0500649_000003_116988_118859 578
125 3300005327 Ga0070658_10000051 Ga0070658_1000005132 579
126 3300006038 Ga0075365_10004899 Ga0075365_100048992 579
127 3300006051 Ga0075364_10011415 Ga0075364_100114152 579
128 3300006195 Ga0075366_10000004 Ga0075366_1000000497 579
129 3300009553 Ga0105249_10000715 Ga0105249_1000071510 579
130 3300025909 Ga0207705_10000019 Ga0207705_1000001969 579
131 3300025961 Ga0207712_10000557 Ga0207712_1000055710 579
132 3300028556 Ga0265337_1000055 Ga0265337_100005511 579
133 3300028800 Ga0265338_10000666 Ga0265338_1000066662 579
134 3300050492 nmdc:mga0yw44_21749_c1 nmdc:mga0yw44_21749_c1_726_2600 579
135 3300050493 nmdc:mga0k408_11_c1 nmdc:mga0k408_11_c1_2380_4254 579
136 3300053129 Ga0500628_001248 Ga0500628_001248_1522_3423 579
137 3300053724 Ga0500570_000170 Ga0500570_000170_5350_7236 579
138 3300005330 Ga0070690_100001026 Ga0070690_1000010269 580
139 3300005337 Ga0070682_100001974 Ga0070682_1000019742 580
140 3300005530 Ga0070679_100009657 Ga0070679_1000096573 580
141 3300005530 Ga0070679_100040720 Ga0070679_1000407202 580
142 3300005539 Ga0068853_100008477 Ga0068853_1000084775 580
143 3300005544 Ga0070686_100001991 Ga0070686_10000199111 580
144 3300005719 Ga0068861_100018206 Ga0068861_1000182063 580
145 3300009093 Ga0105240_10000003 Ga0105240_10000003267 580
146 3300009098 Ga0105245_10000094 Ga0105245_100000942 580
147 3300009098 Ga0105245_10010058 Ga0105245_100100586 580
148 3300009148 Ga0105243_10000001 Ga0105243_10000001983 580
149 3300009174 Ga0105241_10000372 Ga0105241_1000037237 580
150 3300009176 Ga0105242_10000001 Ga0105242_10000001275 580
151 3300009545 Ga0105237_10080465 Ga0105237_100804652 580
152 3300010375 Ga0105239_10013862 Ga0105239_100138624 580
153 3300013296 Ga0157374_10000133 Ga0157374_1000013351 580
154 3300013296 Ga0157374_10008765 Ga0157374_100087654 580
155 3300013296 Ga0157374_10134815 Ga0157374_101348151 580
156 3300014745 Ga0157377_10016676 Ga0157377_100166762 580
157 3300025911 Ga0207654_10004582 Ga0207654_100045824 580
158 3300025912 Ga0207707_10006585 Ga0207707_1000658512 580
159 3300025913 Ga0207695_10000005 Ga0207695_10000005274 580
160 3300025914 Ga0207671_10061102 Ga0207671_100611022 580
161 3300025917 Ga0207660_10022060 Ga0207660_100220604 580
162 3300025920 Ga0207649_10082698 Ga0207649_100826982 580
163 3300025921 Ga0207652_10008693 Ga0207652_100086932 580
164 3300025921 Ga0207652_10010282 Ga0207652_100102823 580
165 3300025927 Ga0207687_10000060 Ga0207687_1000006083 580
166 3300025934 Ga0207686_10000001 Ga0207686_10000001157 580
167 3300025935 Ga0207709_10000002 Ga0207709_10000002274 580
168 3300025949 Ga0207667_10008943 Ga0207667_100089439 580
169 3300026116 Ga0207674_10002165 Ga0207674_100021658 580
170 3300026118 Ga0207675_100035190 Ga0207675_1000351903 580
171 3300028563 Ga0265319_1013889 Ga0265319_10138892 580
172 3300031238 Ga0265332_10003520 Ga0265332_100035201 580
173 3300031240 Ga0265320_10022068 Ga0265320_100220682 580
174 3300031247 Ga0265340_10037277 Ga0265340_100372772 580
175 3300031251 Ga0265327_10034641 Ga0265327_100346411 580
176 3300013105 Ga0157369_10006004 Ga0157369_100060041 581
177 3300013296 Ga0157374_10009665 Ga0157374_100096654 581
178 3300005339 Ga0070660_100000054 Ga0070660_10000005470 582
179 3300001915 JGI24741J21665_1001193 JGI24741J21665_10011933 583
180 3300005329 Ga0070683_100000120 Ga0070683_10000012057 583
181 3300005356 Ga0070674_100004086 Ga0070674_10000408610 583
182 3300005535 Ga0070684_100067538 Ga0070684_1000675381 583
183 3300005548 Ga0070665_100027894 Ga0070665_1000278943 583
184 3300005563 Ga0068855_100000001 Ga0068855_100000001595 583
185 3300005614 Ga0068856_100000568 Ga0068856_10000056811 583
186 3300009093 Ga0105240_10009060 Ga0105240_100090603 583
187 3300009174 Ga0105241_10000003 Ga0105241_10000003893 583
188 3300009174 Ga0105241_10013026 Ga0105241_100130263 583
189 3300013100 Ga0157373_10000059 Ga0157373_1000005912 583
190 3300013105 Ga0157369_10000054 Ga0157369_10000054121 583
191 3300025911 Ga0207654_10000002 Ga0207654_10000002315 583
192 3300025913 Ga0207695_10010248 Ga0207695_100102489 583
193 3300025944 Ga0207661_10000310 Ga0207661_1000031037 583
194 3300025949 Ga0207667_10000003 Ga0207667_10000003583 583
195 3300026078 Ga0207702_10001830 Ga0207702_1000183013 583
196 3300028379 Ga0268266_10002124 Ga0268266_1000212410 583
197 3300028556 Ga0265337_1000643 Ga0265337_100064320 583
198 3300028573 Ga0265334_10000004 Ga0265334_10000004222 583
199 3300028800 Ga0265338_10000003 Ga0265338_10000003194 583
200 3300046694 Ga0495649_0000170 Ga0495649_0000170_31050_32921 583
201 3300028800 Ga0265338_10000074 Ga0265338_10000074140 584
202 3300053093 Ga0500651_0000011 Ga0500651_0000011_83087_84952 585
203 3300053123 Ga0500614_000490 Ga0500614_000490_5873_7738 585
204 3300005539 Ga0068853_100043993 Ga0068853_1000439933 586
205 3300005577 Ga0068857_100008140 Ga0068857_1000081403 586
206 3300009551 Ga0105238_10000042 Ga0105238_10000042139 586
207 3300013105 Ga0157369_10014716 Ga0157369_100147169 586
208 3300025913 Ga0207695_10033147 Ga0207695_100331478 586
209 3300025921 Ga0207652_10074542 Ga0207652_100745423 586
210 3300025924 Ga0207694_10004146 Ga0207694_1000414613 586
211 3300028558 Ga0265326_10000037 Ga0265326_1000003728 586
212 3300028573 Ga0265334_10014776 Ga0265334_100147763 586
213 3300028654 Ga0265322_10006783 Ga0265322_100067833 586
214 3300028666 Ga0265336_10000020 Ga0265336_1000002049 586
215 3300028800 Ga0265338_10000039 Ga0265338_1000003912 586
216 3300028800 Ga0265338_10000655 Ga0265338_1000065548 586
217 3300028800 Ga0265338_10024800 Ga0265338_100248007 586
218 3300028800 Ga0265338_10050931 Ga0265338_100509313 586
219 3300029957 Ga0265324_10002012 Ga0265324_100020124 586
220 3300031249 Ga0265339_10012921 Ga0265339_100129214 586
221 3300031251 Ga0265327_10006196 Ga0265327_100061963 586
222 3300031344 Ga0265316_10000472 Ga0265316_1000047253 586
223 3300031711 Ga0265314_10033104 Ga0265314_100331042 586
224 3300037418 Ga0395900_0011217 Ga0395900_0011217_1228_3105 586
225 3300037466 Ga0395898_0015573 Ga0395898_0015573_3667_5544 586
226 3300028556 Ga0265337_1001500 Ga0265337_100150013 587
227 3300028556 Ga0265337_1003157 Ga0265337_10031572 587
228 3300028573 Ga0265334_10007141 Ga0265334_100071412 587
229 3300028577 Ga0265318_10014060 Ga0265318_100140603 587
230 3300028654 Ga0265322_10006214 Ga0265322_100062142 587
231 3300028666 Ga0265336_10002666 Ga0265336_100026667 587
232 3300028666 Ga0265336_10003070 Ga0265336_100030702 587
233 3300028800 Ga0265338_10008899 Ga0265338_100088992 587
234 3300028800 Ga0265338_10009651 Ga0265338_100096512 587
235 3300042876 Ga0451577_0138185 Ga0451577_0138185_189_2006 587
236 3300045051 Ga0451576_0003820 Ga0451576_0003820_13357_15174 587
237 3300049744 Ga0501083_0018600 Ga0501083_0018600_2765_4576 588
238 3300006844 Ga0075428_100007612 Ga0075428_1000076128 590
239 3300006846 Ga0075430_100003706 Ga0075430_10000370617 590
240 3300050509 nmdc:mga0qj67_22923_c1 nmdc:mga0qj67_22923_c1_2269_4107 590
241 3300005337 Ga0070682_100004222 Ga0070682_10000422213 591
242 3300053153 Ga0500616_0000005 Ga0500616_0000005_52914_54785 592
243 3300001990 JGI24737J22298_10000108 JGI24737J22298_1000010825 596
244 3300002067 JGI24735J21928_10000053 JGI24735J21928_1000005328 596
245 3300005530 Ga0070679_100028770 Ga0070679_1000287703 596
246 3300006178 Ga0075367_10000166 Ga0075367_1000016610 596
247 3300006195 Ga0075366_10000223 Ga0075366_100002236 596
248 3300009176 Ga0105242_10007229 Ga0105242_100072293 596
249 3300025921 Ga0207652_10020620 Ga0207652_100206203 596
250 3300025934 Ga0207686_10003434 Ga0207686_100034348 596
251 3300028800 Ga0265338_10008280 Ga0265338_100082807 596
252 3300038443 Ga0395901_0060399 Ga0395901_0060399_205_2070 596
253 3300045051 Ga0451576_0012275 Ga0451576_0012275_5687_7507 596
254 3300050493 nmdc:mga0k408_902_c1 nmdc:mga0k408_902_c1_1136_3007 596
255 3300050494 nmdc:mga06z11_21_c1 nmdc:mga06z11_21_c1_12739_14610 596
256 3300053088 Ga0500644_0001091 Ga0500644_0001091_5866_7740 596
257 3300053090 Ga0500646_0000461 Ga0500646_0000461_2752_4623 596
258 3300053098 Ga0500650_0000001 Ga0500650_0000001_11333_13204 596
259 3300053103 Ga0500555_000001 Ga0500555_000001_245085_246959 596
260 3300053108 Ga0500562_000002 Ga0500562_000002_495921_497792 596
261 3300053117 Ga0500593_000001 Ga0500593_000001_54894_56765 596
262 3300053118 Ga0500594_0000001 Ga0500594_0000001_677630_679501 596
263 3300053133 Ga0500655_000873 Ga0500655_000873_1521_3392 596
264 3300053137 Ga0500561_0000002 Ga0500561_0000002_134251_136122 596
265 3300053143 Ga0500579_024015 Ga0500579_024015_2036_3907 596
266 3300053727 Ga0500611_000543 Ga0500611_000543_517_2391 596
267 3300005842 Ga0068858_100049461 Ga0068858_1000494612 597
268 3300005844 Ga0068862_100016308 Ga0068862_1000163088 597
269 3300005530 Ga0070679_100045473 Ga0070679_1000454734 600
270 3300025921 Ga0207652_10032186 Ga0207652_100321864 600
271 3300037471 Ga0395905_0083593 Ga0395905_0083593_214_2100 604
272 3300028800 Ga0265338_10001049 Ga0265338_1000104927 610
273 3300028800 Ga0265338_10000807 Ga0265338_1000080730 612
274 3300001904 JGI24736J21556_1002526 JGI24736J21556_10025262 624
275 3300005335 Ga0070666_10000225 Ga0070666_1000022514 624
276 3300025903 Ga0207680_10000659 Ga0207680_1000065919 624
277 3300025904 Ga0207647_10000004 Ga0207647_10000004122 624
278 3300025922 Ga0207646_10063210 Ga0207646_100632103 624
279 3300025986 Ga0207658_10050346 Ga0207658_100503463 624

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01434

Peptidase_M41

Peptidase family M41

407

596

0.98

PF00004

AAA

ATPase family associated with various cellular activities (AAA)

194

327

0.97

PF17862

AAA_lid_3

AAA+ lid domain

349

393

0.96

PF07728

AAA_5

AAA domain (dynein-related subfamily)

193

316

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kw6-assembly1.cif.gz_A crystal structure of a domain of 26s proteasome regulatory subunit 8 from homo sapiens. northeast structural genomics consortium target id hr3102a 0.9674 320 393
2dwz-assembly1.cif.gz_B structure of the oncoprotein gankyrin in complex with s6 atpase of the 26s proteasome 0.9561 323 392
4a3v-assembly2.cif.gz_D yeast regulatory particle proteasome assembly chaperone hsm3 in complex with rpt1 c-terminal fragment 0.9491 320 393
3kw6-assembly1.cif.gz_A crystal structure of a domain of 26s proteasome regulatory subunit 8 from homo sapiens. northeast structural genomics consortium target id hr3102a 0.9426 320 393
3aji-assembly1.cif.gz_B structure of gankyrin-s6atpase photo-cross-linked site-specifically, and incoporated by genetic code expansion 0.9394 323 392
ID Description Score Start End Superfamily
4ww0C02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9946 322 390 1.10.8.60
4ww0B02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9935 323 390 1.10.8.60
3h4mB02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9897 322 392 1.10.8.60
1iy1A02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9891 322 388 1.10.8.60
3h4mC02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9859 322 392 1.10.8.60
ID Description Score Start End GO Terms
AF-A0A7J0EVX7-F1-model_v4 Regulatory particle triple-A ATPase 5A 0.9289 295 393 GO:0005524
GO:0016887
AF-E3NMZ7-F1-model_v4 AAA ATPase AAA+ lid domain-containing protein 0.9284 296 393 GO:0000502
GO:0005634
GO:0005737
AF-A0A7J8Q851-F1-model_v4 AAA ATPase AAA+ lid domain-containing protein 0.9255 296 393
AF-A0A7S3HZY7-F1-model_v4 Peptidase M41 domain-containing protein 0.9146 407 596 GO:0004176
GO:0004222
GO:0005524
GO:0005745
GO:0034982
AF-A0A7S0MWP3-F1-model_v4 Peptidase M41 domain-containing protein 0.9095 428 595 GO:0004176
GO:0004222
GO:0005524
GO:0005745
GO:0034982

Feature Viewer

pLDDT pTM Quality
66.45 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map