F382963

General Info

Members Datasets Scaffolds Average Seq Length
279 153 558 349

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100073625|Ga0070716_1000736251
Length 333
Sequence MPLSRRVSSIAVRLPFFLAVAVAIFCFGCKGTGPTGTTSLQGAGATFPNPLYQKWLSEFSKQNPNVKIDYQSIGSGGGIKQIQAQTVDFGASDAPMTDTELKAAPAELIHIPTVLGAVVLTYNLQGVSKPLRFSPDVIADVFLGKITKWNDPRIKADNADADLPAADITVVHRADGSGTSFVFTDYLSKVSWPVGQGXXGNEGVTGQVKQQPNTIGYIELAYAVQNKLPAALIKNPSGKFVEASIDAVTDLRVSITNASGADAYPISSYTYILAYKDQKDAAKGKALVDFIWWGIHDGEKYAKDLQYAPLPSEIVKRAETKINSLTFGGKPLR

Samples

Sample ID Description Type Environment
1 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
129 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
132 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
133 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
134 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
135 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
136 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
137 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
138 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
139 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
140 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
141 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
142 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
143 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
144 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
145 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
146 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
147 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
148 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.43
Rhizosphere 97.49
Stem 0
Stem Tuber 0
Unclassified 11.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070716_100073625 3300006173 Bacteria 2016
2 CNAas_1000016 3300000532 Bacteria 10639
3 Ga0065714_10064454 3300005288 Bacteria 72991
4 Ga0065712_10000129 3300005290 Bacteria 72972
5 Ga0065712_10098275 3300005290 Bacteria 2124
6 Ga0065715_10089122 3300005293 Bacteria 13940
7 Ga0065715_10099968 3300005293 Bacteria 3348
8 Ga0065715_10212904 3300005293 Bacteria 1306
9 Ga0070676_10023826 3300005328 Unclassified 3443
10 Ga0070690_100006619 3300005330 Bacteria 6581
11 Ga0070670_100159416 3300005331 Bacteria 1955
12 Ga0068869_100006292 3300005334 Bacteria 7516
13 Ga0068869_100043348 3300005334 Bacteria 3231
14 Ga0070680_100008580 3300005336 Bacteria 7830
15 Ga0070682_100010488 3300005337 Bacteria 5259
16 Ga0068868_100056496 3300005338 Bacteria 3099
17 Ga0068868_100107165 3300005338 Bacteria 2267
18 Ga0068868_100397301 3300005338 Bacteria 1189
19 Ga0070691_10060415 3300005341 Bacteria 1822
20 Ga0070687_100013054 3300005343 Bacteria 3690
21 Ga0070687_100058026 3300005343 Bacteria 2032
22 Ga0070692_10019309 3300005345 Bacteria 3288
23 Ga0070692_10105549 3300005345 Bacteria 1551
24 Ga0070692_10187895 3300005345 Bacteria 1201
25 Ga0070669_100012259 3300005353 Bacteria 6083
26 Ga0070669_100054726 3300005353 Bacteria 2923
27 Ga0070669_100122727 3300005353 Bacteria 1984
28 Ga0070671_100039352 3300005355 Unclassified 3925
29 Ga0070673_100075747 3300005364 Bacteria 2715
30 Ga0070701_10064016 3300005438 Bacteria 1947
31 Ga0070701_10070873 3300005438 Bacteria 1863
32 Ga0070705_100110135 3300005440 Bacteria 1758
33 Ga0070700_100000183 3300005441 Bacteria 35579
34 Ga0070700_100014638 3300005441 Unclassified 4432
35 Ga0070700_100115520 3300005441 Bacteria 1791
36 Ga0070700_100143754 3300005441 Bacteria 1624
37 Ga0070700_100204484 3300005441 Bacteria 1389
38 Ga0070694_100026345 3300005444 Bacteria 3767
39 Ga0070694_100035180 3300005444 Bacteria 3309
40 Ga0070694_100238275 3300005444 Unclassified 1371
41 Ga0070708_100486473 3300005445 Bacteria 1164
42 Ga0070678_100039414 3300005456 Unclassified 3333
43 Ga0070662_100032798 3300005457 Bacteria 3652
44 Ga0070681_10002251 3300005458 Bacteria 17609
45 Ga0070681_10022564 3300005458 Bacteria 6321
46 Ga0068867_100013850 3300005459 Bacteria 5709
47 Ga0070685_10013917 3300005466 Bacteria 4256
48 Ga0070706_100000044 3300005467 Bacteria 146303
49 Ga0070706_100009673 3300005467 Bacteria 8961
50 Ga0070706_100069811 3300005467 Bacteria 3250
51 Ga0070699_100003571 3300005518 Bacteria 13748
52 Ga0070679_100002201 3300005530 Bacteria 17609
53 Ga0070697_100000619 3300005536 Bacteria 27010
54 Ga0070697_100001471 3300005536 Bacteria 17920
55 Ga0070697_100008983 3300005536 Bacteria 7807
56 Ga0070686_100007382 3300005544 Bacteria 6130
57 Ga0070695_100083407 3300005545 Bacteria 2118
58 Ga0070696_100059886 3300005546 Unclassified 2662
59 Ga0070696_100100274 3300005546 Bacteria 2074
60 Ga0070693_100049144 3300005547 Bacteria 2405
61 Ga0070693_100073521 3300005547 Unclassified 2020
62 Ga0070704_100094417 3300005549 Bacteria 2238
63 Ga0070704_100407386 3300005549 Bacteria 1162
64 Ga0068855_100065219 3300005563 Unclassified 4246
65 Ga0070664_100106246 3300005564 Unclassified 2445
66 Ga0068857_100023163 3300005577 Bacteria 5464
67 Ga0068854_100115576 3300005578 Bacteria 2030
68 Ga0068856_100238958 3300005614 Unclassified 1832
69 Ga0070702_100017570 3300005615 Unclassified 3692
70 Ga0070702_100025752 3300005615 Bacteria 3155
71 Ga0068859_100001224 3300005617 Bacteria 26195
72 Ga0068859_100013911 3300005617 Bacteria 8072
73 Ga0068859_100080834 3300005617 Bacteria 3292
74 Ga0068859_100087693 3300005617 Bacteria 3160
75 Ga0068859_100137456 3300005617 Bacteria 2517
76 Ga0068864_100224182 3300005618 Bacteria 1736
77 Ga0068866_10005443 3300005718 Bacteria 5253
78 Ga0068861_100011075 3300005719 Bacteria 6266
79 Ga0068861_100022424 3300005719 Unclassified 4549
80 Ga0068861_100024976 3300005719 Bacteria 4327
81 Ga0068870_10012826 3300005840 Bacteria 3924
82 Ga0068863_100022685 3300005841 Bacteria 5995
83 Ga0068863_100103894 3300005841 Bacteria 2703
84 Ga0068863_100122785 3300005841 Bacteria 2477
85 Ga0068863_100251733 3300005841 Bacteria 1706
86 Ga0068860_100037190 3300005843 Bacteria 4660
87 Ga0068860_100075780 3300005843 Bacteria 3199
88 Ga0068860_100228146 3300005843 Bacteria 1809
89 Ga0081539_10004329 3300005985 Bacteria 15834
90 Ga0081539_10097217 3300005985 Bacteria 1508
91 Ga0070716_100022929 3300006173 Bacteria 3305
92 Ga0070716_100144802 3300006173 Bacteria 1521
93 Ga0068871_100026778 3300006358 Bacteria 4502
94 Ga0068871_100072192 3300006358 Bacteria 2842
95 Ga0068871_100193363 3300006358 Bacteria 1753
96 Ga0068871_100222003 3300006358 Bacteria 1637
97 Ga0075433_10008988 3300006852 Bacteria 7979
98 Ga0075433_10083504 3300006852 Bacteria 2819
99 Ga0075433_10097742 3300006852 Unclassified 2598
100 Ga0075433_10170234 3300006852 Bacteria 1938
101 Ga0075434_100010862 3300006871 Bacteria 8559
102 Ga0075434_100262480 3300006871 Bacteria 1746
103 Ga0068865_100009470 3300006881 Bacteria 6043
104 Ga0075436_100000044 3300006914 Bacteria 77101
105 Ga0097620_100001224 3300006931 Bacteria 26195
106 Ga0097620_100013911 3300006931 Bacteria 8072
107 Ga0097620_100080832 3300006931 Bacteria 3292
108 Ga0097620_100087687 3300006931 Bacteria 3160
109 Ga0097620_100137454 3300006931 Bacteria 2517
110 Ga0075435_100001106 3300007076 Bacteria 17164
111 Ga0105245_10016010 3300009098 Bacteria 6534
112 Ga0105245_10381372 3300009098 Bacteria 1404
113 Ga0114129_10007815 3300009147 Bacteria 15214
114 Ga0114129_10010564 3300009147 Bacteria 13168
115 Ga0114129_10233468 3300009147 Bacteria 2476
116 Ga0114129_10285008 3300009147 Bacteria 2206
117 Ga0105243_10005941 3300009148 Bacteria 9457
118 Ga0105243_10025294 3300009148 Bacteria 4535
119 Ga0105243_10440522 3300009148 Unclassified 1220
120 Ga0105241_10015949 3300009174 Bacteria 5505
121 Ga0105241_10040961 3300009174 Bacteria 3498
122 Ga0105241_10167614 3300009174 Unclassified 1811
123 Ga0105241_10212250 3300009174 Bacteria 1622
124 Ga0105242_10239087 3300009176 Bacteria 1632
125 Ga0105248_10025793 3300009177 Bacteria 6537
126 Ga0105248_10051918 3300009177 Bacteria 4601
127 Ga0105248_10142246 3300009177 Bacteria 2706
128 Ga0105248_10283394 3300009177 Bacteria 1865
129 Ga0105237_10010684 3300009545 Bacteria 9748
130 Ga0105238_10008489 3300009551 Bacteria 10284
131 Ga0105249_10036286 3300009553 Bacteria 4471
132 Ga0105249_10043528 3300009553 Bacteria 4083
133 Ga0105249_10063938 3300009553 Bacteria 3382
134 Ga0105249_10098115 3300009553 Unclassified 2751
135 Ga0105249_10757994 3300009553 Bacteria 1033
136 Ga0105239_10002095 3300010375 Bacteria 25841
137 Ga0105239_10145108 3300010375 Bacteria 2647
138 Ga0105239_10253037 3300010375 Bacteria 1979
139 Ga0105239_10444986 3300010375 Bacteria 1469
140 Ga0157373_10002117 3300013100 Bacteria 15029
141 Ga0157373_10307237 3300013100 Unclassified 1126
142 Ga0157374_10011236 3300013296 Bacteria 7744
143 Ga0157378_10011726 3300013297 Bacteria 7673
144 Ga0157378_10019296 3300013297 Bacteria 5993
145 Ga0157378_10032274 3300013297 Bacteria 4627
146 Ga0157378_10057443 3300013297 Bacteria 3468
147 Ga0163162_10020047 3300013306 Bacteria 6567
148 Ga0163162_10063546 3300013306 Bacteria 3735
149 Ga0157372_10049885 3300013307 Bacteria 4656
150 Ga0157375_10021546 3300013308 Bacteria 5913
151 Ga0157375_10056198 3300013308 Unclassified 3884
152 Ga0157375_10090031 3300013308 Unclassified 3126
153 Ga0163163_10115651 3300014325 Bacteria 2713
154 Ga0163163_10155707 3300014325 Bacteria 2329
155 Ga0157380_10002550 3300014326 Bacteria 12297
156 Ga0157380_10009394 3300014326 Bacteria 7004
157 Ga0157379_10227488 3300014968 Bacteria 1690
158 Ga0163161_10183651 3300017792 Bacteria 1605
159 Ga0213876_10000089 3300021384 Bacteria 104386
160 Ga0207697_10044514 3300025315 Bacteria 1826
161 Ga0207688_10015526 3300025901 Bacteria 4130
162 Ga0207647_10002510 3300025904 Bacteria 13895
163 Ga0207645_10050175 3300025907 Bacteria 2664
164 Ga0207643_10013501 3300025908 Unclassified 4425
165 Ga0207684_10000085 3300025910 Bacteria 175922
166 Ga0207684_10032552 3300025910 Bacteria 4432
167 Ga0207684_10225853 3300025910 Unclassified 1616
168 Ga0207684_10449308 3300025910 Bacteria 1107
169 Ga0207654_10044664 3300025911 Unclassified 2518
170 Ga0207707_10000571 3300025912 Bacteria 37397
171 Ga0207707_10096953 3300025912 Bacteria 2577
172 Ga0207660_10023380 3300025917 Unclassified 4174
173 Ga0207662_10003709 3300025918 Bacteria 7912
174 Ga0207662_10007821 3300025918 Bacteria 5825
175 Ga0207652_10002002 3300025921 Bacteria 17598
176 Ga0207681_10076602 3300025923 Bacteria 2349
177 Ga0207694_10080632 3300025924 Bacteria 2554
178 Ga0207709_10003660 3300025935 Bacteria 9061
179 Ga0207709_10011308 3300025935 Bacteria 4923
180 Ga0207665_10035620 3300025939 Bacteria 3305
181 Ga0207665_10072936 3300025939 Bacteria 2346
182 Ga0207691_10027736 3300025940 Bacteria 5307
183 Ga0207711_10005724 3300025941 Bacteria 10487
184 Ga0207711_10034645 3300025941 Bacteria 4276
185 Ga0207711_10120025 3300025941 Bacteria 2346
186 Ga0207689_10002233 3300025942 Bacteria 18143
187 Ga0207689_10051648 3300025942 Bacteria 3389
188 Ga0207689_10054025 3300025942 Bacteria 3309
189 Ga0207679_10350491 3300025945 Unclassified 1287
190 Ga0207712_10022805 3300025961 Bacteria 4126
191 Ga0207712_10040215 3300025961 Unclassified 3208
192 Ga0207712_10080747 3300025961 Bacteria 2366
193 Ga0207640_10116051 3300025981 Bacteria 1908
194 Ga0207677_10131920 3300026023 Bacteria 1899
195 Ga0207677_10251661 3300026023 Bacteria 1435
196 Ga0207639_10213210 3300026041 Bacteria 1663
197 Ga0207708_10000100 3300026075 Bacteria 65501
198 Ga0207708_10044539 3300026075 Unclassified 3381
199 Ga0207708_10048844 3300026075 Bacteria 3221
200 Ga0207708_10188633 3300026075 Bacteria 1640
201 Ga0207708_10259269 3300026075 Bacteria 1403
202 Ga0207648_10065597 3300026089 Unclassified 3165
203 Ga0207648_10145862 3300026089 Bacteria 2087
204 Ga0207648_10302447 3300026089 Bacteria 1435
205 Ga0207648_10321717 3300026089 Bacteria 1390
206 Ga0207676_10039764 3300026095 Bacteria 3600
207 Ga0207676_10165739 3300026095 Bacteria 1919
208 Ga0207676_10253947 3300026095 Bacteria 1584
209 Ga0207674_10012851 3300026116 Bacteria 9347
210 Ga0207674_10240215 3300026116 Bacteria 1758
211 Ga0207675_100002173 3300026118 Bacteria 19497
212 Ga0207675_100012635 3300026118 Bacteria 7890
213 Ga0207675_100088220 3300026118 Bacteria 2913
214 Ga0207683_10184843 3300026121 Bacteria 1891
215 Ga0268265_10031705 3300028380 Bacteria 3819
216 Ga0268265_10148342 3300028380 Bacteria 1974
217 Ga0268265_10164927 3300028380 Bacteria 1887
218 Ga0268264_10051117 3300028381 Bacteria 3443
219 Ga0268264_10234684 3300028381 Bacteria 1696
220 Ga0268264_10311187 3300028381 Bacteria 1486
221 Ga0307408_100049203 3300031548 Bacteria 3026
222 Ga0307408_100310857 3300031548 Bacteria 1324
223 Ga0307405_10267292 3300031731 Bacteria 1281
224 Ga0307406_10091365 3300031901 Bacteria 2050
225 Ga0307412_10124914 3300031911 Bacteria 1859
226 Ga0307409_100508080 3300031995 Bacteria 1175
227 Ga0307416_100189595 3300032002 Bacteria 1937
228 Ga0307416_100220115 3300032002 Bacteria 1820
229 Ga0307414_10022450 3300032004 Bacteria 3980
230 Ga0307411_10012237 3300032005 Bacteria 4671
231 Ga0307415_100098625 3300032126 Bacteria 2136
232 Ga0395900_0326337 3300037418 Bacteria 1514
233 Ga0395898_0075148 3300037466 Bacteria 3264
234 Ga0395905_0470483 3300037471 Bacteria 1156
235 Ga0436364_1017371 3300037853 Bacteria 2056
236 Ga0436365_1738066 3300039437 Bacteria 103785
237 Ga0496107_0197803 3300048910 Unclassified 1494
238 Ga0496110_0240342 3300048913 Bacteria 1648
239 Ga0496112_0227596 3300048915 Bacteria 1820
240 Ga0496112_0548623 3300048915 Bacteria 1090
241 Ga0501297_001303 3300049520 Bacteria 2287
242 Ga0501298_006467 3300049521 Bacteria 1916
243 Ga0501038_0001430 3300049574 Bacteria 21883
244 Ga0501207_010859 3300049654 Bacteria 1348
245 Ga0501216_007347 3300049660 Bacteria 1713
246 Ga0501216_011956 3300049660 Bacteria 1418
247 Ga0501217_002501 3300049661 Unclassified 3626
248 Ga0501217_002640 3300049661 Bacteria 3552
249 Ga0501223_003466 3300049663 Bacteria 3430
250 Ga0501224_008782 3300049664 Bacteria 1476
251 Ga0501227_003726 3300049665 Unclassified 3300
252 Ga0501227_005344 3300049665 Bacteria 2748
253 Ga0501233_006214 3300049668 Bacteria 2239
254 Ga0501235_007335 3300049669 Bacteria 2404
255 Ga0501243_001322 3300049675 Bacteria 3529
256 Ga0501249_008117 3300049679 Bacteria 2178
257 Ga0501253_003229 3300049683 Bacteria 1932
258 Ga0501260_004305 3300049689 Bacteria 1310
259 Ga0501261_004164 3300049690 Bacteria 1781
260 Ga0501225_0003620 3300049705 Bacteria 4657
261 Ga0501225_0010618 3300049705 Bacteria 2607
262 Ga0501234_006810 3300049707 Bacteria 1789
263 Ga0501234_012342 3300049707 Bacteria 1339
264 Ga0501273_000895 3300049770 Bacteria 2634
265 Ga0501273_001742 3300049770 Bacteria 2121
266 Ga0501283_000404 3300049779 Bacteria 5763
267 Ga0501204_010306 3300049850 Bacteria 1094
268 nmdc:mga05p37_4358_c1 3300050507 Bacteria 16518
269 nmdc:mga05p37_91335_c1 3300050507 Unclassified 3752
270 nmdc:mga05p37_9277_c1 3300050507 Bacteria 11635
271 nmdc:mga0n895_117772_c1 3300050512 Bacteria 2676
272 nmdc:mga0n895_30660_c1 3300050512 Bacteria 5141
273 nmdc:mga0n895_68368_c1 3300050512 Bacteria 3519
274 nmdc:mga0rr50_64_c1 3300050513 Bacteria 63318
275 nmdc:mga08x19_61_c1 3300050514 Bacteria 114972
276 nmdc:mga0a205_126952_c1 3300050515 Bacteria 2450
277 nmdc:mga0a205_19136_c1 3300050515 Bacteria 6453
278 nmdc:mga0a205_349567_c1 3300050515 Unclassified 1346
279 nmdc:mga0a205_57755_c1 3300050515 Bacteria 3747
280 Ga0070716_100073625
281 CNAas_1000016
282 Ga0065714_10064454
283 Ga0065712_10000129
284 Ga0065712_10098275
285 Ga0065715_10089122
286 Ga0065715_10099968
287 Ga0065715_10212904
288 Ga0070676_10023826
289 Ga0070690_100006619
290 Ga0070670_100159416
291 Ga0068869_100006292
292 Ga0068869_100043348
293 Ga0070680_100008580
294 Ga0070682_100010488
295 Ga0068868_100056496
296 Ga0068868_100107165
297 Ga0068868_100397301
298 Ga0070691_10060415
299 Ga0070687_100013054
300 Ga0070687_100058026
301 Ga0070692_10019309
302 Ga0070692_10105549
303 Ga0070692_10187895
304 Ga0070669_100012259
305 Ga0070669_100054726
306 Ga0070669_100122727
307 Ga0070671_100039352
308 Ga0070673_100075747
309 Ga0070701_10064016
310 Ga0070701_10070873
311 Ga0070705_100110135
312 Ga0070700_100000183
313 Ga0070700_100014638
314 Ga0070700_100115520
315 Ga0070700_100143754
316 Ga0070700_100204484
317 Ga0070694_100026345
318 Ga0070694_100035180
319 Ga0070694_100238275
320 Ga0070708_100486473
321 Ga0070678_100039414
322 Ga0070662_100032798
323 Ga0070681_10002251
324 Ga0070681_10022564
325 Ga0068867_100013850
326 Ga0070685_10013917
327 Ga0070706_100000044
328 Ga0070706_100009673
329 Ga0070706_100069811
330 Ga0070699_100003571
331 Ga0070679_100002201
332 Ga0070697_100000619
333 Ga0070697_100001471
334 Ga0070697_100008983
335 Ga0070686_100007382
336 Ga0070695_100083407
337 Ga0070696_100059886
338 Ga0070696_100100274
339 Ga0070693_100049144
340 Ga0070693_100073521
341 Ga0070704_100094417
342 Ga0070704_100407386
343 Ga0068855_100065219
344 Ga0070664_100106246
345 Ga0068857_100023163
346 Ga0068854_100115576
347 Ga0068856_100238958
348 Ga0070702_100017570
349 Ga0070702_100025752
350 Ga0068859_100001224
351 Ga0068859_100013911
352 Ga0068859_100080834
353 Ga0068859_100087693
354 Ga0068859_100137456
355 Ga0068864_100224182
356 Ga0068866_10005443
357 Ga0068861_100011075
358 Ga0068861_100022424
359 Ga0068861_100024976
360 Ga0068870_10012826
361 Ga0068863_100022685
362 Ga0068863_100103894
363 Ga0068863_100122785
364 Ga0068863_100251733
365 Ga0068860_100037190
366 Ga0068860_100075780
367 Ga0068860_100228146
368 Ga0081539_10004329
369 Ga0081539_10097217
370 Ga0070716_100022929
371 Ga0070716_100144802
372 Ga0068871_100026778
373 Ga0068871_100072192
374 Ga0068871_100193363
375 Ga0068871_100222003
376 Ga0075433_10008988
377 Ga0075433_10083504
378 Ga0075433_10097742
379 Ga0075433_10170234
380 Ga0075434_100010862
381 Ga0075434_100262480
382 Ga0068865_100009470
383 Ga0075436_100000044
384 Ga0097620_100001224
385 Ga0097620_100013911
386 Ga0097620_100080832
387 Ga0097620_100087687
388 Ga0097620_100137454
389 Ga0075435_100001106
390 Ga0105245_10016010
391 Ga0105245_10381372
392 Ga0114129_10007815
393 Ga0114129_10010564
394 Ga0114129_10233468
395 Ga0114129_10285008
396 Ga0105243_10005941
397 Ga0105243_10025294
398 Ga0105243_10440522
399 Ga0105241_10015949
400 Ga0105241_10040961
401 Ga0105241_10167614
402 Ga0105241_10212250
403 Ga0105242_10239087
404 Ga0105248_10025793
405 Ga0105248_10051918
406 Ga0105248_10142246
407 Ga0105248_10283394
408 Ga0105237_10010684
409 Ga0105238_10008489
410 Ga0105249_10036286
411 Ga0105249_10043528
412 Ga0105249_10063938
413 Ga0105249_10098115
414 Ga0105249_10757994
415 Ga0105239_10002095
416 Ga0105239_10145108
417 Ga0105239_10253037
418 Ga0105239_10444986
419 Ga0157373_10002117
420 Ga0157373_10307237
421 Ga0157374_10011236
422 Ga0157378_10011726
423 Ga0157378_10019296
424 Ga0157378_10032274
425 Ga0157378_10057443
426 Ga0163162_10020047
427 Ga0163162_10063546
428 Ga0157372_10049885
429 Ga0157375_10021546
430 Ga0157375_10056198
431 Ga0157375_10090031
432 Ga0163163_10115651
433 Ga0163163_10155707
434 Ga0157380_10002550
435 Ga0157380_10009394
436 Ga0157379_10227488
437 Ga0163161_10183651
438 Ga0213876_10000089
439 Ga0207697_10044514
440 Ga0207688_10015526
441 Ga0207647_10002510
442 Ga0207645_10050175
443 Ga0207643_10013501
444 Ga0207684_10000085
445 Ga0207684_10032552
446 Ga0207684_10225853
447 Ga0207684_10449308
448 Ga0207654_10044664
449 Ga0207707_10000571
450 Ga0207707_10096953
451 Ga0207660_10023380
452 Ga0207662_10003709
453 Ga0207662_10007821
454 Ga0207652_10002002
455 Ga0207681_10076602
456 Ga0207694_10080632
457 Ga0207709_10003660
458 Ga0207709_10011308
459 Ga0207665_10035620
460 Ga0207665_10072936
461 Ga0207691_10027736
462 Ga0207711_10005724
463 Ga0207711_10034645
464 Ga0207711_10120025
465 Ga0207689_10002233
466 Ga0207689_10051648
467 Ga0207689_10054025
468 Ga0207679_10350491
469 Ga0207712_10022805
470 Ga0207712_10040215
471 Ga0207712_10080747
472 Ga0207640_10116051
473 Ga0207677_10131920
474 Ga0207677_10251661
475 Ga0207639_10213210
476 Ga0207708_10000100
477 Ga0207708_10044539
478 Ga0207708_10048844
479 Ga0207708_10188633
480 Ga0207708_10259269
481 Ga0207648_10065597
482 Ga0207648_10145862
483 Ga0207648_10302447
484 Ga0207648_10321717
485 Ga0207676_10039764
486 Ga0207676_10165739
487 Ga0207676_10253947
488 Ga0207674_10012851
489 Ga0207674_10240215
490 Ga0207675_100002173
491 Ga0207675_100012635
492 Ga0207675_100088220
493 Ga0207683_10184843
494 Ga0268265_10031705
495 Ga0268265_10148342
496 Ga0268265_10164927
497 Ga0268264_10051117
498 Ga0268264_10234684
499 Ga0268264_10311187
500 Ga0307408_100049203
501 Ga0307408_100310857
502 Ga0307405_10267292
503 Ga0307406_10091365
504 Ga0307412_10124914
505 Ga0307409_100508080
506 Ga0307416_100189595
507 Ga0307416_100220115
508 Ga0307414_10022450
509 Ga0307411_10012237
510 Ga0307415_100098625
511 Ga0395900_0326337
512 Ga0395898_0075148
513 Ga0395905_0470483
514 Ga0436364_1017371
515 Ga0436365_1738066
516 Ga0496107_0197803
517 Ga0496110_0240342
518 Ga0496112_0227596
519 Ga0496112_0548623
520 Ga0501297_001303
521 Ga0501298_006467
522 Ga0501038_0001430
523 Ga0501207_010859
524 Ga0501216_007347
525 Ga0501216_011956
526 Ga0501217_002501
527 Ga0501217_002640
528 Ga0501223_003466
529 Ga0501224_008782
530 Ga0501227_003726
531 Ga0501227_005344
532 Ga0501233_006214
533 Ga0501235_007335
534 Ga0501243_001322
535 Ga0501249_008117
536 Ga0501253_003229
537 Ga0501260_004305
538 Ga0501261_004164
539 Ga0501225_0003620
540 Ga0501225_0010618
541 Ga0501234_006810
542 Ga0501234_012342
543 Ga0501273_000895
544 Ga0501273_001742
545 Ga0501283_000404
546 Ga0501204_010306
547 nmdc:mga05p37_4358_c1
548 nmdc:mga05p37_91335_c1
549 nmdc:mga05p37_9277_c1
550 nmdc:mga0n895_117772_c1
551 nmdc:mga0n895_30660_c1
552 nmdc:mga0n895_68368_c1
553 nmdc:mga0rr50_64_c1
554 nmdc:mga08x19_61_c1
555 nmdc:mga0a205_126952_c1
556 nmdc:mga0a205_19136_c1
557 nmdc:mga0a205_349567_c1
558 nmdc:mga0a205_57755_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12849

PBP_like_2

PBP superfamily domain

31

292

0.89

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

37

291

0.84

PF12727

PBP_like

PBP superfamily domain

56

197

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pc3-assembly1.cif.gz_A crystal structure of the extracellular phosphate abc transport receptor (psts-1) and immunodominant antigen of m. tuberculosis. 0.9626 33 350
5i84-assembly3.cif.gz_C structure of the xanthomonas citri phosphate-binding protein phox 0.96 37 343
5i84-assembly5.cif.gz_E structure of the xanthomonas citri phosphate-binding protein phox 0.9548 37 343
8ods-assembly1.cif.gz_A phosphate-binding protein (psts) from xanthomonas citri pv. citri a306 bound to phosphate 0.9524 36 348
1pbp-assembly1.cif.gz_A fine tuning of the specificity of the periplasmic phosphate transport receptor: site-directed mutagenesis, ligand binding, and crystallographic studies 0.9476 35 356
ID Description Score Start End Superfamily
1pc3B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9552 114 289 3.40.190.10
af_P0AG82_103_278_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.955 115 289 3.40.190.10
af_Q58421_135_323_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.945 116 289 3.40.190.10
af_Q2FYP6_33_111_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9407 36 100 3.40.190.10
af_P0AG82_103_278_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.939 115 289 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2V5PJC1-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9903 90 349 GO:0035435
GO:0042301
GO:0043190
AF-A0A3L7YJ45-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9887 111 356 GO:0035435
GO:0042301
GO:0043190
AF-A0A1Q7M8L9-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9866 143 356 GO:0035435
GO:0042301
GO:0043190
AF-A0A3C1JPN0-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9845 73 356 GO:0035435
GO:0042301
GO:0043190
AF-A0A2V6G038-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9842 35 349 GO:0035435
GO:0042301
GO:0043190

Map