F383010

General Info

Members Datasets Scaffolds Average Seq Length
279 208 277 201

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10894411|Ga0105240_108944111
Length 232
Sequence VDQVTVLVDGVGDGQQTLTQPGQVGDPDPGVALDPADPLADPPNPVSAWNIANALTVFRLVLVPVFLVLLFHGTGTQTGWRLAAAVVFAAACITDRFDGDIARRRGLVTEFGKLADPLADKALVGASLIGLSALGELPWWVTVVILIREVGVTGLRFWVIRHGVLPASRGGKLKTLLQTVAIGLFVLPPWGWLRDAAWVVMIAAIVVALVTGADYVQRATTLHRVPRRSRTS

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
138 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
139 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
140 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
141 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
142 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
192 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
208 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.85
Metatranscriptomes 1.43
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.66
Rhizosphere 93.55
Stem 0
Stem Tuber 0
Unclassified 1.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10317689 3300005327 Bacteria 1330
2 Ga0070683_100550851 3300005329 Bacteria 1103
3 Ga0070690_100085376 3300005330 Bacteria 2070
4 Ga0068869_100082592 3300005334 Bacteria 2401
5 Ga0070666_10021777 3300005335 Bacteria 4155
6 Ga0070680_100155177 3300005336 Bacteria 1923
7 Ga0070682_100039808 3300005337 Bacteria 2889
8 Ga0068868_100015814 3300005338 Bacteria 5590
9 Ga0070691_10045448 3300005341 Bacteria 2084
10 Ga0070687_100015051 3300005343 Bacteria 3488
11 Ga0070661_100359471 3300005344 Bacteria 1144
12 Ga0070668_100009441 3300005347 Bacteria 7239
13 Ga0070675_100582233 3300005354 Bacteria 1014
14 Ga0070671_100111615 3300005355 Bacteria 2297
15 Ga0070673_100012205 3300005364 Bacteria 5891
16 Ga0070688_100129369 3300005365 Bacteria 1701
17 Ga0070659_100040312 3300005366 Bacteria 3648
18 Ga0070659_100575508 3300005366 Bacteria 966
19 Ga0070667_100426352 3300005367 Bacteria 1210
20 Ga0070709_10003958 3300005434 Bacteria 7983
21 Ga0070709_10078308 3300005434 Bacteria 2150
22 Ga0070714_100075248 3300005435 Bacteria 2929
23 Ga0070713_100747476 3300005436 Bacteria 935
24 Ga0070710_10035002 3300005437 Bacteria 2735
25 Ga0070701_10064172 3300005438 Bacteria 1945
26 Ga0070711_100009145 3300005439 Bacteria 6089
27 Ga0070711_100243810 3300005439 Bacteria 1406
28 Ga0070705_100009314 3300005440 Bacteria 4879
29 Ga0070678_100065052 3300005456 Bacteria 2705
30 Ga0070662_100035816 3300005457 Bacteria 3507
31 Ga0070706_100001191 3300005467 Bacteria 27870
32 Ga0070707_100307372 3300005468 Bacteria 1541
33 Ga0070707_100785111 3300005468 Bacteria 916
34 Ga0070698_100055911 3300005471 Bacteria 4000
35 Ga0070699_100188411 3300005518 Bacteria 1832
36 Ga0070697_100175897 3300005536 Bacteria 1813
37 Ga0068853_100076131 3300005539 Bacteria 2929
38 Ga0070672_100524323 3300005543 Bacteria 1027
39 Ga0070686_100235753 3300005544 Bacteria 1330
40 Ga0070696_100038624 3300005546 Bacteria 3295
41 Ga0070693_100006791 3300005547 Bacteria 5557
42 Ga0070665_100618509 3300005548 Bacteria 1096
43 Ga0070704_100145473 3300005549 Bacteria 1857
44 Ga0068855_100014218 3300005563 Bacteria 9588
45 Ga0068855_100353768 3300005563 Bacteria 1618
46 Ga0068857_100309472 3300005577 Bacteria 1457
47 Ga0068854_100052653 3300005578 Bacteria 2920
48 Ga0068856_100013653 3300005614 Bacteria 7856
49 Ga0068856_100029557 3300005614 Bacteria 5353
50 Ga0068856_100119702 3300005614 Bacteria 2634
51 Ga0070702_100056114 3300005615 Bacteria 2273
52 Ga0068852_100010992 3300005616 Bacteria 6790
53 Ga0068852_100012840 3300005616 Bacteria 6384
54 Ga0068859_100003150 3300005617 Bacteria 16776
55 Ga0068859_100044854 3300005617 Bacteria 4442
56 Ga0068864_100038934 3300005618 Bacteria 4062
57 Ga0068866_10018872 3300005718 Bacteria 3128
58 Ga0068861_100033783 3300005719 Bacteria 3777
59 Ga0068870_10131102 3300005840 Bacteria 1456
60 Ga0068863_100134297 3300005841 Bacteria 2364
61 Ga0068862_100587163 3300005844 Bacteria 1068
62 Ga0081540_1001908 3300005983 Bacteria 17461
63 Ga0070717_10014302 3300006028 Bacteria 6104
64 Ga0070715_10038727 3300006163 Bacteria 1981
65 Ga0070716_100002348 3300006173 Bacteria 8706
66 Ga0070716_100195942 3300006173 Bacteria 1339
67 Ga0070712_100073735 3300006175 Bacteria 2449
68 Ga0070712_100888167 3300006175 Bacteria 768
69 Ga0097621_100026425 3300006237 Bacteria 4554
70 Ga0068871_100121718 3300006358 Bacteria 2205
71 Ga0075433_10007638 3300006852 Bacteria 8587
72 Ga0075434_100010843 3300006871 Bacteria 8565
73 Ga0068865_100130822 3300006881 Bacteria 1880
74 Ga0075436_100045626 3300006914 Bacteria 3023
75 Ga0097620_100003150 3300006931 Bacteria 16776
76 Ga0097620_100044854 3300006931 Bacteria 4442
77 Ga0075435_100256801 3300007076 Bacteria 1488
78 Ga0105240_10291695 3300009093 Bacteria 1870
79 Ga0105240_10894411 3300009093 Bacteria 956
80 Ga0111539_10129570 3300009094 Bacteria 2954
81 Ga0105245_10150916 3300009098 Bacteria 2197
82 Ga0105245_10271166 3300009098 Bacteria 1655
83 Ga0105247_10013456 3300009101 Bacteria 4907
84 Ga0105247_10051193 3300009101 Bacteria 2543
85 Ga0105243_10012511 3300009148 Bacteria 6417
86 Ga0105241_10012225 3300009174 Bacteria 6299
87 Ga0105241_10066472 3300009174 Bacteria 2788
88 Ga0105242_10028934 3300009176 Bacteria 4415
89 Ga0105248_10128901 3300009177 Bacteria 2854
90 Ga0105237_10017108 3300009545 Bacteria 7522
91 Ga0105237_10053022 3300009545 Bacteria 4069
92 Ga0105237_10474535 3300009545 Bacteria 1257
93 Ga0105238_10096784 3300009551 Bacteria 2937
94 Ga0105249_10002883 3300009553 Bacteria 14846
95 Ga0105239_10015333 3300010375 Bacteria 8491
96 Ga0105246_10045270 3300011119 Bacteria 2995
97 Ga0157373_10122932 3300013100 Bacteria 1824
98 Ga0157370_10013040 3300013104 Bacteria 8582
99 Ga0157369_10131673 3300013105 Bacteria 2650
100 Ga0157374_10008472 3300013296 Bacteria 8793
101 Ga0157374_10193227 3300013296 Bacteria 1991
102 Ga0163162_10007873 3300013306 Bacteria 10382
103 Ga0157372_10031636 3300013307 Bacteria 5794
104 Ga0157372_10459578 3300013307 Bacteria 1484
105 Ga0157375_10127660 3300013308 Bacteria 2660
106 Ga0163163_10043710 3300014325 Bacteria 4394
107 Ga0157379_10065431 3300014968 Bacteria 3249
108 Ga0157376_10200053 3300014969 Bacteria 1837
109 Ga0197907_10016130 3300020069 Bacteria 1900
110 Ga0206356_10902430 3300020070 Bacteria 859
111 Ga0206353_10514055 3300020082 Bacteria 3460
112 Ga0206353_11961309 3300020082 Bacteria 1963
113 Ga0207653_10012523 3300025885 Bacteria 2649
114 Ga0207692_10004712 3300025898 Bacteria 5413
115 Ga0207692_10332648 3300025898 Bacteria 932
116 Ga0207642_10061614 3300025899 Bacteria 1745
117 Ga0207710_10003622 3300025900 Bacteria 6847
118 Ga0207710_10030468 3300025900 Bacteria 2354
119 Ga0207688_10005792 3300025901 Bacteria 6727
120 Ga0207685_10011041 3300025905 Bacteria 2698
121 Ga0207685_10069078 3300025905 Bacteria 1426
122 Ga0207699_10015876 3300025906 Bacteria 3924
123 Ga0207699_10037101 3300025906 Bacteria 2783
124 Ga0207705_10094937 3300025909 Bacteria 2188
125 Ga0207705_10218276 3300025909 Bacteria 1448
126 Ga0207684_10002644 3300025910 Bacteria 17927
127 Ga0207654_10180183 3300025911 Bacteria 1378
128 Ga0207671_10033687 3300025914 Bacteria 3809
129 Ga0207671_10305886 3300025914 Bacteria 1256
130 Ga0207671_10716363 3300025914 Bacteria 795
131 Ga0207693_10000579 3300025915 Bacteria 32734
132 Ga0207662_10061495 3300025918 Bacteria 2255
133 Ga0207657_10050434 3300025919 Bacteria 3623
134 Ga0207646_10281443 3300025922 Bacteria 1503
135 Ga0207694_10102604 3300025924 Bacteria 2268
136 Ga0207650_10201263 3300025925 Bacteria 1595
137 Ga0207687_10036723 3300025927 Bacteria 3338
138 Ga0207687_10253687 3300025927 Bacteria 1399
139 Ga0207700_10060971 3300025928 Bacteria 2859
140 Ga0207664_10113746 3300025929 Bacteria 2254
141 Ga0207664_10142446 3300025929 Bacteria 2029
142 Ga0207706_10044120 3300025933 Bacteria 3952
143 Ga0207686_10153112 3300025934 Bacteria 1607
144 Ga0207686_10439101 3300025934 Bacteria 1002
145 Ga0207709_10253010 3300025935 Bacteria 1288
146 Ga0207669_10024634 3300025937 Bacteria 3238
147 Ga0207704_10458069 3300025938 Bacteria 1019
148 Ga0207665_10003426 3300025939 Bacteria 10610
149 Ga0207689_10019426 3300025942 Bacteria 5728
150 Ga0207689_10117488 3300025942 Bacteria 2187
151 Ga0207667_10022404 3300025949 Bacteria 6980
152 Ga0207667_10078949 3300025949 Bacteria 3411
153 Ga0207667_10105338 3300025949 Bacteria 2909
154 Ga0207712_10005510 3300025961 Bacteria 7984
155 Ga0207668_10004499 3300025972 Bacteria 8194
156 Ga0207658_10013197 3300025986 Bacteria 5642
157 Ga0207658_10071468 3300025986 Bacteria 2628
158 Ga0207658_10419395 3300025986 Bacteria 1180
159 Ga0207677_10035438 3300026023 Bacteria 3241
160 Ga0207678_10007746 3300026067 Bacteria 9489
161 Ga0207702_10011808 3300026078 Bacteria 7272
162 Ga0207702_10051508 3300026078 Bacteria 3480
163 Ga0207702_10077443 3300026078 Bacteria 2876
164 Ga0207702_10077922 3300026078 Bacteria 2868
165 Ga0207674_10232861 3300026116 Bacteria 1790
166 Ga0207674_10722778 3300026116 Bacteria 961
167 Ga0207675_100001639 3300026118 Bacteria 22443
168 Ga0207683_11103791 3300026121 Bacteria 736
169 Ga0207698_10008111 3300026142 Bacteria 6621
170 Ga0265338_10004156 3300028800 Bacteria 19774
171 Ga0307408_100007993 3300031548 Bacteria 6994
172 Ga0307406_10006578 3300031901 Bacteria 6424
173 Ga0307409_100108666 3300031995 Bacteria 2320
174 Ga0307416_100462273 3300032002 Bacteria 1324
175 Ga0373930_0019811 3300034816 Bacteria 1305
176 Ga0373950_0003341 3300034818 Bacteria 2287
177 Ga0373938_0003017 3300034957 Bacteria 2732
178 Ga0373928_0019717 3300035084 Bacteria 1409
179 Ga0373939_0010042 3300035114 Bacteria 2358
180 Ga0373941_0009374 3300035115 Bacteria 2464
181 Ga0373943_0019729 3300035170 Bacteria 3103
182 Ga0373962_0003429 3300035242 Bacteria 3808
183 Ga0373935_0085445 3300035692 Bacteria 2057
184 Ga0373937_0426895 3300036401 Bacteria 1258
185 Ga0373925_0050473 3300037068 Bacteria 3102
186 Ga0373925_0062582 3300037068 Bacteria 2798
187 Ga0395900_0029090 3300037418 Bacteria 5667
188 Ga0395898_0228598 3300037466 Bacteria 1774
189 Ga0466969_0040061 3300044656 Bacteria 2349
190 Ga0466972_0092973 3300044658 Bacteria 1430
191 Ga0466966_0059194 3300044684 Bacteria 2419
192 Ga0466966_0076365 3300044684 Bacteria 2092
193 Ga0466966_0097156 3300044684 Bacteria 1824
194 Ga0466966_0185577 3300044684 Bacteria 1261
195 Ga0466961_0007879 3300044693 Bacteria 6785
196 Ga0466961_0022575 3300044693 Bacteria 4048
197 Ga0466961_0050676 3300044693 Bacteria 2651
198 Ga0466961_0056760 3300044693 Bacteria 2495
199 Ga0466961_0091308 3300044693 Bacteria 1923
200 Ga0466961_0103862 3300044693 Bacteria 1789
201 Ga0466961_0122467 3300044693 Bacteria 1632
202 Ga0466961_0194120 3300044693 Bacteria 1258
203 Ga0466963_0001664 3300044694 Bacteria 12111
204 Ga0466963_0017513 3300044694 Bacteria 4467
205 Ga0466963_0035065 3300044694 Bacteria 3267
206 Ga0466963_0102724 3300044694 Bacteria 1958
207 Ga0466964_0050107 3300044706 Bacteria 1711
208 Ga0466964_0264247 3300044706 Bacteria 854
209 Ga0466971_0016777 3300044719 Bacteria 3235
210 Ga0466971_0095177 3300044719 Bacteria 1365
211 Ga0466968_0103414 3300044735 Bacteria 1274
212 Ga0466970_0182228 3300044765 Bacteria 1165
213 Ga0466957_0036890 3300044842 Bacteria 2941
214 Ga0466957_0043606 3300044842 Bacteria 2717
215 Ga0466960_0018079 3300044901 Bacteria 3084
216 Ga0466959_0032877 3300045049 Bacteria 3839
217 Ga0466959_0164438 3300045049 Bacteria 1559
218 Ga0466959_0168166 3300045049 Bacteria 1539
219 Ga0466958_0017810 3300045836 Bacteria 4114
220 Ga0466958_0273622 3300045836 Bacteria 1082
221 Ga0466967_0000579 3300045976 Bacteria 18061
222 Ga0466967_0002683 3300045976 Bacteria 11236
223 Ga0466967_0003275 3300045976 Bacteria 10498
224 Ga0466967_0094259 3300045976 Bacteria 2726
225 Ga0466967_0945637 3300045976 Bacteria 857
226 Ga0495627_121512 3300046453 Bacteria 737
227 Ga0495603_0269778 3300046455 Bacteria 979
228 Ga0495662_0032802 3300046476 Bacteria 2509
229 Ga0495664_0436981 3300046477 Bacteria 784
230 Ga0495585_0012992 3300046492 Bacteria 4889
231 Ga0495628_0222856 3300046516 Bacteria 1416
232 Ga0495652_0451663 3300046529 Bacteria 900
233 Ga0495640_0018337 3300046533 Bacteria 5195
234 Ga0495586_0328826 3300046535 Bacteria 877
235 Ga0495645_0448617 3300046543 Bacteria 814
236 Ga0495599_0157788 3300046678 Bacteria 1403
237 Ga0495646_0048667 3300046680 Bacteria 2574
238 Ga0495624_0165439 3300046690 Bacteria 1350
239 Ga0495674_0018519 3300047319 Bacteria 6481
240 Ga0495676_0237434 3300047321 Bacteria 1249
241 Ga0496101_0019625 3300048904 Bacteria 4618
242 Ga0496102_0000094 3300048905 Bacteria 125159
243 Ga0496102_0001805 3300048905 Bacteria 18518
244 Ga0496103_0000042 3300048906 Bacteria 168701
245 Ga0496103_0176587 3300048906 Bacteria 1372
246 Ga0496104_0028730 3300048907 Bacteria 5154
247 Ga0496105_0005684 3300048908 Bacteria 9489
248 Ga0496106_0078632 3300048909 Bacteria 2531
249 Ga0496108_0030536 3300048911 Bacteria 4466
250 Ga0496110_0133027 3300048913 Bacteria 2247
251 Ga0496113_0009068 3300048916 Bacteria 6518
252 Ga0496114_0013827 3300048917 Bacteria 6471
253 Ga0496115_0003985 3300048918 Bacteria 10651
254 Ga0496117_0104102 3300048920 Bacteria 1787
255 Ga0496119_0017704 3300048922 Bacteria 5347
256 Ga0496121_0313188 3300048924 Bacteria 1060
257 Ga0496126_0100719 3300048929 Bacteria 2528
258 Ga0501031_0049655 3300049568 Bacteria 2734
259 Ga0501033_0078578 3300049570 Bacteria 2421
260 Ga0501033_0197278 3300049570 Bacteria 1439
261 Ga0501034_0094570 3300049571 Bacteria 2985
262 Ga0501037_0101950 3300049573 Bacteria 2071
263 Ga0501038_0013032 3300049574 Bacteria 7582
264 Ga0501043_0081521 3300049579 Bacteria 2542
265 Ga0501047_0030812 3300049581 Bacteria 5170
266 Ga0501047_0231790 3300049581 Bacteria 1700
267 Ga0501070_0025875 3300049586 Bacteria 4923
268 Ga0501070_0499168 3300049586 Bacteria 978
269 Ga0501035_0021794 3300049822 Bacteria 5889
270 Ga0501035_0298452 3300049822 Bacteria 1358
271 Ga0501044_0009778 3300049823 Bacteria 10430
272 nmdc:mga0n895_5014_c1 3300050512 Bacteria 10984
273 nmdc:mga0a205_25422_c1 3300050515 Bacteria 5642
274 Ga0495601_0324649 3300053077 Bacteria 1002
275 Ga0495612_0036238 3300053078 Bacteria 2002
276 Ga0466962_0046533 3300061719 Bacteria 2073
277 Ga0466962_0063378 3300061719 Bacteria 1765

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005434 Ga0070709_10003958 Ga0070709_100039582 160
2 3300006175 Ga0070712_100073735 Ga0070712_1000737354 166
3 3300006175 Ga0070712_100888167 Ga0070712_1008881671 167
4 3300046516 Ga0495628_0222856 Ga0495628_0222856_186_719 167
5 3300035170 Ga0373943_0019729 Ga0373943_0019729_559_1071 170
6 3300035692 Ga0373935_0085445 Ga0373935_0085445_78_590 170
7 3300037068 Ga0373925_0062582 Ga0373925_0062582_755_1267 170
8 3300046476 Ga0495662_0032802 Ga0495662_0032802_1833_2345 170
9 3300046477 Ga0495664_0436981 Ga0495664_0436981_40_552 170
10 3300046529 Ga0495652_0451663 Ga0495652_0451663_342_854 170
11 3300046533 Ga0495640_0018337 Ga0495640_0018337_367_879 170
12 3300046535 Ga0495586_0328826 Ga0495586_0328826_121_633 170
13 3300046543 Ga0495645_0448617 Ga0495645_0448617_40_552 170
14 3300046678 Ga0495599_0157788 Ga0495599_0157788_424_936 170
15 3300046680 Ga0495646_0048667 Ga0495646_0048667_754_1266 170
16 3300047319 Ga0495674_0018519 Ga0495674_0018519_5375_5887 170
17 3300047321 Ga0495676_0237434 Ga0495676_0237434_27_539 170
18 3300053077 Ga0495601_0324649 Ga0495601_0324649_327_839 170
19 3300053078 Ga0495612_0036238 Ga0495612_0036238_254_766 170
20 3300005439 Ga0070711_100243810 Ga0070711_1002438102 176
21 3300006173 Ga0070716_100195942 Ga0070716_1001959422 176
22 3300025898 Ga0207692_10004712 Ga0207692_100047126 176
23 3300025905 Ga0207685_10011041 Ga0207685_100110412 176
24 3300025906 Ga0207699_10015876 Ga0207699_100158764 176
25 3300025928 Ga0207700_10060971 Ga0207700_100609712 176
26 3300025929 Ga0207664_10113746 Ga0207664_101137462 176
27 3300037068 Ga0373925_0050473 Ga0373925_0050473_1605_2150 178
28 3300044658 Ga0466972_0092973 Ga0466972_0092973_13_606 185
29 3300045836 Ga0466958_0273622 Ga0466958_0273622_373_1029 186
30 iso_pu_bacteria 2537561592 2537898593 186
31 iso_pu_bacteria 2857710386 2857711755 187
32 3300020069 Ga0197907_10016130 Ga0197907_100161302 189
33 3300031548 Ga0307408_100007993 Ga0307408_1000079933 190
34 3300031901 Ga0307406_10006578 Ga0307406_100065788 190
35 3300031995 Ga0307409_100108666 Ga0307409_1001086662 190
36 3300032002 Ga0307416_100462273 Ga0307416_1004622732 190
37 3300005366 Ga0070659_100575508 Ga0070659_1005755082 191
38 3300005367 Ga0070667_100426352 Ga0070667_1004263522 191
39 3300005467 Ga0070706_100001191 Ga0070706_1000011915 191
40 3300005471 Ga0070698_100055911 Ga0070698_1000559114 191
41 3300005844 Ga0068862_100587163 Ga0068862_1005871632 191
42 3300006028 Ga0070717_10014302 Ga0070717_100143022 191
43 3300013307 Ga0157372_10459578 Ga0157372_104595781 191
44 3300025910 Ga0207684_10002644 Ga0207684_100026445 191
45 3300025925 Ga0207650_10201263 Ga0207650_102012632 191
46 3300025986 Ga0207658_10071468 Ga0207658_100714681 191
47 3300026116 Ga0207674_10722778 Ga0207674_107227781 191
48 3300026121 Ga0207683_11103791 Ga0207683_111037911 191
49 3300028800 Ga0265338_10004156 Ga0265338_100041566 191
50 3300046453 Ga0495627_121512 Ga0495627_121512_86_709 191
51 3300046492 Ga0495585_0012992 Ga0495585_0012992_952_1575 191
52 3300005468 Ga0070707_100307372 Ga0070707_1003073722 194
53 3300025922 Ga0207646_10281443 Ga0207646_102814432 194
54 3300025942 Ga0207689_10117488 Ga0207689_101174882 194
55 3300020082 Ga0206353_11961309 Ga0206353_119613092 195
56 3300025909 Ga0207705_10218276 Ga0207705_102182762 195
57 3300025986 Ga0207658_10013197 Ga0207658_100131975 195
58 3300044684 Ga0466966_0059194 Ga0466966_0059194_1419_2036 195
59 3300045049 Ga0466959_0032877 Ga0466959_0032877_2615_3232 195
60 3300025937 Ga0207669_10024634 Ga0207669_100246342 196
61 3300044693 Ga0466961_0056760 Ga0466961_0056760_872_1519 196
62 3300005548 Ga0070665_100618509 Ga0070665_1006185092 198
63 3300020082 Ga0206353_10514055 Ga0206353_105140553 198
64 3300044693 Ga0466961_0194120 Ga0466961_0194120_268_882 198
65 3300005330 Ga0070690_100085376 Ga0070690_1000853762 199
66 3300005334 Ga0068869_100082592 Ga0068869_1000825922 199
67 3300005335 Ga0070666_10021777 Ga0070666_100217772 199
68 3300005336 Ga0070680_100155177 Ga0070680_1001551772 199
69 3300005337 Ga0070682_100039808 Ga0070682_1000398083 199
70 3300005338 Ga0068868_100015814 Ga0068868_1000158142 199
71 3300005341 Ga0070691_10045448 Ga0070691_100454483 199
72 3300005343 Ga0070687_100015051 Ga0070687_1000150515 199
73 3300005344 Ga0070661_100359471 Ga0070661_1003594712 199
74 3300005347 Ga0070668_100009441 Ga0070668_1000094415 199
75 3300005354 Ga0070675_100582233 Ga0070675_1005822332 199
76 3300005355 Ga0070671_100111615 Ga0070671_1001116152 199
77 3300005364 Ga0070673_100012205 Ga0070673_1000122055 199
78 3300005365 Ga0070688_100129369 Ga0070688_1001293692 199
79 3300005366 Ga0070659_100040312 Ga0070659_1000403122 199
80 3300005434 Ga0070709_10078308 Ga0070709_100783083 199
81 3300005435 Ga0070714_100075248 Ga0070714_1000752482 199
82 3300005436 Ga0070713_100747476 Ga0070713_1007474761 199
83 3300005437 Ga0070710_10035002 Ga0070710_100350024 199
84 3300005438 Ga0070701_10064172 Ga0070701_100641723 199
85 3300005439 Ga0070711_100009145 Ga0070711_1000091456 199
86 3300005440 Ga0070705_100009314 Ga0070705_1000093142 199
87 3300005456 Ga0070678_100065052 Ga0070678_1000650522 199
88 3300005457 Ga0070662_100035816 Ga0070662_1000358162 199
89 3300005468 Ga0070707_100785111 Ga0070707_1007851112 199
90 3300005518 Ga0070699_100188411 Ga0070699_1001884113 199
91 3300005536 Ga0070697_100175897 Ga0070697_1001758972 199
92 3300005539 Ga0068853_100076131 Ga0068853_1000761314 199
93 3300005543 Ga0070672_100524323 Ga0070672_1005243232 199
94 3300005544 Ga0070686_100235753 Ga0070686_1002357532 199
95 3300005546 Ga0070696_100038624 Ga0070696_1000386243 199
96 3300005547 Ga0070693_100006791 Ga0070693_1000067917 199
97 3300005549 Ga0070704_100145473 Ga0070704_1001454733 199
98 3300005577 Ga0068857_100309472 Ga0068857_1003094722 199
99 3300005578 Ga0068854_100052653 Ga0068854_1000526534 199
100 3300005614 Ga0068856_100119702 Ga0068856_1001197022 199
101 3300005615 Ga0070702_100056114 Ga0070702_1000561142 199
102 3300005616 Ga0068852_100010992 Ga0068852_1000109926 199
103 3300005617 Ga0068859_100044854 Ga0068859_1000448545 199
104 3300005618 Ga0068864_100038934 Ga0068864_1000389345 199
105 3300005718 Ga0068866_10018872 Ga0068866_100188722 199
106 3300005719 Ga0068861_100033783 Ga0068861_1000337833 199
107 3300005840 Ga0068870_10131102 Ga0068870_101311022 199
108 3300005841 Ga0068863_100134297 Ga0068863_1001342972 199
109 3300005983 Ga0081540_1001908 Ga0081540_100190814 199
110 3300006163 Ga0070715_10038727 Ga0070715_100387272 199
111 3300006173 Ga0070716_100002348 Ga0070716_1000023486 199
112 3300006237 Ga0097621_100026425 Ga0097621_1000264255 199
113 3300006358 Ga0068871_100121718 Ga0068871_1001217182 199
114 3300006852 Ga0075433_10007638 Ga0075433_100076387 199
115 3300006871 Ga0075434_100010843 Ga0075434_1000108437 199
116 3300006881 Ga0068865_100130822 Ga0068865_1001308223 199
117 3300006914 Ga0075436_100045626 Ga0075436_1000456262 199
118 3300006931 Ga0097620_100044854 Ga0097620_1000448542 199
119 3300007076 Ga0075435_100256801 Ga0075435_1002568012 199
120 3300009093 Ga0105240_10291695 Ga0105240_102916952 199
121 3300009094 Ga0111539_10129570 Ga0111539_101295704 199
122 3300009098 Ga0105245_10150916 Ga0105245_101509162 199
123 3300009101 Ga0105247_10051193 Ga0105247_100511932 199
124 3300009148 Ga0105243_10012511 Ga0105243_100125116 199
125 3300009174 Ga0105241_10012225 Ga0105241_100122256 199
126 3300009176 Ga0105242_10028934 Ga0105242_100289343 199
127 3300009177 Ga0105248_10128901 Ga0105248_101289013 199
128 3300009545 Ga0105237_10053022 Ga0105237_100530223 199
129 3300009551 Ga0105238_10096784 Ga0105238_100967843 199
130 3300009553 Ga0105249_10002883 Ga0105249_100028838 199
131 3300011119 Ga0105246_10045270 Ga0105246_100452702 199
132 3300013100 Ga0157373_10122932 Ga0157373_101229322 199
133 3300013104 Ga0157370_10013040 Ga0157370_100130407 199
134 3300013105 Ga0157369_10131673 Ga0157369_101316732 199
135 3300013296 Ga0157374_10008472 Ga0157374_100084726 199
136 3300013306 Ga0163162_10007873 Ga0163162_100078739 199
137 3300013307 Ga0157372_10031636 Ga0157372_100316365 199
138 3300013308 Ga0157375_10127660 Ga0157375_101276601 199
139 3300014325 Ga0163163_10043710 Ga0163163_100437102 199
140 3300014968 Ga0157379_10065431 Ga0157379_100654312 199
141 3300014969 Ga0157376_10200053 Ga0157376_102000533 199
142 3300020070 Ga0206356_10902430 Ga0206356_109024302 199
143 3300025885 Ga0207653_10012523 Ga0207653_100125233 199
144 3300025898 Ga0207692_10332648 Ga0207692_103326482 199
145 3300025899 Ga0207642_10061614 Ga0207642_100616142 199
146 3300025900 Ga0207710_10030468 Ga0207710_100304682 199
147 3300025901 Ga0207688_10005792 Ga0207688_100057922 199
148 3300025905 Ga0207685_10069078 Ga0207685_100690782 199
149 3300025906 Ga0207699_10037101 Ga0207699_100371012 199
150 3300025914 Ga0207671_10033687 Ga0207671_100336872 199
151 3300025915 Ga0207693_10000579 Ga0207693_1000057924 199
152 3300025918 Ga0207662_10061495 Ga0207662_100614952 199
153 3300025919 Ga0207657_10050434 Ga0207657_100504343 199
154 3300025924 Ga0207694_10102604 Ga0207694_101026042 199
155 3300025927 Ga0207687_10036723 Ga0207687_100367233 199
156 3300025929 Ga0207664_10142446 Ga0207664_101424462 199
157 3300025933 Ga0207706_10044120 Ga0207706_100441201 199
158 3300025934 Ga0207686_10153112 Ga0207686_101531123 199
159 3300025935 Ga0207709_10253010 Ga0207709_102530102 199
160 3300025938 Ga0207704_10458069 Ga0207704_104580692 199
161 3300025939 Ga0207665_10003426 Ga0207665_1000342611 199
162 3300025942 Ga0207689_10019426 Ga0207689_100194265 199
163 3300025949 Ga0207667_10105338 Ga0207667_101053382 199
164 3300025961 Ga0207712_10005510 Ga0207712_100055103 199
165 3300025972 Ga0207668_10004499 Ga0207668_100044996 199
166 3300025986 Ga0207658_10419395 Ga0207658_104193952 199
167 3300026023 Ga0207677_10035438 Ga0207677_100354384 199
168 3300026067 Ga0207678_10007746 Ga0207678_100077462 199
169 3300026078 Ga0207702_10077922 Ga0207702_100779222 199
170 3300026116 Ga0207674_10232861 Ga0207674_102328612 199
171 3300026118 Ga0207675_100001639 Ga0207675_1000016399 199
172 3300034816 Ga0373930_0019811 Ga0373930_0019811_275_874 199
173 3300034818 Ga0373950_0003341 Ga0373950_0003341_272_871 199
174 3300034957 Ga0373938_0003017 Ga0373938_0003017_1035_1634 199
175 3300035084 Ga0373928_0019717 Ga0373928_0019717_617_1216 199
176 3300035114 Ga0373939_0010042 Ga0373939_0010042_685_1284 199
177 3300035115 Ga0373941_0009374 Ga0373941_0009374_1014_1613 199
178 3300035242 Ga0373962_0003429 Ga0373962_0003429_919_1518 199
179 3300044693 Ga0466961_0122467 Ga0466961_0122467_477_1121 199
180 3300044694 Ga0466963_0017513 Ga0466963_0017513_472_1116 199
181 3300044719 Ga0466971_0016777 Ga0466971_0016777_18_662 199
182 3300044842 Ga0466957_0043606 Ga0466957_0043606_586_1230 199
183 3300046455 Ga0495603_0269778 Ga0495603_0269778_60_659 199
184 3300046690 Ga0495624_0165439 Ga0495624_0165439_144_743 199
185 3300048904 Ga0496101_0019625 Ga0496101_0019625_623_1222 199
186 3300048906 Ga0496103_0176587 Ga0496103_0176587_164_763 199
187 3300048907 Ga0496104_0028730 Ga0496104_0028730_3859_4458 199
188 3300048908 Ga0496105_0005684 Ga0496105_0005684_2034_2633 199
189 3300048909 Ga0496106_0078632 Ga0496106_0078632_975_1574 199
190 3300048911 Ga0496108_0030536 Ga0496108_0030536_2862_3461 199
191 3300048913 Ga0496110_0133027 Ga0496110_0133027_373_972 199
192 3300048916 Ga0496113_0009068 Ga0496113_0009068_3810_4409 199
193 3300048917 Ga0496114_0013827 Ga0496114_0013827_5153_5752 199
194 3300048918 Ga0496115_0003985 Ga0496115_0003985_988_1587 199
195 3300048924 Ga0496121_0313188 Ga0496121_0313188_274_882 199
196 3300050512 nmdc:mga0n895_5014_c1 nmdc:mga0n895_5014_c1_26_625 199
197 3300050515 nmdc:mga0a205_25422_c1 nmdc:mga0a205_25422_c1_2372_2971 199
198 3300061719 Ga0466962_0046533 Ga0466962_0046533_920_1564 199
199 3300025934 Ga0207686_10439101 Ga0207686_104391012 200
200 3300005617 Ga0068859_100003150 Ga0068859_10000315017 201
201 3300006931 Ga0097620_100003150 Ga0097620_1000031503 201
202 3300009101 Ga0105247_10013456 Ga0105247_100134563 201
203 3300013296 Ga0157374_10193227 Ga0157374_101932273 201
204 3300025900 Ga0207710_10003622 Ga0207710_100036223 201
205 3300036401 Ga0373937_0426895 Ga0373937_0426895_79_690 201
206 3300048905 Ga0496102_0000094 Ga0496102_0000094_38797_39411 201
207 3300048906 Ga0496103_0000042 Ga0496103_0000042_85027_85641 201
208 3300048920 Ga0496117_0104102 Ga0496117_0104102_542_1156 201
209 3300048922 Ga0496119_0017704 Ga0496119_0017704_3465_4079 201
210 3300044684 Ga0466966_0097156 Ga0466966_0097156_1170_1781 203
211 3300044693 Ga0466961_0050676 Ga0466961_0050676_905_1522 203
212 3300044693 Ga0466961_0103862 Ga0466961_0103862_467_1078 203
213 3300045976 Ga0466967_0003275 Ga0466967_0003275_6149_6808 203
214 3300005563 Ga0068855_100014218 Ga0068855_1000142185 204
215 3300005614 Ga0068856_100013653 Ga0068856_1000136536 204
216 3300009545 Ga0105237_10474535 Ga0105237_104745352 204
217 3300025914 Ga0207671_10305886 Ga0207671_103058862 204
218 3300025949 Ga0207667_10022404 Ga0207667_100224044 204
219 3300026078 Ga0207702_10011808 Ga0207702_100118085 204
220 3300044684 Ga0466966_0185577 Ga0466966_0185577_164_799 204
221 3300044693 Ga0466961_0007879 Ga0466961_0007879_429_1064 204
222 3300044694 Ga0466963_0001664 Ga0466963_0001664_10654_11283 204
223 3300044706 Ga0466964_0050107 Ga0466964_0050107_455_1084 204
224 3300044719 Ga0466971_0095177 Ga0466971_0095177_373_1002 204
225 3300045836 Ga0466958_0017810 Ga0466958_0017810_1336_1965 204
226 3300045976 Ga0466967_0002683 Ga0466967_0002683_7483_8112 204
227 3300061719 Ga0466962_0063378 Ga0466962_0063378_886_1515 204
228 3300044656 Ga0466969_0040061 Ga0466969_0040061_375_1013 205
229 3300044693 Ga0466961_0022575 Ga0466961_0022575_1580_2218 205
230 3300044694 Ga0466963_0102724 Ga0466963_0102724_234_872 205
231 3300044706 Ga0466964_0264247 Ga0466964_0264247_83_700 205
232 3300049568 Ga0501031_0049655 Ga0501031_0049655_1130_1819 205
233 3300049571 Ga0501034_0094570 Ga0501034_0094570_1674_2363 205
234 3300049573 Ga0501037_0101950 Ga0501037_0101950_1078_1767 205
235 3300049574 Ga0501038_0013032 Ga0501038_0013032_6319_7008 205
236 3300049579 Ga0501043_0081521 Ga0501043_0081521_1702_2391 205
237 3300049581 Ga0501047_0030812 Ga0501047_0030812_2625_3314 205
238 3300049586 Ga0501070_0025875 Ga0501070_0025875_1604_2293 205
239 3300049822 Ga0501035_0021794 Ga0501035_0021794_3006_3695 205
240 3300049823 Ga0501044_0009778 Ga0501044_0009778_7468_8157 205
241 3300044694 Ga0466963_0035065 Ga0466963_0035065_1402_2052 206
242 3300044842 Ga0466957_0036890 Ga0466957_0036890_660_1310 206
243 3300044901 Ga0466960_0018079 Ga0466960_0018079_2232_2882 206
244 3300045976 Ga0466967_0000579 Ga0466967_0000579_11024_11674 206
245 3300009093 Ga0105240_10894411 Ga0105240_108944111 207
246 3300044693 Ga0466961_0091308 Ga0466961_0091308_147_809 207
247 3300045049 Ga0466959_0164438 Ga0466959_0164438_229_891 207
248 3300048905 Ga0496102_0001805 Ga0496102_0001805_1435_2058 207
249 3300044735 Ga0466968_0103414 Ga0466968_0103414_200_832 208
250 3300005329 Ga0070683_100550851 Ga0070683_1005508512 209
251 3300005614 Ga0068856_100029557 Ga0068856_1000295573 209
252 3300009545 Ga0105237_10017108 Ga0105237_100171085 209
253 3300010375 Ga0105239_10015333 Ga0105239_100153335 209
254 3300025914 Ga0207671_10716363 Ga0207671_107163631 209
255 3300026078 Ga0207702_10077443 Ga0207702_100774432 209
256 3300037418 Ga0395900_0029090 Ga0395900_0029090_42_707 209
257 3300037466 Ga0395898_0228598 Ga0395898_0228598_1017_1682 209
258 3300045976 Ga0466967_0094259 Ga0466967_0094259_1925_2563 209
259 3300049586 Ga0501070_0499168 Ga0501070_0499168_209_844 209
260 3300044765 Ga0466970_0182228 Ga0466970_0182228_110_769 210
261 3300045049 Ga0466959_0168166 Ga0466959_0168166_376_1035 210
262 3300045976 Ga0466967_0945637 Ga0466967_0945637_97_759 210
263 3300048929 Ga0496126_0100719 Ga0496126_0100719_1814_2485 210
264 3300044684 Ga0466966_0076365 Ga0466966_0076365_457_1131 211
265 3300049570 Ga0501033_0078578 Ga0501033_0078578_362_1009 212
266 3300005616 Ga0068852_100012840 Ga0068852_1000128404 215
267 3300025911 Ga0207654_10180183 Ga0207654_101801832 215
268 3300026078 Ga0207702_10051508 Ga0207702_100515085 215
269 3300026142 Ga0207698_10008111 Ga0207698_100081115 215
270 3300005563 Ga0068855_100353768 Ga0068855_1003537683 216
271 3300009098 Ga0105245_10271166 Ga0105245_102711662 216
272 3300009174 Ga0105241_10066472 Ga0105241_100664723 216
273 3300025909 Ga0207705_10094937 Ga0207705_100949372 216
274 3300025927 Ga0207687_10253687 Ga0207687_102536872 216
275 3300049570 Ga0501033_0197278 Ga0501033_0197278_258_926 216
276 3300049581 Ga0501047_0231790 Ga0501047_0231790_272_940 216
277 3300049822 Ga0501035_0298452 Ga0501035_0298452_36_704 216
278 3300005327 Ga0070658_10317689 Ga0070658_103176892 217
279 3300025949 Ga0207667_10078949 Ga0207667_100789493 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

49

210

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.8384 35 201
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.7604 35 201
6wmv-assembly1.cif.gz_A structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii with evidence of substrate binding 0.7035 35 200
8gyw-assembly1.cif.gz_B cryo-em structure of human cept1 complexed with cdp-choline 0.6486 35 200
5d91-assembly1.cif.gz_A structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.6466 29 208
ID Description Score Start End Superfamily
af_P9WPG3_21_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9739 33 204 1.20.120.1760
af_P0ABF8_3_179_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9302 35 204 1.20.120.1760
af_P9WPG3_21_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9164 33 204 1.20.120.1760
af_P0ABF8_3_179_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8898 35 204 1.20.120.1760
af_A0A1D6JYP0_117_317_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8845 34 205 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A4R6I603-F1-model_v4 deleted 0.9768 33 211
AF-A0A7I8A3N5-F1-model_v4 deleted 0.9735 35 203
AF-A0A5Q5BJ31-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9713 33 207 GO:0005886
GO:0008444
GO:0046474
AF-A0A7D6VJQ3-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9704 35 205 GO:0005886
GO:0008444
GO:0046474
AF-A0A2A3FJM3-F1-model_v4 deleted 0.9701 35 217

Feature Viewer

pLDDT pTM Quality
79.59 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map