F383088

General Info

Members Datasets Scaffolds Average Seq Length
279 124 256 197

Family's Representative Sequence

Representative Sequence 3300015262|Ga0182007_10082606|Ga0182007_100826061
Length 231
Sequence MVRHAWQERHRIGSEKLPLIINFQRPPSGGFFVPEENMAAFAINYLPMTTIKLSGSLAKKFGRIHRRLLDSGRSWEVLKALKYTIAGFEEEIRRLDRLGMRFAIFRNGKNVGFDGFDLAGTREIRIVPVVEGSKRAGILQTILGAVLLVASIWVPALAPAGIALVAGGVLQMLSPQASGLKQSASPENSPSYAFGSAKNTTASGNPVPICIGERRWGGMIISASILAEDKA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231011 Pseudomonas sp. GM30 Isolate Nodule
3 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
4 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
5 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
6 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
7 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
8 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
9 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
10 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
11 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
12 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
13 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
14 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
15 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
16 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
17 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
18 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
19 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
20 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
21 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
29 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
30 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
31 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
32 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
45 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
52 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
56 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
57 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
58 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
59 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
60 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
61 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
62 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
63 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
64 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
65 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
66 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
67 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
68 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
69 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
70 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
71 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
72 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
73 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
74 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
75 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
76 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
77 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
78 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
79 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
80 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
81 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
82 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
83 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
84 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
85 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
86 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
87 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
88 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
89 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
90 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
91 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
92 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
93 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
94 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
95 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
96 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
97 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
98 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
99 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
100 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
101 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
102 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
103 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
104 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
105 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
106 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
107 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
108 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
112 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
113 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
114 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
115 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
116 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
117 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
118 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
119 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
120 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
121 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
122 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
123 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
124 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.76
Metatranscriptomes 0
Isolates 8.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.15
Nodule 1.79
Rhizoplane 1.43
Rhizosphere 79.93
Stem 0
Stem Tuber 0
Unclassified 14.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1803637 2162886007 Bacteria 4199
2 JGI24737J22298_10113019 3300001990 Bacteria 803
3 Ga0055536_1000084 3300003781 Bacteria 80899
4 Ga0055530_10000215 3300003791 Bacteria 52142
5 Ga0055540_1000284 3300003792 Bacteria 45364
6 Ga0065714_10093511 3300005288 Bacteria 1843
7 Ga0065714_10125625 3300005288 Bacteria 1294
8 Ga0065704_10074909 3300005289 Bacteria 5919
9 Ga0070669_100230991 3300005353 Bacteria 1466
10 Ga0099823_1003708 3300006944 Bacteria 14623
11 Ga0079104_1001430 3300006946 Bacteria 16058
12 Ga0105251_10000619 3300009011 Bacteria 32604
13 Ga0105251_10001198 3300009011 Bacteria 22424
14 Ga0105251_10002410 3300009011 Bacteria 14761
15 Ga0105251_10034488 3300009011 Bacteria 2504
16 Ga0105244_10016391 3300009036 Bacteria 4221
17 Ga0105244_10021511 3300009036 Bacteria 3567
18 Ga0105244_10046101 3300009036 Bacteria 2240
19 Ga0105250_10014256 3300009092 Bacteria 3269
20 Ga0105250_10172538 3300009092 Bacteria 906
21 Ga0105246_10003617 3300011119 Bacteria 9351
22 Ga0157373_10004462 3300013100 Bacteria 10533
23 Ga0157373_10023800 3300013100 Bacteria 4437
24 Ga0157373_10060759 3300013100 Viruses 2677
25 Ga0157373_10294480 3300013100 Bacteria 1151
26 Ga0157373_10415761 3300013100 Bacteria 965
27 Ga0157371_10004988 3300013102 Bacteria 11391
28 Ga0157371_10031901 3300013102 Bacteria 3794
29 Ga0157370_10005232 3300013104 Bacteria 14601
30 Ga0157370_10022185 3300013104 Bacteria 6319
31 Ga0157370_10075363 3300013104 Bacteria 3181
32 Ga0157370_10489336 3300013104 Bacteria 1130
33 Ga0157369_10003556 3300013105 Bacteria 18511
34 Ga0157369_10031276 3300013105 Bacteria 5862
35 Ga0163162_10016147 3300013306 Bacteria 7299
36 Ga0157372_10000261 3300013307 Bacteria 58448
37 Ga0157375_10007129 3300013308 Bacteria 9766
38 Ga0182008_10001578 3300014497 Bacteria 15174
39 Ga0182008_10002463 3300014497 Bacteria 11586
40 Ga0182008_10011451 3300014497 Bacteria 4717
41 Ga0182008_10016612 3300014497 Bacteria 3823
42 Ga0182008_10047744 3300014497 Bacteria 2127
43 Ga0182008_10103882 3300014497 Bacteria 1405
44 Ga0182008_10173467 3300014497 Bacteria 1089
45 Ga0182006_1007829 3300015261 Bacteria 4870
46 Ga0182006_1036141 3300015261 Bacteria 1965
47 Ga0182006_1133395 3300015261 Bacteria 853
48 Ga0182007_10000347 3300015262 Bacteria 29423
49 Ga0182007_10008214 3300015262 Bacteria 4302
50 Ga0182007_10082606 3300015262 Bacteria 1054
51 Ga0182005_1000398 3300015265 Bacteria 23727
52 Ga0182005_1000845 3300015265 Bacteria 13707
53 Ga0182005_1002255 3300015265 Bacteria 7076
54 Ga0182005_1004117 3300015265 Bacteria 4756
55 Ga0182005_1016763 3300015265 Bacteria 2033
56 Ga0182005_1018136 3300015265 Bacteria 1946
57 Ga0209130_1018171 3300025284 Bacteria 1657
58 Ga0209050_1008922 3300025298 Bacteria 5238
59 Ga0207696_1034916 3300025711 Bacteria 1499
60 Ga0207696_1079401 3300025711 Bacteria 906
61 Ga0207655_1052354 3300025728 Bacteria 1642
62 Ga0207713_1000085 3300025735 Bacteria 160800
63 Ga0207713_1001793 3300025735 Bacteria 16418
64 Ga0207713_1003531 3300025735 Bacteria 10590
65 Ga0207713_1054134 3300025735 Bacteria 1575
66 Ga0207681_10290586 3300025923 Bacteria 1290
67 Ga0209281_1000015 3300027111 Bacteria 590084
68 Ga0209389_1092114 3300027296 Bacteria 1250
69 Ga0307408_100019162 3300031548 Bacteria 4605
70 Ga0307408_100110332 3300031548 Bacteria 2112
71 Ga0307405_10000075 3300031731 Bacteria 43232
72 Ga0307414_10000292 3300032004 Bacteria 29264
73 Ga0307414_10007252 3300032004 Bacteria 6228
74 Ga0307411_10018670 3300032005 Bacteria 3985
75 Ga0439438_001455 3300041405 Bacteria 10434
76 Ga0439438_012818 3300041405 Bacteria 2554
77 Ga0439447_010588 3300041407 Bacteria 2731
78 Ga0439466_0000036 3300041411 Bacteria 54279
79 Ga0439466_0001110 3300041411 Bacteria 10483
80 Ga0439432_000151 3300042006 Bacteria 23589
81 Ga0439432_000276 3300042006 Bacteria 18534
82 Ga0439451_000359 3300042009 Bacteria 8842
83 Ga0439451_062254 3300042009 Bacteria 746
84 Ga0439452_000241 3300042010 Bacteria 37760
85 Ga0439452_000311 3300042010 Bacteria 31096
86 Ga0439452_002922 3300042010 Bacteria 6096
87 Ga0439452_016922 3300042010 Bacteria 1972
88 Ga0439456_000253 3300042013 Bacteria 13841
89 Ga0439463_000673 3300042016 Bacteria 9485
90 Ga0450904_001888 3300042139 Bacteria 2703
91 Ga0450906_000031 3300042145 Bacteria 22793
92 Ga0495617_001560 3300046452 Bacteria 9929
93 Ga0495617_005419 3300046452 Bacteria 4523
94 Ga0495590_0000110 3300046457 Bacteria 49979
95 Ga0495591_000191 3300046458 Bacteria 62737
96 Ga0495591_000298 3300046458 Bacteria 45382
97 Ga0495591_000333 3300046458 Bacteria 42317
98 Ga0495591_014227 3300046458 Bacteria 2871
99 Ga0495638_0005371 3300046460 Bacteria 9553
100 Ga0495638_0133177 3300046460 Bacteria 1458
101 Ga0495653_0001491 3300046463 Bacteria 18284
102 Ga0495653_0002771 3300046463 Bacteria 13980
103 Ga0495650_0001884 3300046471 Bacteria 18660
104 Ga0495605_0000020 3300046474 Bacteria 254765
105 Ga0495605_0011071 3300046474 Bacteria 5039
106 Ga0495584_0000108 3300046491 Bacteria 56594
107 Ga0495584_0000548 3300046491 Bacteria 25464
108 Ga0495584_0031574 3300046491 Bacteria 2681
109 Ga0495584_0050623 3300046491 Bacteria 2092
110 Ga0495584_0137134 3300046491 Bacteria 1242
111 Ga0495585_0000044 3300046492 Bacteria 123462
112 Ga0495585_0000182 3300046492 Bacteria 66842
113 Ga0495585_0000311 3300046492 Bacteria 48318
114 Ga0495585_0000319 3300046492 Bacteria 47776
115 Ga0495607_0000255 3300046501 Bacteria 57210
116 Ga0495607_0007421 3300046501 Bacteria 7591
117 Ga0495607_0060569 3300046501 Bacteria 2154
118 Ga0495607_0157807 3300046501 Bacteria 1155
119 Ga0495607_0163001 3300046501 Bacteria 1131
120 Ga0495583_0000371 3300046506 Bacteria 69919
121 Ga0495583_0001439 3300046506 Bacteria 24201
122 Ga0495606_0000155 3300046507 Bacteria 119163
123 Ga0495606_0000467 3300046507 Bacteria 66389
124 Ga0495606_0000521 3300046507 Bacteria 62153
125 Ga0495606_0000604 3300046507 Bacteria 56852
126 Ga0495606_0000799 3300046507 Bacteria 48007
127 Ga0495606_0004071 3300046507 Bacteria 14876
128 Ga0495606_0018998 3300046507 Bacteria 5134
129 Ga0495610_0000551 3300046512 Bacteria 37502
130 Ga0495610_0000602 3300046512 Bacteria 35582
131 Ga0495610_0001133 3300046512 Bacteria 24239
132 Ga0495616_0060415 3300046513 Bacteria 1861
133 Ga0495620_0000118 3300046515 Bacteria 63497
134 Ga0495620_0000232 3300046515 Bacteria 41649
135 Ga0495620_0001670 3300046515 Bacteria 13085
136 Ga0495620_0002104 3300046515 Bacteria 11568
137 Ga0495631_0000140 3300046518 Bacteria 49175
138 Ga0495632_0000414 3300046519 Bacteria 40468
139 Ga0495632_0002571 3300046519 Bacteria 13713
140 Ga0495632_0003563 3300046519 Bacteria 10985
141 Ga0495632_0004134 3300046519 Bacteria 9977
142 Ga0495632_0007506 3300046519 Bacteria 6833
143 Ga0495632_0011057 3300046519 Bacteria 5289
144 Ga0495632_0037710 3300046519 Bacteria 2450
145 Ga0495632_0146559 3300046519 Bacteria 1093
146 Ga0495637_0000130 3300046520 Bacteria 55897
147 Ga0495637_0000355 3300046520 Bacteria 34901
148 Ga0495643_0000381 3300046522 Bacteria 58799
149 Ga0495643_0065933 3300046522 Bacteria 1911
150 Ga0495643_0117617 3300046522 Bacteria 1345
151 Ga0495644_0005924 3300046523 Bacteria 4767
152 Ga0495648_0000284 3300046524 Bacteria 57498
153 Ga0495648_0000835 3300046524 Bacteria 32494
154 Ga0495648_0000927 3300046524 Bacteria 30514
155 Ga0495648_0014365 3300046524 Bacteria 5800
156 Ga0495648_0038850 3300046524 Bacteria 3037
157 Ga0495666_0000812 3300046526 Bacteria 14457
158 Ga0495654_0000177 3300046530 Bacteria 62703
159 Ga0495654_0000502 3300046530 Bacteria 32013
160 Ga0495654_0003360 3300046530 Bacteria 9856
161 Ga0495654_0009474 3300046530 Bacteria 5337
162 Ga0495609_0000204 3300046538 Bacteria 58862
163 Ga0495609_0000205 3300046538 Bacteria 58818
164 Ga0495609_0000529 3300046538 Bacteria 30510
165 Ga0495609_0009326 3300046538 Bacteria 4753
166 Ga0495597_0001973 3300046542 Bacteria 13777
167 Ga0495597_0008534 3300046542 Bacteria 5128
168 Ga0495597_0079356 3300046542 Bacteria 1406
169 Ga0495622_0000877 3300046557 Bacteria 16456
170 Ga0495622_0001417 3300046557 Bacteria 12117
171 Ga0495668_0002338 3300046616 Bacteria 15791
172 Ga0495668_0026235 3300046616 Bacteria 3307
173 Ga0495611_0062367 3300046648 Bacteria 1696
174 Ga0495625_0000790 3300046660 Bacteria 43942
175 Ga0495625_0001690 3300046660 Bacteria 25714
176 Ga0495661_0002199 3300046665 Bacteria 15206
177 Ga0495661_0012961 3300046665 Bacteria 5615
178 Ga0495670_0042084 3300046691 Bacteria 2279
179 Ga0495670_0123596 3300046691 Bacteria 1345
180 Ga0495670_0299890 3300046691 Bacteria 861
181 Ga0495671_0000156 3300046692 Bacteria 59948
182 Ga0495671_0000769 3300046692 Bacteria 23059
183 Ga0495671_0001234 3300046692 Bacteria 17527
184 Ga0495671_0001649 3300046692 Bacteria 14611
185 Ga0495649_0000103 3300046694 Bacteria 75113
186 Ga0495649_0000626 3300046694 Bacteria 29126
187 Ga0495649_0004605 3300046694 Bacteria 8970
188 Ga0495649_0012540 3300046694 Bacteria 4924
189 Ga0495649_0124269 3300046694 Bacteria 1363
190 Ga0495600_0004182 3300046809 Bacteria 8611
191 Ga0495660_0000487 3300046810 Bacteria 33011
192 Ga0495660_0001020 3300046810 Bacteria 20338
193 Ga0495660_0001051 3300046810 Bacteria 19980
194 Ga0495660_0009899 3300046810 Bacteria 5547
195 Ga0495660_0136854 3300046810 Bacteria 1223
196 Ga0495672_0000268 3300047320 Bacteria 72131
197 Ga0495672_0000318 3300047320 Bacteria 64020
198 Ga0495672_0000426 3300047320 Bacteria 50522
199 Ga0495672_0000762 3300047320 Bacteria 35095
200 Ga0495672_0012584 3300047320 Bacteria 5896
201 Ga0495672_0081029 3300047320 Bacteria 1809
202 Ga0495672_0122936 3300047320 Bacteria 1377
203 Ga0495676_0000066 3300047321 Bacteria 80666
204 Ga0495683_0000065 3300047323 Bacteria 112239
205 Ga0495683_0000887 3300047323 Bacteria 21089
206 Ga0495683_0001214 3300047323 Bacteria 17559
207 Ga0495683_0074026 3300047323 Bacteria 1670
208 Ga0495679_000134 3300047446 Bacteria 65887
209 Ga0495679_001345 3300047446 Bacteria 14194
210 Ga0495673_0000732 3300047469 Bacteria 31449
211 Ga0495673_0000764 3300047469 Bacteria 30514
212 Ga0495673_0000897 3300047469 Bacteria 27364
213 Ga0495673_0000936 3300047469 Bacteria 26471
214 Ga0495673_0003585 3300047469 Bacteria 10187
215 Ga0495673_0006075 3300047469 Bacteria 7170
216 Ga0495673_0073700 3300047469 Bacteria 1430
217 Ga0495681_0002245 3300047470 Bacteria 13902
218 Ga0495626_0000690 3300048091 Bacteria 32282
219 Ga0495626_0000825 3300048091 Bacteria 27823
220 Ga0496113_0233559 3300048916 Bacteria 1467
221 Ga0496113_0781054 3300048916 Bacteria 759
222 Ga0496117_0000604 3300048920 Bacteria 58763
223 Ga0496117_0000646 3300048920 Bacteria 56027
224 Ga0496117_0002562 3300048920 Bacteria 22621
225 Ga0496118_0000613 3300048921 Bacteria 58782
226 Ga0496118_0000986 3300048921 Bacteria 44325
227 Ga0496118_0003030 3300048921 Bacteria 21690
228 Ga0496119_0000152 3300048922 Bacteria 96200
229 Ga0496119_0014866 3300048922 Bacteria 6052
230 Ga0496120_0000855 3300048923 Bacteria 43066
231 Ga0496120_0001575 3300048923 Bacteria 26662
232 Ga0496121_0001514 3300048924 Bacteria 38991
233 Ga0496122_0000175 3300048925 Bacteria 153295
234 Ga0496122_0000954 3300048925 Bacteria 52237
235 Ga0496122_0002189 3300048925 Bacteria 28583
236 Ga0496122_0024193 3300048925 Bacteria 5321
237 Ga0496122_0071717 3300048925 Bacteria 2467
238 Ga0496122_0245151 3300048925 Bacteria 1007
239 Ga0496123_0000079 3300048926 Bacteria 191201
240 Ga0496123_0000758 3300048926 Bacteria 52244
241 Ga0496123_0001739 3300048926 Bacteria 28807
242 Ga0496123_0008323 3300048926 Bacteria 9549
243 Ga0496124_0005837 3300048927 Bacteria 13665
244 Ga0496124_0010523 3300048927 Bacteria 9357
245 Ga0496125_0000665 3300048928 Bacteria 57218
246 Ga0496125_0001262 3300048928 Bacteria 37739
247 Ga0496125_0003703 3300048928 Bacteria 18244
248 Ga0496126_0002891 3300048929 Bacteria 22401
249 Ga0496126_0336946 3300048929 Bacteria 1236
250 Ga0495682_0000079 3300049460 Bacteria 85081
251 Ga0495682_0000123 3300049460 Bacteria 67837
252 Ga0495682_0000143 3300049460 Bacteria 62210
253 Ga0495682_0000931 3300049460 Bacteria 17738
254 Ga0495682_0001790 3300049460 Bacteria 10838
255 Ga0495682_0036252 3300049460 Bacteria 1816
256 Ga0500618_000702 3300053125 Bacteria 19673

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042006 Ga0439432_000151 Ga0439432_000151_11778_12359 175
2 3300046492 Ga0495585_0000182 Ga0495585_0000182_12232_12813 175
3 3300048927 Ga0496124_0010523 Ga0496124_0010523_1334_1915 175
4 3300046501 Ga0495607_0007421 Ga0495607_0007421_1599_2219 176
5 3300046530 Ga0495654_0000177 Ga0495654_0000177_43484_44062 177
6 3300046616 Ga0495668_0002338 Ga0495668_0002338_11183_11761 177
7 3300014497 Ga0182008_10047744 Ga0182008_100477444 178
8 3300015261 Ga0182006_1133395 Ga0182006_11333951 178
9 3300046463 Ga0495653_0001491 Ga0495653_0001491_12258_12947 178
10 3300046691 Ga0495670_0299890 Ga0495670_0299890_166_735 178
11 3300047469 Ga0495673_0000732 Ga0495673_0000732_20581_21150 178
12 3300046458 Ga0495591_000191 Ga0495591_000191_12031_12693 180
13 3300046530 Ga0495654_0009474 Ga0495654_0009474_1046_1708 180
14 3300009092 Ga0105250_10172538 Ga0105250_101725382 181
15 3300013102 Ga0157371_10031901 Ga0157371_100319012 181
16 3300013105 Ga0157369_10031276 Ga0157369_100312762 181
17 3300025711 Ga0207696_1079401 Ga0207696_10794011 181
18 3300046458 Ga0495591_000298 Ga0495591_000298_10832_11470 182
19 3300046519 Ga0495632_0037710 Ga0495632_0037710_313_921 182
20 3300046519 Ga0495632_0146559 Ga0495632_0146559_308_916 182
21 3300046530 Ga0495654_0000502 Ga0495654_0000502_22434_23042 182
22 3300046557 Ga0495622_0001417 Ga0495622_0001417_5475_6083 182
23 3300046810 Ga0495660_0136854 Ga0495660_0136854_260_841 182
24 3300047323 Ga0495683_0000887 Ga0495683_0000887_9783_10391 182
25 3300047446 Ga0495679_001345 Ga0495679_001345_7128_7748 182
26 3300005353 Ga0070669_100230991 Ga0070669_1002309912 183
27 3300014497 Ga0182008_10011451 Ga0182008_100114513 183
28 3300015261 Ga0182006_1036141 Ga0182006_10361412 183
29 3300015262 Ga0182007_10008214 Ga0182007_100082142 183
30 3300015265 Ga0182005_1004117 Ga0182005_10041176 183
31 3300031548 Ga0307408_100110332 Ga0307408_1001103323 183
32 3300032005 Ga0307411_10018670 Ga0307411_100186702 183
33 3300041411 Ga0439466_0000036 Ga0439466_0000036_44024_44584 183
34 3300042009 Ga0439451_000359 Ga0439451_000359_7906_8466 183
35 3300042010 Ga0439452_000241 Ga0439452_000241_10305_10865 183
36 3300046457 Ga0495590_0000110 Ga0495590_0000110_8552_9112 183
37 3300046491 Ga0495584_0000108 Ga0495584_0000108_18135_18695 183
38 3300046501 Ga0495607_0060569 Ga0495607_0060569_552_1112 183
39 3300046507 Ga0495606_0000604 Ga0495606_0000604_46632_47192 183
40 3300046520 Ga0495637_0000130 Ga0495637_0000130_2277_2837 183
41 3300046530 Ga0495654_0003360 Ga0495654_0003360_5897_6457 183
42 3300046538 Ga0495609_0000205 Ga0495609_0000205_48512_49072 183
43 3300046542 Ga0495597_0001973 Ga0495597_0001973_10939_11499 183
44 3300046691 Ga0495670_0123596 Ga0495670_0123596_508_1068 183
45 3300046692 Ga0495671_0000769 Ga0495671_0000769_3662_4270 183
46 3300046694 Ga0495649_0012540 Ga0495649_0012540_4052_4612 183
47 3300047320 Ga0495672_0000268 Ga0495672_0000268_61825_62385 183
48 3300048922 Ga0496119_0000152 Ga0496119_0000152_41218_41778 183
49 3300048923 Ga0496120_0000855 Ga0496120_0000855_26040_26600 183
50 3300031548 Ga0307408_100019162 Ga0307408_1000191623 184
51 3300032004 Ga0307414_10007252 Ga0307414_100072523 184
52 3300041407 Ga0439447_010588 Ga0439447_010588_200_763 184
53 3300042006 Ga0439432_000276 Ga0439432_000276_4049_4612 184
54 3300042145 Ga0450906_000031 Ga0450906_000031_10577_11140 184
55 3300046452 Ga0495617_005419 Ga0495617_005419_2824_3498 184
56 3300046491 Ga0495584_0031574 Ga0495584_0031574_987_1661 184
57 3300046501 Ga0495607_0157807 Ga0495607_0157807_341_970 184
58 3300046507 Ga0495606_0000799 Ga0495606_0000799_34310_34984 184
59 3300046542 Ga0495597_0079356 Ga0495597_0079356_593_1219 184
60 3300046692 Ga0495671_0001234 Ga0495671_0001234_12637_13311 184
61 3300047469 Ga0495673_0000936 Ga0495673_0000936_12961_13575 184
62 3300049460 Ga0495682_0000931 Ga0495682_0000931_15694_16290 184
63 3300049460 Ga0495682_0036252 Ga0495682_0036252_1145_1798 184
64 iso_pu_bacteria 2919385768 2919390336 184
65 3300013100 Ga0157373_10023800 Ga0157373_100238003 185
66 3300013100 Ga0157373_10415761 Ga0157373_104157612 185
67 3300014497 Ga0182008_10103882 Ga0182008_101038823 185
68 3300046460 Ga0495638_0005371 Ga0495638_0005371_4959_5561 185
69 3300046463 Ga0495653_0002771 Ga0495653_0002771_10905_11501 185
70 3300046491 Ga0495584_0137134 Ga0495584_0137134_188_754 185
71 3300046507 Ga0495606_0018998 Ga0495606_0018998_380_988 185
72 3300046515 Ga0495620_0000118 Ga0495620_0000118_25139_25705 185
73 3300046524 Ga0495648_0000284 Ga0495648_0000284_10028_10630 185
74 3300046538 Ga0495609_0009326 Ga0495609_0009326_164_730 185
75 3300047321 Ga0495676_0000066 Ga0495676_0000066_76399_77082 185
76 3300047323 Ga0495683_0001214 Ga0495683_0001214_10296_10979 185
77 3300047469 Ga0495673_0003585 Ga0495673_0003585_6564_7247 185
78 3300049460 Ga0495682_0000123 Ga0495682_0000123_15635_16201 185
79 iso_pu_bacteria 2619619299 2621298651 185
80 iso_pu_bacteria 2643221713 2644621777 185
81 3300013308 Ga0157375_10007129 Ga0157375_1000712910 186
82 3300015265 Ga0182005_1016763 Ga0182005_10167631 186
83 3300046512 Ga0495610_0000602 Ga0495610_0000602_20914_21483 186
84 3300046538 Ga0495609_0000529 Ga0495609_0000529_11968_12537 186
85 3300048091 Ga0495626_0000825 Ga0495626_0000825_10300_10869 186
86 iso_pu_bacteria 2597489889 2597868359 186
87 iso_pu_bacteria 2908446538 2908448008 186
88 3300013100 Ga0157373_10294480 Ga0157373_102944801 187
89 3300013104 Ga0157370_10075363 Ga0157370_100753632 187
90 3300013105 Ga0157369_10003556 Ga0157369_1000355614 187
91 3300014497 Ga0182008_10002463 Ga0182008_100024635 187
92 3300015261 Ga0182006_1007829 Ga0182006_10078296 187
93 3300046501 Ga0495607_0163001 Ga0495607_0163001_259_885 187
94 3300046515 Ga0495620_0001670 Ga0495620_0001670_6319_6927 187
95 3300046522 Ga0495643_0065933 Ga0495643_0065933_886_1494 187
96 3300046542 Ga0495597_0008534 Ga0495597_0008534_826_1434 187
97 3300046810 Ga0495660_0001020 Ga0495660_0001020_10827_11435 187
98 3300047469 Ga0495673_0006075 Ga0495673_0006075_3361_3987 187
99 iso_pu_bacteria 2600255283 2601626830 187
100 iso_pu_bacteria 2643221633 2644185726 187
101 3300041405 Ga0439438_001455 Ga0439438_001455_3135_3764 188
102 3300048927 Ga0496124_0005837 Ga0496124_0005837_12452_13081 188
103 3300009011 Ga0105251_10001198 Ga0105251_100011982 189
104 3300025735 Ga0207713_1001793 Ga0207713_100179324 189
105 3300046694 Ga0495649_0000626 Ga0495649_0000626_10183_10761 189
106 3300048920 Ga0496117_0002562 Ga0496117_0002562_18567_19145 189
107 3300048921 Ga0496118_0003030 Ga0496118_0003030_2702_3280 189
108 3300048925 Ga0496122_0000954 Ga0496122_0000954_12640_13218 189
109 3300048925 Ga0496122_0002189 Ga0496122_0002189_16610_17188 189
110 3300048926 Ga0496123_0000758 Ga0496123_0000758_39019_39597 189
111 3300048926 Ga0496123_0001739 Ga0496123_0001739_16707_17285 189
112 3300048928 Ga0496125_0000665 Ga0496125_0000665_16909_17487 189
113 3300048928 Ga0496125_0001262 Ga0496125_0001262_10511_11089 189
114 3300048928 Ga0496125_0003703 Ga0496125_0003703_3457_4035 189
115 iso_pu_bacteria 2600254931 2600362602 189
116 iso_pu_bacteria 2791355520 2794597435 189
117 iso_pu_bacteria 3007866637 3007869518 189
118 iso_pu_bacteria 8056115690 8056120118 189
119 3300003781 Ga0055536_1000084 Ga0055536_100008454 190
120 3300003791 Ga0055530_10000215 Ga0055530_1000021523 190
121 3300003792 Ga0055540_1000284 Ga0055540_100028449 190
122 3300009036 Ga0105244_10016391 Ga0105244_100163916 190
123 3300013102 Ga0157371_10004988 Ga0157371_100049883 190
124 3300025284 Ga0209130_1018171 Ga0209130_10181712 190
125 3300046452 Ga0495617_001560 Ga0495617_001560_3042_3623 190
126 3300046491 Ga0495584_0000548 Ga0495584_0000548_6599_7180 190
127 3300046519 Ga0495632_0003563 Ga0495632_0003563_310_891 190
128 3300046526 Ga0495666_0000812 Ga0495666_0000812_13278_13859 190
129 3300046665 Ga0495661_0002199 Ga0495661_0002199_10388_10969 190
130 3300047320 Ga0495672_0000318 Ga0495672_0000318_25287_25868 190
131 3300048091 Ga0495626_0000690 Ga0495626_0000690_11196_11777 190
132 iso_pu_bacteria 8056148874 8056149392 190
133 3300009011 Ga0105251_10034488 Ga0105251_100344884 191
134 3300009036 Ga0105244_10021511 Ga0105244_100215112 191
135 3300013104 Ga0157370_10489336 Ga0157370_104893362 191
136 3300015262 Ga0182007_10082606 Ga0182007_100826061 191
137 3300015265 Ga0182005_1018136 Ga0182005_10181361 191
138 3300025735 Ga0207713_1054134 Ga0207713_10541342 191
139 3300041411 Ga0439466_0001110 Ga0439466_0001110_4621_5205 191
140 3300042010 Ga0439452_016922 Ga0439452_016922_1070_1654 191
141 3300042016 Ga0439463_000673 Ga0439463_000673_6701_7285 191
142 3300046458 Ga0495591_000333 Ga0495591_000333_30368_30952 191
143 3300046492 Ga0495585_0000319 Ga0495585_0000319_34194_34793 191
144 3300046519 Ga0495632_0002571 Ga0495632_0002571_8714_9406 191
145 3300047323 Ga0495683_0074026 Ga0495683_0074026_301_900 191
146 3300047446 Ga0495679_000134 Ga0495679_000134_21918_22517 191
147 3300047469 Ga0495673_0073700 Ga0495673_0073700_379_978 191
148 3300048916 Ga0496113_0233559 Ga0496113_0233559_377_1039 191
149 3300048925 Ga0496122_0000175 Ga0496122_0000175_78461_79123 191
150 3300048926 Ga0496123_0000079 Ga0496123_0000079_74187_74849 191
151 iso_pu_bacteria 2511231011 2511296049 191
152 iso_pu_bacteria 2880230671 2880233246 191
153 3300015265 Ga0182005_1000845 Ga0182005_10008459 192
154 3300031731 Ga0307405_10000075 Ga0307405_1000007573 192
155 3300032004 Ga0307414_10000292 Ga0307414_1000029214 192
156 3300046519 Ga0495632_0004134 Ga0495632_0004134_1628_2215 192
157 3300001990 JGI24737J22298_10113019 JGI24737J22298_101130191 193
158 3300005288 Ga0065714_10125625 Ga0065714_101256252 193
159 3300006944 Ga0099823_1003708 Ga0099823_100370824 193
160 3300013100 Ga0157373_10060759 Ga0157373_100607593 193
161 3300014497 Ga0182008_10016612 Ga0182008_100166122 193
162 3300014497 Ga0182008_10173467 Ga0182008_101734671 193
163 3300025923 Ga0207681_10290586 Ga0207681_102905862 193
164 3300027296 Ga0209389_1092114 Ga0209389_10921142 193
165 3300042009 Ga0439451_062254 Ga0439451_062254_72_662 193
166 3300042010 Ga0439452_002922 Ga0439452_002922_2010_2642 193
167 3300042013 Ga0439456_000253 Ga0439456_000253_2758_3348 193
168 3300046492 Ga0495585_0000044 Ga0495585_0000044_21080_21670 193
169 3300046507 Ga0495606_0000155 Ga0495606_0000155_13027_13617 193
170 3300046512 Ga0495610_0001133 Ga0495610_0001133_10174_10812 193
171 3300046515 Ga0495620_0000232 Ga0495620_0000232_27835_28425 193
172 3300046557 Ga0495622_0000877 Ga0495622_0000877_5202_5834 193
173 3300048925 Ga0496122_0245151 Ga0496122_0245151_165_755 193
174 iso_pu_bacteria 2939651529 2939652742 193
175 3300013100 Ga0157373_10004462 Ga0157373_100044623 194
176 3300014497 Ga0182008_10001578 Ga0182008_100015789 194
177 iso_pu_bacteria 2919155634 2919159191 194
178 3300009011 Ga0105251_10000619 Ga0105251_1000061915 195
179 3300013307 Ga0157372_10000261 Ga0157372_1000026114 195
180 3300025735 Ga0207713_1000085 Ga0207713_100008547 195
181 3300046471 Ga0495650_0001884 Ga0495650_0001884_7979_8575 195
182 3300046506 Ga0495583_0000371 Ga0495583_0000371_23675_24274 195
183 3300046506 Ga0495583_0001439 Ga0495583_0001439_16425_17036 195
184 3300046512 Ga0495610_0000551 Ga0495610_0000551_26310_26906 195
185 3300046513 Ga0495616_0060415 Ga0495616_0060415_624_1223 195
186 3300046518 Ga0495631_0000140 Ga0495631_0000140_44992_45591 195
187 3300046519 Ga0495632_0011057 Ga0495632_0011057_3686_4285 195
188 3300046523 Ga0495644_0005924 Ga0495644_0005924_2613_3212 195
189 3300046524 Ga0495648_0014365 Ga0495648_0014365_540_1139 195
190 3300046694 Ga0495649_0000103 Ga0495649_0000103_63907_64503 195
191 3300046694 Ga0495649_0004605 Ga0495649_0004605_1174_1773 195
192 3300046810 Ga0495660_0009899 Ga0495660_0009899_3171_3770 195
193 3300047320 Ga0495672_0000762 Ga0495672_0000762_8526_9125 195
194 3300047469 Ga0495673_0000897 Ga0495673_0000897_19832_20431 195
195 3300048916 Ga0496113_0781054 Ga0496113_0781054_94_690 195
196 3300048920 Ga0496117_0000646 Ga0496117_0000646_33914_34510 195
197 3300048921 Ga0496118_0000986 Ga0496118_0000986_21655_22251 195
198 3300048922 Ga0496119_0014866 Ga0496119_0014866_219_815 195
199 3300048923 Ga0496120_0001575 Ga0496120_0001575_9795_10391 195
200 3300048924 Ga0496121_0001514 Ga0496121_0001514_21431_22027 195
201 3300048925 Ga0496122_0024193 Ga0496122_0024193_4016_4612 195
202 3300048925 Ga0496122_0071717 Ga0496122_0071717_1342_1938 195
203 3300048926 Ga0496123_0008323 Ga0496123_0008323_1641_2237 195
204 3300049460 Ga0495682_0000143 Ga0495682_0000143_16100_16696 195
205 iso_pu_bacteria 2842832357 2842835476 195
206 iso_pu_bacteria 2974289157 2974291147 195
207 iso_pu_bacteria 8029995093 8029998623 195
208 3300009011 Ga0105251_10002410 Ga0105251_100024107 196
209 3300025735 Ga0207713_1003531 Ga0207713_100353114 196
210 3300046458 Ga0495591_014227 Ga0495591_014227_733_1380 196
211 3300046515 Ga0495620_0002104 Ga0495620_0002104_8352_8951 196
212 3300046522 Ga0495643_0117617 Ga0495643_0117617_65_664 196
213 3300046648 Ga0495611_0062367 Ga0495611_0062367_724_1407 196
214 3300046810 Ga0495660_0001051 Ga0495660_0001051_10011_10610 196
215 3300053125 Ga0500618_000702 Ga0500618_000702_5657_6265 196
216 iso_pu_bacteria 2643221713 2644622679 196
217 iso_pu_bacteria 2738541265 2738672432 196
218 iso_pu_bacteria 2738541282 2738750825 196
219 iso_pu_bacteria 2738541303 2738859866 196
220 3300009036 Ga0105244_10046101 Ga0105244_100461013 197
221 3300009092 Ga0105250_10014256 Ga0105250_100142562 197
222 3300025711 Ga0207696_1034916 Ga0207696_10349162 197
223 3300025728 Ga0207655_1052354 Ga0207655_10523542 197
224 3300046519 Ga0495632_0000414 Ga0495632_0000414_19388_19990 197
225 3300046692 Ga0495671_0000156 Ga0495671_0000156_8723_9352 197
226 3300048929 Ga0496126_0336946 Ga0496126_0336946_432_1034 197
227 3300049460 Ga0495682_0000079 Ga0495682_0000079_22765_23367 197
228 3300046665 Ga0495661_0012961 Ga0495661_0012961_1959_2567 198
229 3300046692 Ga0495671_0001649 Ga0495671_0001649_10105_10710 198
230 3300047320 Ga0495672_0012584 Ga0495672_0012584_2047_2652 198
231 3300005288 Ga0065714_10093511 Ga0065714_100935112 199
232 3300006946 Ga0079104_1001430 Ga0079104_10014303 199
233 3300013104 Ga0157370_10022185 Ga0157370_100221858 199
234 3300013306 Ga0163162_10016147 Ga0163162_100161472 199
235 3300015265 Ga0182005_1002255 Ga0182005_10022559 199
236 3300025298 Ga0209050_1008922 Ga0209050_10089222 199
237 3300027111 Ga0209281_1000015 Ga0209281_1000015509 199
238 3300041405 Ga0439438_012818 Ga0439438_012818_147_755 199
239 3300042010 Ga0439452_000311 Ga0439452_000311_14647_15255 199
240 3300042139 Ga0450904_001888 Ga0450904_001888_2049_2657 199
241 3300046460 Ga0495638_0133177 Ga0495638_0133177_360_968 199
242 3300046474 Ga0495605_0011071 Ga0495605_0011071_1152_1760 199
243 3300046491 Ga0495584_0050623 Ga0495584_0050623_510_1175 199
244 3300046492 Ga0495585_0000311 Ga0495585_0000311_36673_37341 199
245 3300046507 Ga0495606_0000467 Ga0495606_0000467_10386_10994 199
246 3300046507 Ga0495606_0000521 Ga0495606_0000521_41606_42220 199
247 3300046507 Ga0495606_0004071 Ga0495606_0004071_2150_2842 199
248 3300046519 Ga0495632_0007506 Ga0495632_0007506_936_1544 199
249 3300046520 Ga0495637_0000355 Ga0495637_0000355_9482_10150 199
250 3300046524 Ga0495648_0000927 Ga0495648_0000927_7210_7818 199
251 3300046538 Ga0495609_0000204 Ga0495609_0000204_11104_11712 199
252 3300046616 Ga0495668_0026235 Ga0495668_0026235_1620_2228 199
253 3300046660 Ga0495625_0000790 Ga0495625_0000790_10635_11243 199
254 3300046660 Ga0495625_0001690 Ga0495625_0001690_2472_3080 199
255 3300046691 Ga0495670_0042084 Ga0495670_0042084_1556_2164 199
256 3300046694 Ga0495649_0124269 Ga0495649_0124269_313_981 199
257 3300046809 Ga0495600_0004182 Ga0495600_0004182_851_1459 199
258 3300046810 Ga0495660_0000487 Ga0495660_0000487_7095_7703 199
259 3300047320 Ga0495672_0000426 Ga0495672_0000426_7044_7652 199
260 3300047320 Ga0495672_0122936 Ga0495672_0122936_118_762 199
261 3300047323 Ga0495683_0000065 Ga0495683_0000065_32542_33156 199
262 3300047469 Ga0495673_0000764 Ga0495673_0000764_7210_7818 199
263 3300047470 Ga0495681_0002245 Ga0495681_0002245_9277_9945 199
264 3300048920 Ga0496117_0000604 Ga0496117_0000604_42359_42967 199
265 3300048921 Ga0496118_0000613 Ga0496118_0000613_42359_42967 199
266 3300049460 Ga0495682_0001790 Ga0495682_0001790_2691_3299 199
267 2162886007 SwRhRL2b_contig_1803637 SwRhRL2b_0351.00006090 200
268 3300005289 Ga0065704_10074909 Ga0065704_100749093 200
269 3300011119 Ga0105246_10003617 Ga0105246_100036174 200
270 3300013104 Ga0157370_10005232 Ga0157370_1000523218 200
271 3300015262 Ga0182007_10000347 Ga0182007_1000034719 200
272 3300015265 Ga0182005_1000398 Ga0182005_100039820 200
273 3300046474 Ga0495605_0000020 Ga0495605_0000020_147481_148131 200
274 3300046501 Ga0495607_0000255 Ga0495607_0000255_24250_24900 200
275 3300046522 Ga0495643_0000381 Ga0495643_0000381_9787_10437 200
276 3300046524 Ga0495648_0000835 Ga0495648_0000835_7567_8169 200
277 3300046524 Ga0495648_0038850 Ga0495648_0038850_585_1235 200
278 3300047320 Ga0495672_0081029 Ga0495672_0081029_700_1350 200
279 3300048929 Ga0496126_0002891 Ga0496126_0002891_9863_10465 200

Feature Viewer

pLDDT pTM Quality
53.62 0.4 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map