F383010
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 279 | 208 | 277 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10894411|Ga0105240_108944111 |
| Length | 232 |
| Sequence | VDQVTVLVDGVGDGQQTLTQPGQVGDPDPGVALDPADPLADPPNPVSAWNIANALTVFRLVLVPVFLVLLFHGTGTQTGWRLAAAVVFAAACITDRFDGDIARRRGLVTEFGKLADPLADKALVGASLIGLSALGELPWWVTVVILIREVGVTGLRFWVIRHGVLPASRGGKLKTLLQTVAIGLFVLPPWGWLRDAAWVVMIAAIVVALVTGADYVQRATTLHRVPRRSRTS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 2 | 2857710386 | Brevibacterium sp. R-73093 | Isolate | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 134 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 135 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 136 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 137 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 138 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 139 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 140 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 141 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 142 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 143 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 144 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 145 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 149 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 150 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 151 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 152 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 153 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 154 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 155 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 156 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 157 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 158 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 159 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 160 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 161 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 162 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 163 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 164 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 181 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 182 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 183 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 184 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 185 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 187 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 188 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 189 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 190 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 191 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 192 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 193 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 194 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.85 |
| Metatranscriptomes | 1.43 |
| Isolates | 0.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.66 |
| Rhizosphere | 93.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10317689 | 3300005327 | Bacteria | 1330 |
| 2 | Ga0070683_100550851 | 3300005329 | Bacteria | 1103 |
| 3 | Ga0070690_100085376 | 3300005330 | Bacteria | 2070 |
| 4 | Ga0068869_100082592 | 3300005334 | Bacteria | 2401 |
| 5 | Ga0070666_10021777 | 3300005335 | Bacteria | 4155 |
| 6 | Ga0070680_100155177 | 3300005336 | Bacteria | 1923 |
| 7 | Ga0070682_100039808 | 3300005337 | Bacteria | 2889 |
| 8 | Ga0068868_100015814 | 3300005338 | Bacteria | 5590 |
| 9 | Ga0070691_10045448 | 3300005341 | Bacteria | 2084 |
| 10 | Ga0070687_100015051 | 3300005343 | Bacteria | 3488 |
| 11 | Ga0070661_100359471 | 3300005344 | Bacteria | 1144 |
| 12 | Ga0070668_100009441 | 3300005347 | Bacteria | 7239 |
| 13 | Ga0070675_100582233 | 3300005354 | Bacteria | 1014 |
| 14 | Ga0070671_100111615 | 3300005355 | Bacteria | 2297 |
| 15 | Ga0070673_100012205 | 3300005364 | Bacteria | 5891 |
| 16 | Ga0070688_100129369 | 3300005365 | Bacteria | 1701 |
| 17 | Ga0070659_100040312 | 3300005366 | Bacteria | 3648 |
| 18 | Ga0070659_100575508 | 3300005366 | Bacteria | 966 |
| 19 | Ga0070667_100426352 | 3300005367 | Bacteria | 1210 |
| 20 | Ga0070709_10003958 | 3300005434 | Bacteria | 7983 |
| 21 | Ga0070709_10078308 | 3300005434 | Bacteria | 2150 |
| 22 | Ga0070714_100075248 | 3300005435 | Bacteria | 2929 |
| 23 | Ga0070713_100747476 | 3300005436 | Bacteria | 935 |
| 24 | Ga0070710_10035002 | 3300005437 | Bacteria | 2735 |
| 25 | Ga0070701_10064172 | 3300005438 | Bacteria | 1945 |
| 26 | Ga0070711_100009145 | 3300005439 | Bacteria | 6089 |
| 27 | Ga0070711_100243810 | 3300005439 | Bacteria | 1406 |
| 28 | Ga0070705_100009314 | 3300005440 | Bacteria | 4879 |
| 29 | Ga0070678_100065052 | 3300005456 | Bacteria | 2705 |
| 30 | Ga0070662_100035816 | 3300005457 | Bacteria | 3507 |
| 31 | Ga0070706_100001191 | 3300005467 | Bacteria | 27870 |
| 32 | Ga0070707_100307372 | 3300005468 | Bacteria | 1541 |
| 33 | Ga0070707_100785111 | 3300005468 | Bacteria | 916 |
| 34 | Ga0070698_100055911 | 3300005471 | Bacteria | 4000 |
| 35 | Ga0070699_100188411 | 3300005518 | Bacteria | 1832 |
| 36 | Ga0070697_100175897 | 3300005536 | Bacteria | 1813 |
| 37 | Ga0068853_100076131 | 3300005539 | Bacteria | 2929 |
| 38 | Ga0070672_100524323 | 3300005543 | Bacteria | 1027 |
| 39 | Ga0070686_100235753 | 3300005544 | Bacteria | 1330 |
| 40 | Ga0070696_100038624 | 3300005546 | Bacteria | 3295 |
| 41 | Ga0070693_100006791 | 3300005547 | Bacteria | 5557 |
| 42 | Ga0070665_100618509 | 3300005548 | Bacteria | 1096 |
| 43 | Ga0070704_100145473 | 3300005549 | Bacteria | 1857 |
| 44 | Ga0068855_100014218 | 3300005563 | Bacteria | 9588 |
| 45 | Ga0068855_100353768 | 3300005563 | Bacteria | 1618 |
| 46 | Ga0068857_100309472 | 3300005577 | Bacteria | 1457 |
| 47 | Ga0068854_100052653 | 3300005578 | Bacteria | 2920 |
| 48 | Ga0068856_100013653 | 3300005614 | Bacteria | 7856 |
| 49 | Ga0068856_100029557 | 3300005614 | Bacteria | 5353 |
| 50 | Ga0068856_100119702 | 3300005614 | Bacteria | 2634 |
| 51 | Ga0070702_100056114 | 3300005615 | Bacteria | 2273 |
| 52 | Ga0068852_100010992 | 3300005616 | Bacteria | 6790 |
| 53 | Ga0068852_100012840 | 3300005616 | Bacteria | 6384 |
| 54 | Ga0068859_100003150 | 3300005617 | Bacteria | 16776 |
| 55 | Ga0068859_100044854 | 3300005617 | Bacteria | 4442 |
| 56 | Ga0068864_100038934 | 3300005618 | Bacteria | 4062 |
| 57 | Ga0068866_10018872 | 3300005718 | Bacteria | 3128 |
| 58 | Ga0068861_100033783 | 3300005719 | Bacteria | 3777 |
| 59 | Ga0068870_10131102 | 3300005840 | Bacteria | 1456 |
| 60 | Ga0068863_100134297 | 3300005841 | Bacteria | 2364 |
| 61 | Ga0068862_100587163 | 3300005844 | Bacteria | 1068 |
| 62 | Ga0081540_1001908 | 3300005983 | Bacteria | 17461 |
| 63 | Ga0070717_10014302 | 3300006028 | Bacteria | 6104 |
| 64 | Ga0070715_10038727 | 3300006163 | Bacteria | 1981 |
| 65 | Ga0070716_100002348 | 3300006173 | Bacteria | 8706 |
| 66 | Ga0070716_100195942 | 3300006173 | Bacteria | 1339 |
| 67 | Ga0070712_100073735 | 3300006175 | Bacteria | 2449 |
| 68 | Ga0070712_100888167 | 3300006175 | Bacteria | 768 |
| 69 | Ga0097621_100026425 | 3300006237 | Bacteria | 4554 |
| 70 | Ga0068871_100121718 | 3300006358 | Bacteria | 2205 |
| 71 | Ga0075433_10007638 | 3300006852 | Bacteria | 8587 |
| 72 | Ga0075434_100010843 | 3300006871 | Bacteria | 8565 |
| 73 | Ga0068865_100130822 | 3300006881 | Bacteria | 1880 |
| 74 | Ga0075436_100045626 | 3300006914 | Bacteria | 3023 |
| 75 | Ga0097620_100003150 | 3300006931 | Bacteria | 16776 |
| 76 | Ga0097620_100044854 | 3300006931 | Bacteria | 4442 |
| 77 | Ga0075435_100256801 | 3300007076 | Bacteria | 1488 |
| 78 | Ga0105240_10291695 | 3300009093 | Bacteria | 1870 |
| 79 | Ga0105240_10894411 | 3300009093 | Bacteria | 956 |
| 80 | Ga0111539_10129570 | 3300009094 | Bacteria | 2954 |
| 81 | Ga0105245_10150916 | 3300009098 | Bacteria | 2197 |
| 82 | Ga0105245_10271166 | 3300009098 | Bacteria | 1655 |
| 83 | Ga0105247_10013456 | 3300009101 | Bacteria | 4907 |
| 84 | Ga0105247_10051193 | 3300009101 | Bacteria | 2543 |
| 85 | Ga0105243_10012511 | 3300009148 | Bacteria | 6417 |
| 86 | Ga0105241_10012225 | 3300009174 | Bacteria | 6299 |
| 87 | Ga0105241_10066472 | 3300009174 | Bacteria | 2788 |
| 88 | Ga0105242_10028934 | 3300009176 | Bacteria | 4415 |
| 89 | Ga0105248_10128901 | 3300009177 | Bacteria | 2854 |
| 90 | Ga0105237_10017108 | 3300009545 | Bacteria | 7522 |
| 91 | Ga0105237_10053022 | 3300009545 | Bacteria | 4069 |
| 92 | Ga0105237_10474535 | 3300009545 | Bacteria | 1257 |
| 93 | Ga0105238_10096784 | 3300009551 | Bacteria | 2937 |
| 94 | Ga0105249_10002883 | 3300009553 | Bacteria | 14846 |
| 95 | Ga0105239_10015333 | 3300010375 | Bacteria | 8491 |
| 96 | Ga0105246_10045270 | 3300011119 | Bacteria | 2995 |
| 97 | Ga0157373_10122932 | 3300013100 | Bacteria | 1824 |
| 98 | Ga0157370_10013040 | 3300013104 | Bacteria | 8582 |
| 99 | Ga0157369_10131673 | 3300013105 | Bacteria | 2650 |
| 100 | Ga0157374_10008472 | 3300013296 | Bacteria | 8793 |
| 101 | Ga0157374_10193227 | 3300013296 | Bacteria | 1991 |
| 102 | Ga0163162_10007873 | 3300013306 | Bacteria | 10382 |
| 103 | Ga0157372_10031636 | 3300013307 | Bacteria | 5794 |
| 104 | Ga0157372_10459578 | 3300013307 | Bacteria | 1484 |
| 105 | Ga0157375_10127660 | 3300013308 | Bacteria | 2660 |
| 106 | Ga0163163_10043710 | 3300014325 | Bacteria | 4394 |
| 107 | Ga0157379_10065431 | 3300014968 | Bacteria | 3249 |
| 108 | Ga0157376_10200053 | 3300014969 | Bacteria | 1837 |
| 109 | Ga0197907_10016130 | 3300020069 | Bacteria | 1900 |
| 110 | Ga0206356_10902430 | 3300020070 | Bacteria | 859 |
| 111 | Ga0206353_10514055 | 3300020082 | Bacteria | 3460 |
| 112 | Ga0206353_11961309 | 3300020082 | Bacteria | 1963 |
| 113 | Ga0207653_10012523 | 3300025885 | Bacteria | 2649 |
| 114 | Ga0207692_10004712 | 3300025898 | Bacteria | 5413 |
| 115 | Ga0207692_10332648 | 3300025898 | Bacteria | 932 |
| 116 | Ga0207642_10061614 | 3300025899 | Bacteria | 1745 |
| 117 | Ga0207710_10003622 | 3300025900 | Bacteria | 6847 |
| 118 | Ga0207710_10030468 | 3300025900 | Bacteria | 2354 |
| 119 | Ga0207688_10005792 | 3300025901 | Bacteria | 6727 |
| 120 | Ga0207685_10011041 | 3300025905 | Bacteria | 2698 |
| 121 | Ga0207685_10069078 | 3300025905 | Bacteria | 1426 |
| 122 | Ga0207699_10015876 | 3300025906 | Bacteria | 3924 |
| 123 | Ga0207699_10037101 | 3300025906 | Bacteria | 2783 |
| 124 | Ga0207705_10094937 | 3300025909 | Bacteria | 2188 |
| 125 | Ga0207705_10218276 | 3300025909 | Bacteria | 1448 |
| 126 | Ga0207684_10002644 | 3300025910 | Bacteria | 17927 |
| 127 | Ga0207654_10180183 | 3300025911 | Bacteria | 1378 |
| 128 | Ga0207671_10033687 | 3300025914 | Bacteria | 3809 |
| 129 | Ga0207671_10305886 | 3300025914 | Bacteria | 1256 |
| 130 | Ga0207671_10716363 | 3300025914 | Bacteria | 795 |
| 131 | Ga0207693_10000579 | 3300025915 | Bacteria | 32734 |
| 132 | Ga0207662_10061495 | 3300025918 | Bacteria | 2255 |
| 133 | Ga0207657_10050434 | 3300025919 | Bacteria | 3623 |
| 134 | Ga0207646_10281443 | 3300025922 | Bacteria | 1503 |
| 135 | Ga0207694_10102604 | 3300025924 | Bacteria | 2268 |
| 136 | Ga0207650_10201263 | 3300025925 | Bacteria | 1595 |
| 137 | Ga0207687_10036723 | 3300025927 | Bacteria | 3338 |
| 138 | Ga0207687_10253687 | 3300025927 | Bacteria | 1399 |
| 139 | Ga0207700_10060971 | 3300025928 | Bacteria | 2859 |
| 140 | Ga0207664_10113746 | 3300025929 | Bacteria | 2254 |
| 141 | Ga0207664_10142446 | 3300025929 | Bacteria | 2029 |
| 142 | Ga0207706_10044120 | 3300025933 | Bacteria | 3952 |
| 143 | Ga0207686_10153112 | 3300025934 | Bacteria | 1607 |
| 144 | Ga0207686_10439101 | 3300025934 | Bacteria | 1002 |
| 145 | Ga0207709_10253010 | 3300025935 | Bacteria | 1288 |
| 146 | Ga0207669_10024634 | 3300025937 | Bacteria | 3238 |
| 147 | Ga0207704_10458069 | 3300025938 | Bacteria | 1019 |
| 148 | Ga0207665_10003426 | 3300025939 | Bacteria | 10610 |
| 149 | Ga0207689_10019426 | 3300025942 | Bacteria | 5728 |
| 150 | Ga0207689_10117488 | 3300025942 | Bacteria | 2187 |
| 151 | Ga0207667_10022404 | 3300025949 | Bacteria | 6980 |
| 152 | Ga0207667_10078949 | 3300025949 | Bacteria | 3411 |
| 153 | Ga0207667_10105338 | 3300025949 | Bacteria | 2909 |
| 154 | Ga0207712_10005510 | 3300025961 | Bacteria | 7984 |
| 155 | Ga0207668_10004499 | 3300025972 | Bacteria | 8194 |
| 156 | Ga0207658_10013197 | 3300025986 | Bacteria | 5642 |
| 157 | Ga0207658_10071468 | 3300025986 | Bacteria | 2628 |
| 158 | Ga0207658_10419395 | 3300025986 | Bacteria | 1180 |
| 159 | Ga0207677_10035438 | 3300026023 | Bacteria | 3241 |
| 160 | Ga0207678_10007746 | 3300026067 | Bacteria | 9489 |
| 161 | Ga0207702_10011808 | 3300026078 | Bacteria | 7272 |
| 162 | Ga0207702_10051508 | 3300026078 | Bacteria | 3480 |
| 163 | Ga0207702_10077443 | 3300026078 | Bacteria | 2876 |
| 164 | Ga0207702_10077922 | 3300026078 | Bacteria | 2868 |
| 165 | Ga0207674_10232861 | 3300026116 | Bacteria | 1790 |
| 166 | Ga0207674_10722778 | 3300026116 | Bacteria | 961 |
| 167 | Ga0207675_100001639 | 3300026118 | Bacteria | 22443 |
| 168 | Ga0207683_11103791 | 3300026121 | Bacteria | 736 |
| 169 | Ga0207698_10008111 | 3300026142 | Bacteria | 6621 |
| 170 | Ga0265338_10004156 | 3300028800 | Bacteria | 19774 |
| 171 | Ga0307408_100007993 | 3300031548 | Bacteria | 6994 |
| 172 | Ga0307406_10006578 | 3300031901 | Bacteria | 6424 |
| 173 | Ga0307409_100108666 | 3300031995 | Bacteria | 2320 |
| 174 | Ga0307416_100462273 | 3300032002 | Bacteria | 1324 |
| 175 | Ga0373930_0019811 | 3300034816 | Bacteria | 1305 |
| 176 | Ga0373950_0003341 | 3300034818 | Bacteria | 2287 |
| 177 | Ga0373938_0003017 | 3300034957 | Bacteria | 2732 |
| 178 | Ga0373928_0019717 | 3300035084 | Bacteria | 1409 |
| 179 | Ga0373939_0010042 | 3300035114 | Bacteria | 2358 |
| 180 | Ga0373941_0009374 | 3300035115 | Bacteria | 2464 |
| 181 | Ga0373943_0019729 | 3300035170 | Bacteria | 3103 |
| 182 | Ga0373962_0003429 | 3300035242 | Bacteria | 3808 |
| 183 | Ga0373935_0085445 | 3300035692 | Bacteria | 2057 |
| 184 | Ga0373937_0426895 | 3300036401 | Bacteria | 1258 |
| 185 | Ga0373925_0050473 | 3300037068 | Bacteria | 3102 |
| 186 | Ga0373925_0062582 | 3300037068 | Bacteria | 2798 |
| 187 | Ga0395900_0029090 | 3300037418 | Bacteria | 5667 |
| 188 | Ga0395898_0228598 | 3300037466 | Bacteria | 1774 |
| 189 | Ga0466969_0040061 | 3300044656 | Bacteria | 2349 |
| 190 | Ga0466972_0092973 | 3300044658 | Bacteria | 1430 |
| 191 | Ga0466966_0059194 | 3300044684 | Bacteria | 2419 |
| 192 | Ga0466966_0076365 | 3300044684 | Bacteria | 2092 |
| 193 | Ga0466966_0097156 | 3300044684 | Bacteria | 1824 |
| 194 | Ga0466966_0185577 | 3300044684 | Bacteria | 1261 |
| 195 | Ga0466961_0007879 | 3300044693 | Bacteria | 6785 |
| 196 | Ga0466961_0022575 | 3300044693 | Bacteria | 4048 |
| 197 | Ga0466961_0050676 | 3300044693 | Bacteria | 2651 |
| 198 | Ga0466961_0056760 | 3300044693 | Bacteria | 2495 |
| 199 | Ga0466961_0091308 | 3300044693 | Bacteria | 1923 |
| 200 | Ga0466961_0103862 | 3300044693 | Bacteria | 1789 |
| 201 | Ga0466961_0122467 | 3300044693 | Bacteria | 1632 |
| 202 | Ga0466961_0194120 | 3300044693 | Bacteria | 1258 |
| 203 | Ga0466963_0001664 | 3300044694 | Bacteria | 12111 |
| 204 | Ga0466963_0017513 | 3300044694 | Bacteria | 4467 |
| 205 | Ga0466963_0035065 | 3300044694 | Bacteria | 3267 |
| 206 | Ga0466963_0102724 | 3300044694 | Bacteria | 1958 |
| 207 | Ga0466964_0050107 | 3300044706 | Bacteria | 1711 |
| 208 | Ga0466964_0264247 | 3300044706 | Bacteria | 854 |
| 209 | Ga0466971_0016777 | 3300044719 | Bacteria | 3235 |
| 210 | Ga0466971_0095177 | 3300044719 | Bacteria | 1365 |
| 211 | Ga0466968_0103414 | 3300044735 | Bacteria | 1274 |
| 212 | Ga0466970_0182228 | 3300044765 | Bacteria | 1165 |
| 213 | Ga0466957_0036890 | 3300044842 | Bacteria | 2941 |
| 214 | Ga0466957_0043606 | 3300044842 | Bacteria | 2717 |
| 215 | Ga0466960_0018079 | 3300044901 | Bacteria | 3084 |
| 216 | Ga0466959_0032877 | 3300045049 | Bacteria | 3839 |
| 217 | Ga0466959_0164438 | 3300045049 | Bacteria | 1559 |
| 218 | Ga0466959_0168166 | 3300045049 | Bacteria | 1539 |
| 219 | Ga0466958_0017810 | 3300045836 | Bacteria | 4114 |
| 220 | Ga0466958_0273622 | 3300045836 | Bacteria | 1082 |
| 221 | Ga0466967_0000579 | 3300045976 | Bacteria | 18061 |
| 222 | Ga0466967_0002683 | 3300045976 | Bacteria | 11236 |
| 223 | Ga0466967_0003275 | 3300045976 | Bacteria | 10498 |
| 224 | Ga0466967_0094259 | 3300045976 | Bacteria | 2726 |
| 225 | Ga0466967_0945637 | 3300045976 | Bacteria | 857 |
| 226 | Ga0495627_121512 | 3300046453 | Bacteria | 737 |
| 227 | Ga0495603_0269778 | 3300046455 | Bacteria | 979 |
| 228 | Ga0495662_0032802 | 3300046476 | Bacteria | 2509 |
| 229 | Ga0495664_0436981 | 3300046477 | Bacteria | 784 |
| 230 | Ga0495585_0012992 | 3300046492 | Bacteria | 4889 |
| 231 | Ga0495628_0222856 | 3300046516 | Bacteria | 1416 |
| 232 | Ga0495652_0451663 | 3300046529 | Bacteria | 900 |
| 233 | Ga0495640_0018337 | 3300046533 | Bacteria | 5195 |
| 234 | Ga0495586_0328826 | 3300046535 | Bacteria | 877 |
| 235 | Ga0495645_0448617 | 3300046543 | Bacteria | 814 |
| 236 | Ga0495599_0157788 | 3300046678 | Bacteria | 1403 |
| 237 | Ga0495646_0048667 | 3300046680 | Bacteria | 2574 |
| 238 | Ga0495624_0165439 | 3300046690 | Bacteria | 1350 |
| 239 | Ga0495674_0018519 | 3300047319 | Bacteria | 6481 |
| 240 | Ga0495676_0237434 | 3300047321 | Bacteria | 1249 |
| 241 | Ga0496101_0019625 | 3300048904 | Bacteria | 4618 |
| 242 | Ga0496102_0000094 | 3300048905 | Bacteria | 125159 |
| 243 | Ga0496102_0001805 | 3300048905 | Bacteria | 18518 |
| 244 | Ga0496103_0000042 | 3300048906 | Bacteria | 168701 |
| 245 | Ga0496103_0176587 | 3300048906 | Bacteria | 1372 |
| 246 | Ga0496104_0028730 | 3300048907 | Bacteria | 5154 |
| 247 | Ga0496105_0005684 | 3300048908 | Bacteria | 9489 |
| 248 | Ga0496106_0078632 | 3300048909 | Bacteria | 2531 |
| 249 | Ga0496108_0030536 | 3300048911 | Bacteria | 4466 |
| 250 | Ga0496110_0133027 | 3300048913 | Bacteria | 2247 |
| 251 | Ga0496113_0009068 | 3300048916 | Bacteria | 6518 |
| 252 | Ga0496114_0013827 | 3300048917 | Bacteria | 6471 |
| 253 | Ga0496115_0003985 | 3300048918 | Bacteria | 10651 |
| 254 | Ga0496117_0104102 | 3300048920 | Bacteria | 1787 |
| 255 | Ga0496119_0017704 | 3300048922 | Bacteria | 5347 |
| 256 | Ga0496121_0313188 | 3300048924 | Bacteria | 1060 |
| 257 | Ga0496126_0100719 | 3300048929 | Bacteria | 2528 |
| 258 | Ga0501031_0049655 | 3300049568 | Bacteria | 2734 |
| 259 | Ga0501033_0078578 | 3300049570 | Bacteria | 2421 |
| 260 | Ga0501033_0197278 | 3300049570 | Bacteria | 1439 |
| 261 | Ga0501034_0094570 | 3300049571 | Bacteria | 2985 |
| 262 | Ga0501037_0101950 | 3300049573 | Bacteria | 2071 |
| 263 | Ga0501038_0013032 | 3300049574 | Bacteria | 7582 |
| 264 | Ga0501043_0081521 | 3300049579 | Bacteria | 2542 |
| 265 | Ga0501047_0030812 | 3300049581 | Bacteria | 5170 |
| 266 | Ga0501047_0231790 | 3300049581 | Bacteria | 1700 |
| 267 | Ga0501070_0025875 | 3300049586 | Bacteria | 4923 |
| 268 | Ga0501070_0499168 | 3300049586 | Bacteria | 978 |
| 269 | Ga0501035_0021794 | 3300049822 | Bacteria | 5889 |
| 270 | Ga0501035_0298452 | 3300049822 | Bacteria | 1358 |
| 271 | Ga0501044_0009778 | 3300049823 | Bacteria | 10430 |
| 272 | nmdc:mga0n895_5014_c1 | 3300050512 | Bacteria | 10984 |
| 273 | nmdc:mga0a205_25422_c1 | 3300050515 | Bacteria | 5642 |
| 274 | Ga0495601_0324649 | 3300053077 | Bacteria | 1002 |
| 275 | Ga0495612_0036238 | 3300053078 | Bacteria | 2002 |
| 276 | Ga0466962_0046533 | 3300061719 | Bacteria | 2073 |
| 277 | Ga0466962_0063378 | 3300061719 | Bacteria | 1765 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005434 | Ga0070709_10003958 | Ga0070709_100039582 | 160 |
| 2 | 3300006175 | Ga0070712_100073735 | Ga0070712_1000737354 | 166 |
| 3 | 3300006175 | Ga0070712_100888167 | Ga0070712_1008881671 | 167 |
| 4 | 3300046516 | Ga0495628_0222856 | Ga0495628_0222856_186_719 | 167 |
| 5 | 3300035170 | Ga0373943_0019729 | Ga0373943_0019729_559_1071 | 170 |
| 6 | 3300035692 | Ga0373935_0085445 | Ga0373935_0085445_78_590 | 170 |
| 7 | 3300037068 | Ga0373925_0062582 | Ga0373925_0062582_755_1267 | 170 |
| 8 | 3300046476 | Ga0495662_0032802 | Ga0495662_0032802_1833_2345 | 170 |
| 9 | 3300046477 | Ga0495664_0436981 | Ga0495664_0436981_40_552 | 170 |
| 10 | 3300046529 | Ga0495652_0451663 | Ga0495652_0451663_342_854 | 170 |
| 11 | 3300046533 | Ga0495640_0018337 | Ga0495640_0018337_367_879 | 170 |
| 12 | 3300046535 | Ga0495586_0328826 | Ga0495586_0328826_121_633 | 170 |
| 13 | 3300046543 | Ga0495645_0448617 | Ga0495645_0448617_40_552 | 170 |
| 14 | 3300046678 | Ga0495599_0157788 | Ga0495599_0157788_424_936 | 170 |
| 15 | 3300046680 | Ga0495646_0048667 | Ga0495646_0048667_754_1266 | 170 |
| 16 | 3300047319 | Ga0495674_0018519 | Ga0495674_0018519_5375_5887 | 170 |
| 17 | 3300047321 | Ga0495676_0237434 | Ga0495676_0237434_27_539 | 170 |
| 18 | 3300053077 | Ga0495601_0324649 | Ga0495601_0324649_327_839 | 170 |
| 19 | 3300053078 | Ga0495612_0036238 | Ga0495612_0036238_254_766 | 170 |
| 20 | 3300005439 | Ga0070711_100243810 | Ga0070711_1002438102 | 176 |
| 21 | 3300006173 | Ga0070716_100195942 | Ga0070716_1001959422 | 176 |
| 22 | 3300025898 | Ga0207692_10004712 | Ga0207692_100047126 | 176 |
| 23 | 3300025905 | Ga0207685_10011041 | Ga0207685_100110412 | 176 |
| 24 | 3300025906 | Ga0207699_10015876 | Ga0207699_100158764 | 176 |
| 25 | 3300025928 | Ga0207700_10060971 | Ga0207700_100609712 | 176 |
| 26 | 3300025929 | Ga0207664_10113746 | Ga0207664_101137462 | 176 |
| 27 | 3300037068 | Ga0373925_0050473 | Ga0373925_0050473_1605_2150 | 178 |
| 28 | 3300044658 | Ga0466972_0092973 | Ga0466972_0092973_13_606 | 185 |
| 29 | 3300045836 | Ga0466958_0273622 | Ga0466958_0273622_373_1029 | 186 |
| 30 | iso_pu_bacteria | 2537561592 | 2537898593 | 186 |
| 31 | iso_pu_bacteria | 2857710386 | 2857711755 | 187 |
| 32 | 3300020069 | Ga0197907_10016130 | Ga0197907_100161302 | 189 |
| 33 | 3300031548 | Ga0307408_100007993 | Ga0307408_1000079933 | 190 |
| 34 | 3300031901 | Ga0307406_10006578 | Ga0307406_100065788 | 190 |
| 35 | 3300031995 | Ga0307409_100108666 | Ga0307409_1001086662 | 190 |
| 36 | 3300032002 | Ga0307416_100462273 | Ga0307416_1004622732 | 190 |
| 37 | 3300005366 | Ga0070659_100575508 | Ga0070659_1005755082 | 191 |
| 38 | 3300005367 | Ga0070667_100426352 | Ga0070667_1004263522 | 191 |
| 39 | 3300005467 | Ga0070706_100001191 | Ga0070706_1000011915 | 191 |
| 40 | 3300005471 | Ga0070698_100055911 | Ga0070698_1000559114 | 191 |
| 41 | 3300005844 | Ga0068862_100587163 | Ga0068862_1005871632 | 191 |
| 42 | 3300006028 | Ga0070717_10014302 | Ga0070717_100143022 | 191 |
| 43 | 3300013307 | Ga0157372_10459578 | Ga0157372_104595781 | 191 |
| 44 | 3300025910 | Ga0207684_10002644 | Ga0207684_100026445 | 191 |
| 45 | 3300025925 | Ga0207650_10201263 | Ga0207650_102012632 | 191 |
| 46 | 3300025986 | Ga0207658_10071468 | Ga0207658_100714681 | 191 |
| 47 | 3300026116 | Ga0207674_10722778 | Ga0207674_107227781 | 191 |
| 48 | 3300026121 | Ga0207683_11103791 | Ga0207683_111037911 | 191 |
| 49 | 3300028800 | Ga0265338_10004156 | Ga0265338_100041566 | 191 |
| 50 | 3300046453 | Ga0495627_121512 | Ga0495627_121512_86_709 | 191 |
| 51 | 3300046492 | Ga0495585_0012992 | Ga0495585_0012992_952_1575 | 191 |
| 52 | 3300005468 | Ga0070707_100307372 | Ga0070707_1003073722 | 194 |
| 53 | 3300025922 | Ga0207646_10281443 | Ga0207646_102814432 | 194 |
| 54 | 3300025942 | Ga0207689_10117488 | Ga0207689_101174882 | 194 |
| 55 | 3300020082 | Ga0206353_11961309 | Ga0206353_119613092 | 195 |
| 56 | 3300025909 | Ga0207705_10218276 | Ga0207705_102182762 | 195 |
| 57 | 3300025986 | Ga0207658_10013197 | Ga0207658_100131975 | 195 |
| 58 | 3300044684 | Ga0466966_0059194 | Ga0466966_0059194_1419_2036 | 195 |
| 59 | 3300045049 | Ga0466959_0032877 | Ga0466959_0032877_2615_3232 | 195 |
| 60 | 3300025937 | Ga0207669_10024634 | Ga0207669_100246342 | 196 |
| 61 | 3300044693 | Ga0466961_0056760 | Ga0466961_0056760_872_1519 | 196 |
| 62 | 3300005548 | Ga0070665_100618509 | Ga0070665_1006185092 | 198 |
| 63 | 3300020082 | Ga0206353_10514055 | Ga0206353_105140553 | 198 |
| 64 | 3300044693 | Ga0466961_0194120 | Ga0466961_0194120_268_882 | 198 |
| 65 | 3300005330 | Ga0070690_100085376 | Ga0070690_1000853762 | 199 |
| 66 | 3300005334 | Ga0068869_100082592 | Ga0068869_1000825922 | 199 |
| 67 | 3300005335 | Ga0070666_10021777 | Ga0070666_100217772 | 199 |
| 68 | 3300005336 | Ga0070680_100155177 | Ga0070680_1001551772 | 199 |
| 69 | 3300005337 | Ga0070682_100039808 | Ga0070682_1000398083 | 199 |
| 70 | 3300005338 | Ga0068868_100015814 | Ga0068868_1000158142 | 199 |
| 71 | 3300005341 | Ga0070691_10045448 | Ga0070691_100454483 | 199 |
| 72 | 3300005343 | Ga0070687_100015051 | Ga0070687_1000150515 | 199 |
| 73 | 3300005344 | Ga0070661_100359471 | Ga0070661_1003594712 | 199 |
| 74 | 3300005347 | Ga0070668_100009441 | Ga0070668_1000094415 | 199 |
| 75 | 3300005354 | Ga0070675_100582233 | Ga0070675_1005822332 | 199 |
| 76 | 3300005355 | Ga0070671_100111615 | Ga0070671_1001116152 | 199 |
| 77 | 3300005364 | Ga0070673_100012205 | Ga0070673_1000122055 | 199 |
| 78 | 3300005365 | Ga0070688_100129369 | Ga0070688_1001293692 | 199 |
| 79 | 3300005366 | Ga0070659_100040312 | Ga0070659_1000403122 | 199 |
| 80 | 3300005434 | Ga0070709_10078308 | Ga0070709_100783083 | 199 |
| 81 | 3300005435 | Ga0070714_100075248 | Ga0070714_1000752482 | 199 |
| 82 | 3300005436 | Ga0070713_100747476 | Ga0070713_1007474761 | 199 |
| 83 | 3300005437 | Ga0070710_10035002 | Ga0070710_100350024 | 199 |
| 84 | 3300005438 | Ga0070701_10064172 | Ga0070701_100641723 | 199 |
| 85 | 3300005439 | Ga0070711_100009145 | Ga0070711_1000091456 | 199 |
| 86 | 3300005440 | Ga0070705_100009314 | Ga0070705_1000093142 | 199 |
| 87 | 3300005456 | Ga0070678_100065052 | Ga0070678_1000650522 | 199 |
| 88 | 3300005457 | Ga0070662_100035816 | Ga0070662_1000358162 | 199 |
| 89 | 3300005468 | Ga0070707_100785111 | Ga0070707_1007851112 | 199 |
| 90 | 3300005518 | Ga0070699_100188411 | Ga0070699_1001884113 | 199 |
| 91 | 3300005536 | Ga0070697_100175897 | Ga0070697_1001758972 | 199 |
| 92 | 3300005539 | Ga0068853_100076131 | Ga0068853_1000761314 | 199 |
| 93 | 3300005543 | Ga0070672_100524323 | Ga0070672_1005243232 | 199 |
| 94 | 3300005544 | Ga0070686_100235753 | Ga0070686_1002357532 | 199 |
| 95 | 3300005546 | Ga0070696_100038624 | Ga0070696_1000386243 | 199 |
| 96 | 3300005547 | Ga0070693_100006791 | Ga0070693_1000067917 | 199 |
| 97 | 3300005549 | Ga0070704_100145473 | Ga0070704_1001454733 | 199 |
| 98 | 3300005577 | Ga0068857_100309472 | Ga0068857_1003094722 | 199 |
| 99 | 3300005578 | Ga0068854_100052653 | Ga0068854_1000526534 | 199 |
| 100 | 3300005614 | Ga0068856_100119702 | Ga0068856_1001197022 | 199 |
| 101 | 3300005615 | Ga0070702_100056114 | Ga0070702_1000561142 | 199 |
| 102 | 3300005616 | Ga0068852_100010992 | Ga0068852_1000109926 | 199 |
| 103 | 3300005617 | Ga0068859_100044854 | Ga0068859_1000448545 | 199 |
| 104 | 3300005618 | Ga0068864_100038934 | Ga0068864_1000389345 | 199 |
| 105 | 3300005718 | Ga0068866_10018872 | Ga0068866_100188722 | 199 |
| 106 | 3300005719 | Ga0068861_100033783 | Ga0068861_1000337833 | 199 |
| 107 | 3300005840 | Ga0068870_10131102 | Ga0068870_101311022 | 199 |
| 108 | 3300005841 | Ga0068863_100134297 | Ga0068863_1001342972 | 199 |
| 109 | 3300005983 | Ga0081540_1001908 | Ga0081540_100190814 | 199 |
| 110 | 3300006163 | Ga0070715_10038727 | Ga0070715_100387272 | 199 |
| 111 | 3300006173 | Ga0070716_100002348 | Ga0070716_1000023486 | 199 |
| 112 | 3300006237 | Ga0097621_100026425 | Ga0097621_1000264255 | 199 |
| 113 | 3300006358 | Ga0068871_100121718 | Ga0068871_1001217182 | 199 |
| 114 | 3300006852 | Ga0075433_10007638 | Ga0075433_100076387 | 199 |
| 115 | 3300006871 | Ga0075434_100010843 | Ga0075434_1000108437 | 199 |
| 116 | 3300006881 | Ga0068865_100130822 | Ga0068865_1001308223 | 199 |
| 117 | 3300006914 | Ga0075436_100045626 | Ga0075436_1000456262 | 199 |
| 118 | 3300006931 | Ga0097620_100044854 | Ga0097620_1000448542 | 199 |
| 119 | 3300007076 | Ga0075435_100256801 | Ga0075435_1002568012 | 199 |
| 120 | 3300009093 | Ga0105240_10291695 | Ga0105240_102916952 | 199 |
| 121 | 3300009094 | Ga0111539_10129570 | Ga0111539_101295704 | 199 |
| 122 | 3300009098 | Ga0105245_10150916 | Ga0105245_101509162 | 199 |
| 123 | 3300009101 | Ga0105247_10051193 | Ga0105247_100511932 | 199 |
| 124 | 3300009148 | Ga0105243_10012511 | Ga0105243_100125116 | 199 |
| 125 | 3300009174 | Ga0105241_10012225 | Ga0105241_100122256 | 199 |
| 126 | 3300009176 | Ga0105242_10028934 | Ga0105242_100289343 | 199 |
| 127 | 3300009177 | Ga0105248_10128901 | Ga0105248_101289013 | 199 |
| 128 | 3300009545 | Ga0105237_10053022 | Ga0105237_100530223 | 199 |
| 129 | 3300009551 | Ga0105238_10096784 | Ga0105238_100967843 | 199 |
| 130 | 3300009553 | Ga0105249_10002883 | Ga0105249_100028838 | 199 |
| 131 | 3300011119 | Ga0105246_10045270 | Ga0105246_100452702 | 199 |
| 132 | 3300013100 | Ga0157373_10122932 | Ga0157373_101229322 | 199 |
| 133 | 3300013104 | Ga0157370_10013040 | Ga0157370_100130407 | 199 |
| 134 | 3300013105 | Ga0157369_10131673 | Ga0157369_101316732 | 199 |
| 135 | 3300013296 | Ga0157374_10008472 | Ga0157374_100084726 | 199 |
| 136 | 3300013306 | Ga0163162_10007873 | Ga0163162_100078739 | 199 |
| 137 | 3300013307 | Ga0157372_10031636 | Ga0157372_100316365 | 199 |
| 138 | 3300013308 | Ga0157375_10127660 | Ga0157375_101276601 | 199 |
| 139 | 3300014325 | Ga0163163_10043710 | Ga0163163_100437102 | 199 |
| 140 | 3300014968 | Ga0157379_10065431 | Ga0157379_100654312 | 199 |
| 141 | 3300014969 | Ga0157376_10200053 | Ga0157376_102000533 | 199 |
| 142 | 3300020070 | Ga0206356_10902430 | Ga0206356_109024302 | 199 |
| 143 | 3300025885 | Ga0207653_10012523 | Ga0207653_100125233 | 199 |
| 144 | 3300025898 | Ga0207692_10332648 | Ga0207692_103326482 | 199 |
| 145 | 3300025899 | Ga0207642_10061614 | Ga0207642_100616142 | 199 |
| 146 | 3300025900 | Ga0207710_10030468 | Ga0207710_100304682 | 199 |
| 147 | 3300025901 | Ga0207688_10005792 | Ga0207688_100057922 | 199 |
| 148 | 3300025905 | Ga0207685_10069078 | Ga0207685_100690782 | 199 |
| 149 | 3300025906 | Ga0207699_10037101 | Ga0207699_100371012 | 199 |
| 150 | 3300025914 | Ga0207671_10033687 | Ga0207671_100336872 | 199 |
| 151 | 3300025915 | Ga0207693_10000579 | Ga0207693_1000057924 | 199 |
| 152 | 3300025918 | Ga0207662_10061495 | Ga0207662_100614952 | 199 |
| 153 | 3300025919 | Ga0207657_10050434 | Ga0207657_100504343 | 199 |
| 154 | 3300025924 | Ga0207694_10102604 | Ga0207694_101026042 | 199 |
| 155 | 3300025927 | Ga0207687_10036723 | Ga0207687_100367233 | 199 |
| 156 | 3300025929 | Ga0207664_10142446 | Ga0207664_101424462 | 199 |
| 157 | 3300025933 | Ga0207706_10044120 | Ga0207706_100441201 | 199 |
| 158 | 3300025934 | Ga0207686_10153112 | Ga0207686_101531123 | 199 |
| 159 | 3300025935 | Ga0207709_10253010 | Ga0207709_102530102 | 199 |
| 160 | 3300025938 | Ga0207704_10458069 | Ga0207704_104580692 | 199 |
| 161 | 3300025939 | Ga0207665_10003426 | Ga0207665_1000342611 | 199 |
| 162 | 3300025942 | Ga0207689_10019426 | Ga0207689_100194265 | 199 |
| 163 | 3300025949 | Ga0207667_10105338 | Ga0207667_101053382 | 199 |
| 164 | 3300025961 | Ga0207712_10005510 | Ga0207712_100055103 | 199 |
| 165 | 3300025972 | Ga0207668_10004499 | Ga0207668_100044996 | 199 |
| 166 | 3300025986 | Ga0207658_10419395 | Ga0207658_104193952 | 199 |
| 167 | 3300026023 | Ga0207677_10035438 | Ga0207677_100354384 | 199 |
| 168 | 3300026067 | Ga0207678_10007746 | Ga0207678_100077462 | 199 |
| 169 | 3300026078 | Ga0207702_10077922 | Ga0207702_100779222 | 199 |
| 170 | 3300026116 | Ga0207674_10232861 | Ga0207674_102328612 | 199 |
| 171 | 3300026118 | Ga0207675_100001639 | Ga0207675_1000016399 | 199 |
| 172 | 3300034816 | Ga0373930_0019811 | Ga0373930_0019811_275_874 | 199 |
| 173 | 3300034818 | Ga0373950_0003341 | Ga0373950_0003341_272_871 | 199 |
| 174 | 3300034957 | Ga0373938_0003017 | Ga0373938_0003017_1035_1634 | 199 |
| 175 | 3300035084 | Ga0373928_0019717 | Ga0373928_0019717_617_1216 | 199 |
| 176 | 3300035114 | Ga0373939_0010042 | Ga0373939_0010042_685_1284 | 199 |
| 177 | 3300035115 | Ga0373941_0009374 | Ga0373941_0009374_1014_1613 | 199 |
| 178 | 3300035242 | Ga0373962_0003429 | Ga0373962_0003429_919_1518 | 199 |
| 179 | 3300044693 | Ga0466961_0122467 | Ga0466961_0122467_477_1121 | 199 |
| 180 | 3300044694 | Ga0466963_0017513 | Ga0466963_0017513_472_1116 | 199 |
| 181 | 3300044719 | Ga0466971_0016777 | Ga0466971_0016777_18_662 | 199 |
| 182 | 3300044842 | Ga0466957_0043606 | Ga0466957_0043606_586_1230 | 199 |
| 183 | 3300046455 | Ga0495603_0269778 | Ga0495603_0269778_60_659 | 199 |
| 184 | 3300046690 | Ga0495624_0165439 | Ga0495624_0165439_144_743 | 199 |
| 185 | 3300048904 | Ga0496101_0019625 | Ga0496101_0019625_623_1222 | 199 |
| 186 | 3300048906 | Ga0496103_0176587 | Ga0496103_0176587_164_763 | 199 |
| 187 | 3300048907 | Ga0496104_0028730 | Ga0496104_0028730_3859_4458 | 199 |
| 188 | 3300048908 | Ga0496105_0005684 | Ga0496105_0005684_2034_2633 | 199 |
| 189 | 3300048909 | Ga0496106_0078632 | Ga0496106_0078632_975_1574 | 199 |
| 190 | 3300048911 | Ga0496108_0030536 | Ga0496108_0030536_2862_3461 | 199 |
| 191 | 3300048913 | Ga0496110_0133027 | Ga0496110_0133027_373_972 | 199 |
| 192 | 3300048916 | Ga0496113_0009068 | Ga0496113_0009068_3810_4409 | 199 |
| 193 | 3300048917 | Ga0496114_0013827 | Ga0496114_0013827_5153_5752 | 199 |
| 194 | 3300048918 | Ga0496115_0003985 | Ga0496115_0003985_988_1587 | 199 |
| 195 | 3300048924 | Ga0496121_0313188 | Ga0496121_0313188_274_882 | 199 |
| 196 | 3300050512 | nmdc:mga0n895_5014_c1 | nmdc:mga0n895_5014_c1_26_625 | 199 |
| 197 | 3300050515 | nmdc:mga0a205_25422_c1 | nmdc:mga0a205_25422_c1_2372_2971 | 199 |
| 198 | 3300061719 | Ga0466962_0046533 | Ga0466962_0046533_920_1564 | 199 |
| 199 | 3300025934 | Ga0207686_10439101 | Ga0207686_104391012 | 200 |
| 200 | 3300005617 | Ga0068859_100003150 | Ga0068859_10000315017 | 201 |
| 201 | 3300006931 | Ga0097620_100003150 | Ga0097620_1000031503 | 201 |
| 202 | 3300009101 | Ga0105247_10013456 | Ga0105247_100134563 | 201 |
| 203 | 3300013296 | Ga0157374_10193227 | Ga0157374_101932273 | 201 |
| 204 | 3300025900 | Ga0207710_10003622 | Ga0207710_100036223 | 201 |
| 205 | 3300036401 | Ga0373937_0426895 | Ga0373937_0426895_79_690 | 201 |
| 206 | 3300048905 | Ga0496102_0000094 | Ga0496102_0000094_38797_39411 | 201 |
| 207 | 3300048906 | Ga0496103_0000042 | Ga0496103_0000042_85027_85641 | 201 |
| 208 | 3300048920 | Ga0496117_0104102 | Ga0496117_0104102_542_1156 | 201 |
| 209 | 3300048922 | Ga0496119_0017704 | Ga0496119_0017704_3465_4079 | 201 |
| 210 | 3300044684 | Ga0466966_0097156 | Ga0466966_0097156_1170_1781 | 203 |
| 211 | 3300044693 | Ga0466961_0050676 | Ga0466961_0050676_905_1522 | 203 |
| 212 | 3300044693 | Ga0466961_0103862 | Ga0466961_0103862_467_1078 | 203 |
| 213 | 3300045976 | Ga0466967_0003275 | Ga0466967_0003275_6149_6808 | 203 |
| 214 | 3300005563 | Ga0068855_100014218 | Ga0068855_1000142185 | 204 |
| 215 | 3300005614 | Ga0068856_100013653 | Ga0068856_1000136536 | 204 |
| 216 | 3300009545 | Ga0105237_10474535 | Ga0105237_104745352 | 204 |
| 217 | 3300025914 | Ga0207671_10305886 | Ga0207671_103058862 | 204 |
| 218 | 3300025949 | Ga0207667_10022404 | Ga0207667_100224044 | 204 |
| 219 | 3300026078 | Ga0207702_10011808 | Ga0207702_100118085 | 204 |
| 220 | 3300044684 | Ga0466966_0185577 | Ga0466966_0185577_164_799 | 204 |
| 221 | 3300044693 | Ga0466961_0007879 | Ga0466961_0007879_429_1064 | 204 |
| 222 | 3300044694 | Ga0466963_0001664 | Ga0466963_0001664_10654_11283 | 204 |
| 223 | 3300044706 | Ga0466964_0050107 | Ga0466964_0050107_455_1084 | 204 |
| 224 | 3300044719 | Ga0466971_0095177 | Ga0466971_0095177_373_1002 | 204 |
| 225 | 3300045836 | Ga0466958_0017810 | Ga0466958_0017810_1336_1965 | 204 |
| 226 | 3300045976 | Ga0466967_0002683 | Ga0466967_0002683_7483_8112 | 204 |
| 227 | 3300061719 | Ga0466962_0063378 | Ga0466962_0063378_886_1515 | 204 |
| 228 | 3300044656 | Ga0466969_0040061 | Ga0466969_0040061_375_1013 | 205 |
| 229 | 3300044693 | Ga0466961_0022575 | Ga0466961_0022575_1580_2218 | 205 |
| 230 | 3300044694 | Ga0466963_0102724 | Ga0466963_0102724_234_872 | 205 |
| 231 | 3300044706 | Ga0466964_0264247 | Ga0466964_0264247_83_700 | 205 |
| 232 | 3300049568 | Ga0501031_0049655 | Ga0501031_0049655_1130_1819 | 205 |
| 233 | 3300049571 | Ga0501034_0094570 | Ga0501034_0094570_1674_2363 | 205 |
| 234 | 3300049573 | Ga0501037_0101950 | Ga0501037_0101950_1078_1767 | 205 |
| 235 | 3300049574 | Ga0501038_0013032 | Ga0501038_0013032_6319_7008 | 205 |
| 236 | 3300049579 | Ga0501043_0081521 | Ga0501043_0081521_1702_2391 | 205 |
| 237 | 3300049581 | Ga0501047_0030812 | Ga0501047_0030812_2625_3314 | 205 |
| 238 | 3300049586 | Ga0501070_0025875 | Ga0501070_0025875_1604_2293 | 205 |
| 239 | 3300049822 | Ga0501035_0021794 | Ga0501035_0021794_3006_3695 | 205 |
| 240 | 3300049823 | Ga0501044_0009778 | Ga0501044_0009778_7468_8157 | 205 |
| 241 | 3300044694 | Ga0466963_0035065 | Ga0466963_0035065_1402_2052 | 206 |
| 242 | 3300044842 | Ga0466957_0036890 | Ga0466957_0036890_660_1310 | 206 |
| 243 | 3300044901 | Ga0466960_0018079 | Ga0466960_0018079_2232_2882 | 206 |
| 244 | 3300045976 | Ga0466967_0000579 | Ga0466967_0000579_11024_11674 | 206 |
| 245 | 3300009093 | Ga0105240_10894411 | Ga0105240_108944111 | 207 |
| 246 | 3300044693 | Ga0466961_0091308 | Ga0466961_0091308_147_809 | 207 |
| 247 | 3300045049 | Ga0466959_0164438 | Ga0466959_0164438_229_891 | 207 |
| 248 | 3300048905 | Ga0496102_0001805 | Ga0496102_0001805_1435_2058 | 207 |
| 249 | 3300044735 | Ga0466968_0103414 | Ga0466968_0103414_200_832 | 208 |
| 250 | 3300005329 | Ga0070683_100550851 | Ga0070683_1005508512 | 209 |
| 251 | 3300005614 | Ga0068856_100029557 | Ga0068856_1000295573 | 209 |
| 252 | 3300009545 | Ga0105237_10017108 | Ga0105237_100171085 | 209 |
| 253 | 3300010375 | Ga0105239_10015333 | Ga0105239_100153335 | 209 |
| 254 | 3300025914 | Ga0207671_10716363 | Ga0207671_107163631 | 209 |
| 255 | 3300026078 | Ga0207702_10077443 | Ga0207702_100774432 | 209 |
| 256 | 3300037418 | Ga0395900_0029090 | Ga0395900_0029090_42_707 | 209 |
| 257 | 3300037466 | Ga0395898_0228598 | Ga0395898_0228598_1017_1682 | 209 |
| 258 | 3300045976 | Ga0466967_0094259 | Ga0466967_0094259_1925_2563 | 209 |
| 259 | 3300049586 | Ga0501070_0499168 | Ga0501070_0499168_209_844 | 209 |
| 260 | 3300044765 | Ga0466970_0182228 | Ga0466970_0182228_110_769 | 210 |
| 261 | 3300045049 | Ga0466959_0168166 | Ga0466959_0168166_376_1035 | 210 |
| 262 | 3300045976 | Ga0466967_0945637 | Ga0466967_0945637_97_759 | 210 |
| 263 | 3300048929 | Ga0496126_0100719 | Ga0496126_0100719_1814_2485 | 210 |
| 264 | 3300044684 | Ga0466966_0076365 | Ga0466966_0076365_457_1131 | 211 |
| 265 | 3300049570 | Ga0501033_0078578 | Ga0501033_0078578_362_1009 | 212 |
| 266 | 3300005616 | Ga0068852_100012840 | Ga0068852_1000128404 | 215 |
| 267 | 3300025911 | Ga0207654_10180183 | Ga0207654_101801832 | 215 |
| 268 | 3300026078 | Ga0207702_10051508 | Ga0207702_100515085 | 215 |
| 269 | 3300026142 | Ga0207698_10008111 | Ga0207698_100081115 | 215 |
| 270 | 3300005563 | Ga0068855_100353768 | Ga0068855_1003537683 | 216 |
| 271 | 3300009098 | Ga0105245_10271166 | Ga0105245_102711662 | 216 |
| 272 | 3300009174 | Ga0105241_10066472 | Ga0105241_100664723 | 216 |
| 273 | 3300025909 | Ga0207705_10094937 | Ga0207705_100949372 | 216 |
| 274 | 3300025927 | Ga0207687_10253687 | Ga0207687_102536872 | 216 |
| 275 | 3300049570 | Ga0501033_0197278 | Ga0501033_0197278_258_926 | 216 |
| 276 | 3300049581 | Ga0501047_0231790 | Ga0501047_0231790_272_940 | 216 |
| 277 | 3300049822 | Ga0501035_0298452 | Ga0501035_0298452_36_704 | 216 |
| 278 | 3300005327 | Ga0070658_10317689 | Ga0070658_103176892 | 217 |
| 279 | 3300025949 | Ga0207667_10078949 | Ga0207667_100789493 | 217 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7drk-assembly1.cif.gz_B | crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol | 0.8384 | 35 | 201 |
| 7drk-assembly1.cif.gz_B | crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol | 0.7604 | 35 | 201 |
| 6wmv-assembly1.cif.gz_A | structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii with evidence of substrate binding | 0.7035 | 35 | 200 |
| 8gyw-assembly1.cif.gz_B | cryo-em structure of human cept1 complexed with cdp-choline | 0.6486 | 35 | 200 |
| 5d91-assembly1.cif.gz_A | structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum | 0.6466 | 29 | 208 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WPG3_21_202_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.9739 | 33 | 204 | 1.20.120.1760 |
| af_P0ABF8_3_179_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.9302 | 35 | 204 | 1.20.120.1760 |
| af_P9WPG3_21_202_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.9164 | 33 | 204 | 1.20.120.1760 |
| af_P0ABF8_3_179_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8898 | 35 | 204 | 1.20.120.1760 |
| af_A0A1D6JYP0_117_317_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8845 | 34 | 205 | 1.20.120.1760 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R6I603-F1-model_v4 | deleted | 0.9768 | 33 | 211 |
|
| AF-A0A7I8A3N5-F1-model_v4 | deleted | 0.9735 | 35 | 203 |
|
| AF-A0A5Q5BJ31-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.9713 | 33 | 207 |
GO:0005886
GO:0008444 GO:0046474 |
| AF-A0A7D6VJQ3-F1-model_v4 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) | 0.9704 | 35 | 205 |
GO:0005886
GO:0008444 GO:0046474 |
| AF-A0A2A3FJM3-F1-model_v4 | deleted | 0.9701 | 35 | 217 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar