F382951

General Info

Members Datasets Scaffolds Average Seq Length
279 145 558 290

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10028035|Ga0081538_100280352
Length 286
Sequence MPERDHYIPGVPCWVDTSQPEPEASLEFYGGLFGWELENSMPAEAPGEYFMARIRGGDVAAIGSIPEGMPRVASWNTYIAVAGADETAAKVRDAGGTVLMAPFDVMSSGRMAVCADPEGAVFFLWQAGEHFGAGVVNEHGALNFNGLNTRDVSGAKAFYGAVFGWTTLDLGGSEMWTLPGYGDDLERDNPDLRKMIGEMGGPPGFEDVVAALTPIGADQPDTPAHWSVTFGVDDADAVAAKAAELGGAVLVPPFDAPWSRLTIVSDPQGATFVASQFVLENKDLGG

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
57 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
64 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
65 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
66 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
67 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
68 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
69 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
70 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
71 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
81 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
85 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
86 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
87 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
88 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
89 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
90 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
95 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
96 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
97 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
102 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
140 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
141 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.23
Nodule 0
Rhizoplane 9.32
Rhizosphere 84.59
Stem 0
Stem Tuber 0
Unclassified 2.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10028035 3300005981 Bacteria 3885
2 JGI25407J50210_10034193 3300003373 Bacteria 1311
3 JGI25407J50210_10047831 3300003373 Bacteria 1086
4 Ga0070690_100249853 3300005330 Bacteria 1254
5 Ga0068869_100333005 3300005334 Bacteria 1234
6 Ga0070674_100031375 3300005356 Bacteria 3521
7 Ga0070673_100100726 3300005364 Bacteria 2379
8 Ga0070714_100268575 3300005435 Bacteria 1581
9 Ga0070713_100058597 3300005436 Bacteria 3212
10 Ga0070711_100062948 3300005439 Bacteria 2587
11 Ga0070708_100320413 3300005445 Bacteria 1460
12 Ga0070706_100549834 3300005467 Unclassified 1074
13 Ga0070707_100463029 3300005468 Bacteria 1229
14 Ga0070686_100128918 3300005544 Bacteria 1747
15 Ga0070686_100210245 3300005544 Bacteria 1400
16 Ga0070665_100490778 3300005548 Bacteria 1239
17 Ga0070664_100092114 3300005564 Bacteria 2624
18 Ga0068866_10068173 3300005718 Bacteria 1870
19 Ga0068866_10190490 3300005718 Bacteria 1218
20 Ga0081455_10007202 3300005937 Bacteria 11755
21 Ga0081455_10010436 3300005937 Bacteria 9427
22 Ga0081455_10014523 3300005937 Bacteria 7712
23 Ga0081455_10059754 3300005937 Bacteria 3217
24 Ga0081455_10061622 3300005937 Bacteria 3156
25 Ga0081455_10185024 3300005937 Bacteria 1574
26 Ga0081538_10000167 3300005981 Bacteria 70351
27 Ga0081538_10000285 3300005981 Bacteria 57944
28 Ga0081538_10000731 3300005981 Bacteria 35867
29 Ga0081538_10002843 3300005981 Bacteria 16556
30 Ga0081538_10014444 3300005981 Bacteria 6183
31 Ga0081538_10024820 3300005981 Bacteria 4255
32 Ga0081538_10073938 3300005981 Bacteria 1859
33 Ga0081538_10078946 3300005981 Bacteria 1763
34 Ga0081538_10089567 3300005981 Bacteria 1596
35 Ga0081538_10140406 3300005981 Bacteria 1115
36 Ga0081539_10003284 3300005985 Bacteria 20268
37 Ga0081539_10035943 3300005985 Bacteria 2970
38 Ga0081539_10088463 3300005985 Bacteria 1607
39 Ga0070717_10094959 3300006028 Bacteria 2523
40 Ga0070717_10141384 3300006028 Bacteria 2076
41 Ga0070717_10454419 3300006028 Bacteria 1155
42 Ga0075365_10000367 3300006038 Bacteria 16363
43 Ga0075365_10007346 3300006038 Bacteria 6163
44 Ga0075364_10029421 3300006051 Bacteria 3523
45 Ga0075364_10116242 3300006051 Bacteria 1788
46 Ga0070712_100029511 3300006175 Bacteria 3677
47 Ga0070712_100031082 3300006175 Bacteria 3594
48 Ga0070712_100220615 3300006175 Bacteria 1501
49 Ga0075428_100073567 3300006844 Bacteria 3732
50 Ga0075428_100402961 3300006844 Bacteria 1466
51 Ga0075428_100647101 3300006844 Bacteria 1127
52 Ga0075430_100006490 3300006846 Bacteria 9862
53 Ga0075430_100167064 3300006846 Bacteria 1831
54 Ga0075431_100114881 3300006847 Bacteria 2779
55 Ga0075431_100169406 3300006847 Bacteria 2244
56 Ga0075431_100185807 3300006847 Bacteria 2131
57 Ga0075433_10007627 3300006852 Bacteria 8591
58 Ga0075434_100126199 3300006871 Bacteria 2576
59 Ga0075429_100255737 3300006880 Bacteria 1533
60 Ga0075435_100066582 3300007076 Bacteria 2931
61 Ga0075435_100190010 3300007076 Unclassified 1738
62 Ga0111539_10003841 3300009094 Bacteria 19785
63 Ga0111539_10054703 3300009094 Bacteria 4747
64 Ga0111539_10239783 3300009094 Bacteria 2111
65 Ga0111539_10293748 3300009094 Bacteria 1891
66 Ga0111539_10834352 3300009094 Bacteria 1072
67 Ga0105245_10006357 3300009098 Bacteria 10396
68 Ga0105245_10585040 3300009098 Bacteria 1141
69 Ga0114129_10000894 3300009147 Bacteria 38837
70 Ga0114129_10201075 3300009147 Bacteria 2698
71 Ga0114129_10354215 3300009147 Bacteria 1944
72 Ga0114129_10881008 3300009147 Bacteria 1136
73 Ga0105243_10300177 3300009148 Bacteria 1455
74 Ga0105243_10341899 3300009148 Bacteria 1371
75 Ga0105241_10090443 3300009174 Bacteria 2414
76 Ga0105248_10581414 3300009177 Bacteria 1264
77 Ga0105239_10128819 3300010375 Bacteria 2813
78 Ga0163162_10091412 3300013306 Bacteria 3126
79 Ga0157375_10050750 3300013308 Bacteria 4070
80 Ga0157375_10364109 3300013308 Bacteria 1612
81 Ga0157379_10393744 3300014968 Bacteria 1273
82 Ga0213874_10001306 3300021377 Bacteria 5152
83 Ga0213876_10023727 3300021384 Bacteria 3238
84 Ga0213876_10064417 3300021384 Bacteria 1935
85 Ga0207688_10244079 3300025901 Bacteria 1086
86 Ga0207699_10023830 3300025906 Bacteria 3337
87 Ga0207699_10036498 3300025906 Bacteria 2802
88 Ga0207654_10158692 3300025911 Bacteria 1459
89 Ga0207693_10000657 3300025915 Bacteria 31001
90 Ga0207693_10016755 3300025915 Bacteria 5853
91 Ga0207693_10097674 3300025915 Bacteria 2303
92 Ga0207693_10185957 3300025915 Bacteria 1635
93 Ga0207663_10016577 3300025916 Bacteria 4089
94 Ga0207662_10110274 3300025918 Bacteria 1715
95 Ga0207664_10134592 3300025929 Bacteria 2084
96 Ga0207709_10041824 3300025935 Bacteria 2752
97 Ga0207709_10226821 3300025935 Bacteria 1351
98 Ga0207669_10006665 3300025937 Bacteria 5293
99 Ga0207679_10115476 3300025945 Unclassified 2127
100 Ga0207651_10125638 3300025960 Bacteria 1954
101 Ga0207640_10118484 3300025981 Bacteria 1892
102 Ga0207648_10137916 3300026089 Bacteria 2149
103 Ga0207428_10015478 3300027907 Bacteria 6598
104 Ga0207428_10107247 3300027907 Bacteria 2152
105 Ga0207428_10258383 3300027907 Bacteria 1297
106 Ga0373933_0315401 3300035724 Bacteria 1013
107 Ga0395899_0075985 3300037312 Bacteria 2453
108 Ga0395899_0090465 3300037312 Bacteria 2219
109 Ga0395900_0023554 3300037418 Bacteria 6300
110 Ga0395900_0083753 3300037418 Bacteria 3276
111 Ga0395900_0591612 3300037418 Bacteria 1051
112 Ga0395898_0027068 3300037466 Bacteria 5760
113 Ga0395898_0075241 3300037466 Bacteria 3262
114 Ga0395898_0100127 3300037466 Bacteria 2783
115 Ga0395898_0101530 3300037466 Bacteria 2762
116 Ga0395898_0336163 3300037466 Bacteria 1440
117 Ga0395898_0391748 3300037466 Bacteria 1325
118 Ga0395905_0091893 3300037471 Bacteria 2846
119 Ga0395905_0154577 3300037471 Bacteria 2158
120 Ga0395905_0209909 3300037471 Bacteria 1824
121 Ga0436364_0195175 3300037853 Bacteria 1218
122 Ga0395901_0038290 3300038443 Bacteria 4960
123 Ga0395901_0143027 3300038443 Bacteria 2514
124 Ga0395901_0359886 3300038443 Bacteria 1501
125 Ga0436365_0537608 3300039437 Bacteria 4296
126 Ga0436365_0857027 3300039437 Bacteria 5063
127 Ga0436365_0969899 3300039437 Bacteria 2926
128 Ga0436363_0171783 3300039450 Bacteria 14687
129 Ga0439450_003071 3300042008 Bacteria 2717
130 Ga0439454_006838 3300042011 Bacteria 1416
131 Ga0439463_001673 3300042016 Bacteria 5815
132 Ga0450923_033994 3300042125 Bacteria 1050
133 Ga0439464_0000938 3300042439 Bacteria 6569
134 Ga0439440_0002939 3300042993 Bacteria 3248
135 Ga0466969_0008521 3300044656 Bacteria 5441
136 Ga0466966_0266578 3300044684 Bacteria 1031
137 Ga0466961_0008019 3300044693 Bacteria 6730
138 Ga0466963_0000505 3300044694 Bacteria 18196
139 Ga0466964_0116054 3300044706 Bacteria 1200
140 Ga0466959_0001552 3300045049 Bacteria 14126
141 Ga0466967_0095137 3300045976 Bacteria 2714
142 Ga0495641_0061095 3300046461 Bacteria 1701
143 Ga0495651_0073558 3300046462 Bacteria 2593
144 Ga0495594_0160023 3300046499 Bacteria 1280
145 Ga0495608_0011158 3300046511 Bacteria 6254
146 Ga0495628_0022898 3300046516 Bacteria 5128
147 Ga0495630_0114480 3300046517 Bacteria 2044
148 Ga0495665_0064731 3300046531 Bacteria 1930
149 Ga0495586_0078420 3300046535 Bacteria 1812
150 Ga0495635_0048926 3300046663 Bacteria 2914
151 Ga0495657_0028384 3300046675 Bacteria 3937
152 Ga0495599_0219310 3300046678 Bacteria 1164
153 Ga0495646_0114097 3300046680 Bacteria 1535
154 Ga0495658_0150738 3300046683 Bacteria 1428
155 Ga0495658_0434775 3300046683 Bacteria 838
156 Ga0495604_0189620 3300047317 Bacteria 1433
157 Ga0495676_0024622 3300047321 Bacteria 5207
158 Ga0495676_0032992 3300047321 Bacteria 4365
159 Ga0495676_0076802 3300047321 Bacteria 2549
160 Ga0495676_0180057 3300047321 Bacteria 1482
161 Ga0495680_0004879 3300047322 Bacteria 12704
162 Ga0495675_0040529 3300047444 Bacteria 2968
163 Ga0495602_0005396 3300048088 Bacteria 13409
164 Ga0496100_0043583 3300048903 Bacteria 2870
165 Ga0496101_0002233 3300048904 Bacteria 11839
166 Ga0496101_0020309 3300048904 Bacteria 4544
167 Ga0496101_0264527 3300048904 Bacteria 1342
168 Ga0496102_0026070 3300048905 Bacteria 5210
169 Ga0496104_0022778 3300048907 Bacteria 5754
170 Ga0496104_0032060 3300048907 Bacteria 4890
171 Ga0496105_0016492 3300048908 Bacteria 5899
172 Ga0496105_0182538 3300048908 Bacteria 1718
173 Ga0496106_0017303 3300048909 Bacteria 5336
174 Ga0496106_0540147 3300048909 Bacteria 935
175 Ga0496107_0002938 3300048910 Bacteria 11278
176 Ga0496109_0003354 3300048912 Bacteria 13397
177 Ga0496109_0581009 3300048912 Unclassified 1056
178 Ga0496110_0014995 3300048913 Bacteria 6445
179 Ga0496111_0021772 3300048914 Bacteria 4479
180 Ga0496111_0026905 3300048914 Bacteria 4065
181 Ga0496112_0204229 3300048915 Bacteria 1934
182 Ga0496112_0432403 3300048915 Bacteria 1254
183 Ga0496113_0043098 3300048916 Bacteria 3337
184 Ga0496113_0094200 3300048916 Bacteria 2313
185 Ga0496114_0002528 3300048917 Bacteria 13971
186 Ga0496114_0100931 3300048917 Bacteria 2463
187 Ga0496114_0320148 3300048917 Bacteria 1370
188 Ga0496115_0040060 3300048918 Bacteria 3723
189 Ga0496115_0202884 3300048918 Bacteria 1638
190 Ga0501031_0042175 3300049568 Bacteria 2979
191 Ga0501033_0331399 3300049570 Bacteria 1068
192 Ga0501033_0362608 3300049570 Bacteria 1014
193 Ga0501036_0050573 3300049572 Bacteria 3519
194 Ga0501036_0083638 3300049572 Bacteria 2698
195 Ga0501036_0231730 3300049572 Bacteria 1550
196 Ga0501037_0110570 3300049573 Bacteria 1980
197 Ga0501037_0295513 3300049573 Bacteria 1126
198 Ga0501039_0063685 3300049575 Bacteria 2857
199 Ga0501039_0077366 3300049575 Bacteria 2587
200 Ga0501039_0282737 3300049575 Bacteria 1304
201 Ga0501040_0203340 3300049576 Bacteria 1407
202 Ga0501040_0332098 3300049576 Bacteria 1088
203 Ga0501040_0348923 3300049576 Bacteria 1060
204 Ga0501041_0051052 3300049577 Bacteria 2520
205 Ga0501041_0221459 3300049577 Bacteria 1187
206 Ga0501042_0052393 3300049578 Bacteria 2911
207 Ga0501048_0089009 3300049582 Bacteria 2178
208 Ga0501048_0316062 3300049582 Bacteria 1112
209 Ga0501068_0128100 3300049584 Bacteria 1586
210 Ga0501071_0016345 3300049587 Bacteria 5101
211 Ga0501071_0078174 3300049587 Bacteria 2418
212 Ga0501071_0091128 3300049587 Bacteria 2239
213 Ga0501071_0093765 3300049587 Bacteria 2208
214 Ga0501072_0031158 3300049588 Bacteria 4173
215 Ga0501072_0055982 3300049588 Bacteria 3108
216 Ga0501072_0217937 3300049588 Bacteria 1521
217 Ga0501074_0076129 3300049590 Bacteria 2409
218 Ga0501074_0109463 3300049590 Bacteria 1977
219 Ga0501075_0082387 3300049591 Bacteria 2437
220 Ga0501075_0097854 3300049591 Bacteria 2227
221 Ga0501076_0020429 3300049592 Bacteria 5070
222 Ga0501076_0049390 3300049592 Bacteria 3327
223 Ga0501076_0057487 3300049592 Bacteria 3089
224 Ga0501076_0059521 3300049592 Bacteria 3038
225 Ga0501076_0092593 3300049592 Bacteria 2432
226 Ga0501076_0151295 3300049592 Bacteria 1888
227 Ga0501077_0094739 3300049593 Bacteria 1893
228 Ga0501077_0188387 3300049593 Bacteria 1311
229 Ga0501079_0035293 3300049741 Bacteria 3849
230 Ga0501079_0058818 3300049741 Bacteria 2966
231 Ga0501079_0064408 3300049741 Bacteria 2828
232 Ga0501081_0132702 3300049743 Bacteria 1780
233 Ga0501081_0165243 3300049743 Bacteria 1596
234 Ga0501045_0026607 3300049824 Bacteria 4163
235 Ga0501045_0053424 3300049824 Bacteria 2952
236 nmdc:mga03n38_23825_c1 3300050490 Bacteria 2495
237 nmdc:mga00v17_137793_c1 3300050491 Bacteria 1563
238 nmdc:mga00v17_14633_c1 3300050491 Bacteria 4385
239 nmdc:mga00v17_23011_c1 3300050491 Bacteria 3602
240 nmdc:mga0yw44_3722_c1 3300050492 Bacteria 6830
241 nmdc:mga05p37_123337_c1 3300050507 Bacteria 3182
242 nmdc:mga05p37_234557_c1 3300050507 Bacteria 2209
243 nmdc:mga05p37_429340_c1 3300050507 Bacteria 1535
244 nmdc:mga05p37_93891_c1 3300050507 Bacteria 3697
245 nmdc:mga05p37_94154_c1 3300050507 Bacteria 3691
246 nmdc:mga0qj67_464609_c1 3300050509 Bacteria 1019
247 nmdc:mga06r32_128023_c1 3300050510 Bacteria 2509
248 nmdc:mga06r32_141226_c1 3300050510 Bacteria 2385
249 nmdc:mga06r32_19280_c1 3300050510 Bacteria 6260
250 nmdc:mga06r32_350063_c1 3300050510 Bacteria 1462
251 nmdc:mga08y16_113502_c1 3300050511 Bacteria 2820
252 nmdc:mga08y16_12935_c1 3300050511 Bacteria 8778
253 nmdc:mga08y16_138580_c1 3300050511 Bacteria 2529
254 nmdc:mga08y16_171817_c1 3300050511 Bacteria 2251
255 nmdc:mga08y16_45047_c1 3300050511 Bacteria 4622
256 nmdc:mga08y16_605540_c1 3300050511 Bacteria 1104
257 nmdc:mga08y16_726006_c1 3300050511 Bacteria 991
258 nmdc:mga0n895_123921_c1 3300050512 Bacteria 2607
259 nmdc:mga0n895_42123_c1 3300050512 Bacteria 4442
260 nmdc:mga0rr50_36477_c1 3300050513 Bacteria 3541
261 nmdc:mga0rr50_387929_c1 3300050513 Unclassified 1178
262 nmdc:mga0a205_110375_c1 3300050515 Bacteria 2649
263 Ga0495655_0064506 3300053083 Bacteria 1008
264 Ga0495595_0027214 3300053084 Bacteria 2546
265 Ga0495619_0060523 3300053085 Bacteria 2517
266 Ga0495619_0274543 3300053085 Unclassified 1168
267 Ga0501084_0008466 3300054114 Bacteria 8506
268 Ga0501084_0125860 3300054114 Bacteria 2156
269 Ga0501084_0339907 3300054114 Bacteria 1268
270 Ga0501082_0022676 3300060353 Bacteria 5407
271 Ga0501082_0089810 3300060353 Bacteria 2653
272 Ga0501082_0439927 3300060353 Bacteria 1139
273 Ga0466962_0060717 3300061719 Bacteria 1805
274 Ga0530510_0003239 3300061734 Bacteria 11184
275 Ga0530510_0010378 3300061734 Bacteria 6530
276 Ga0530510_0024724 3300061734 Bacteria 4290
277 Ga0530510_0052652 3300061734 Bacteria 2941
278 Ga0530510_0105648 3300061734 Bacteria 2061
279 Ga0530510_0154698 3300061734 Bacteria 1694
280 Ga0081538_10028035
281 JGI25407J50210_10034193
282 JGI25407J50210_10047831
283 Ga0070690_100249853
284 Ga0068869_100333005
285 Ga0070674_100031375
286 Ga0070673_100100726
287 Ga0070714_100268575
288 Ga0070713_100058597
289 Ga0070711_100062948
290 Ga0070708_100320413
291 Ga0070706_100549834
292 Ga0070707_100463029
293 Ga0070686_100128918
294 Ga0070686_100210245
295 Ga0070665_100490778
296 Ga0070664_100092114
297 Ga0068866_10068173
298 Ga0068866_10190490
299 Ga0081455_10007202
300 Ga0081455_10010436
301 Ga0081455_10014523
302 Ga0081455_10059754
303 Ga0081455_10061622
304 Ga0081455_10185024
305 Ga0081538_10000167
306 Ga0081538_10000285
307 Ga0081538_10000731
308 Ga0081538_10002843
309 Ga0081538_10014444
310 Ga0081538_10024820
311 Ga0081538_10073938
312 Ga0081538_10078946
313 Ga0081538_10089567
314 Ga0081538_10140406
315 Ga0081539_10003284
316 Ga0081539_10035943
317 Ga0081539_10088463
318 Ga0070717_10094959
319 Ga0070717_10141384
320 Ga0070717_10454419
321 Ga0075365_10000367
322 Ga0075365_10007346
323 Ga0075364_10029421
324 Ga0075364_10116242
325 Ga0070712_100029511
326 Ga0070712_100031082
327 Ga0070712_100220615
328 Ga0075428_100073567
329 Ga0075428_100402961
330 Ga0075428_100647101
331 Ga0075430_100006490
332 Ga0075430_100167064
333 Ga0075431_100114881
334 Ga0075431_100169406
335 Ga0075431_100185807
336 Ga0075433_10007627
337 Ga0075434_100126199
338 Ga0075429_100255737
339 Ga0075435_100066582
340 Ga0075435_100190010
341 Ga0111539_10003841
342 Ga0111539_10054703
343 Ga0111539_10239783
344 Ga0111539_10293748
345 Ga0111539_10834352
346 Ga0105245_10006357
347 Ga0105245_10585040
348 Ga0114129_10000894
349 Ga0114129_10201075
350 Ga0114129_10354215
351 Ga0114129_10881008
352 Ga0105243_10300177
353 Ga0105243_10341899
354 Ga0105241_10090443
355 Ga0105248_10581414
356 Ga0105239_10128819
357 Ga0163162_10091412
358 Ga0157375_10050750
359 Ga0157375_10364109
360 Ga0157379_10393744
361 Ga0213874_10001306
362 Ga0213876_10023727
363 Ga0213876_10064417
364 Ga0207688_10244079
365 Ga0207699_10023830
366 Ga0207699_10036498
367 Ga0207654_10158692
368 Ga0207693_10000657
369 Ga0207693_10016755
370 Ga0207693_10097674
371 Ga0207693_10185957
372 Ga0207663_10016577
373 Ga0207662_10110274
374 Ga0207664_10134592
375 Ga0207709_10041824
376 Ga0207709_10226821
377 Ga0207669_10006665
378 Ga0207679_10115476
379 Ga0207651_10125638
380 Ga0207640_10118484
381 Ga0207648_10137916
382 Ga0207428_10015478
383 Ga0207428_10107247
384 Ga0207428_10258383
385 Ga0373933_0315401
386 Ga0395899_0075985
387 Ga0395899_0090465
388 Ga0395900_0023554
389 Ga0395900_0083753
390 Ga0395900_0591612
391 Ga0395898_0027068
392 Ga0395898_0075241
393 Ga0395898_0100127
394 Ga0395898_0101530
395 Ga0395898_0336163
396 Ga0395898_0391748
397 Ga0395905_0091893
398 Ga0395905_0154577
399 Ga0395905_0209909
400 Ga0436364_0195175
401 Ga0395901_0038290
402 Ga0395901_0143027
403 Ga0395901_0359886
404 Ga0436365_0537608
405 Ga0436365_0857027
406 Ga0436365_0969899
407 Ga0436363_0171783
408 Ga0439450_003071
409 Ga0439454_006838
410 Ga0439463_001673
411 Ga0450923_033994
412 Ga0439464_0000938
413 Ga0439440_0002939
414 Ga0466969_0008521
415 Ga0466966_0266578
416 Ga0466961_0008019
417 Ga0466963_0000505
418 Ga0466964_0116054
419 Ga0466959_0001552
420 Ga0466967_0095137
421 Ga0495641_0061095
422 Ga0495651_0073558
423 Ga0495594_0160023
424 Ga0495608_0011158
425 Ga0495628_0022898
426 Ga0495630_0114480
427 Ga0495665_0064731
428 Ga0495586_0078420
429 Ga0495635_0048926
430 Ga0495657_0028384
431 Ga0495599_0219310
432 Ga0495646_0114097
433 Ga0495658_0150738
434 Ga0495658_0434775
435 Ga0495604_0189620
436 Ga0495676_0024622
437 Ga0495676_0032992
438 Ga0495676_0076802
439 Ga0495676_0180057
440 Ga0495680_0004879
441 Ga0495675_0040529
442 Ga0495602_0005396
443 Ga0496100_0043583
444 Ga0496101_0002233
445 Ga0496101_0020309
446 Ga0496101_0264527
447 Ga0496102_0026070
448 Ga0496104_0022778
449 Ga0496104_0032060
450 Ga0496105_0016492
451 Ga0496105_0182538
452 Ga0496106_0017303
453 Ga0496106_0540147
454 Ga0496107_0002938
455 Ga0496109_0003354
456 Ga0496109_0581009
457 Ga0496110_0014995
458 Ga0496111_0021772
459 Ga0496111_0026905
460 Ga0496112_0204229
461 Ga0496112_0432403
462 Ga0496113_0043098
463 Ga0496113_0094200
464 Ga0496114_0002528
465 Ga0496114_0100931
466 Ga0496114_0320148
467 Ga0496115_0040060
468 Ga0496115_0202884
469 Ga0501031_0042175
470 Ga0501033_0331399
471 Ga0501033_0362608
472 Ga0501036_0050573
473 Ga0501036_0083638
474 Ga0501036_0231730
475 Ga0501037_0110570
476 Ga0501037_0295513
477 Ga0501039_0063685
478 Ga0501039_0077366
479 Ga0501039_0282737
480 Ga0501040_0203340
481 Ga0501040_0332098
482 Ga0501040_0348923
483 Ga0501041_0051052
484 Ga0501041_0221459
485 Ga0501042_0052393
486 Ga0501048_0089009
487 Ga0501048_0316062
488 Ga0501068_0128100
489 Ga0501071_0016345
490 Ga0501071_0078174
491 Ga0501071_0091128
492 Ga0501071_0093765
493 Ga0501072_0031158
494 Ga0501072_0055982
495 Ga0501072_0217937
496 Ga0501074_0076129
497 Ga0501074_0109463
498 Ga0501075_0082387
499 Ga0501075_0097854
500 Ga0501076_0020429
501 Ga0501076_0049390
502 Ga0501076_0057487
503 Ga0501076_0059521
504 Ga0501076_0092593
505 Ga0501076_0151295
506 Ga0501077_0094739
507 Ga0501077_0188387
508 Ga0501079_0035293
509 Ga0501079_0058818
510 Ga0501079_0064408
511 Ga0501081_0132702
512 Ga0501081_0165243
513 Ga0501045_0026607
514 Ga0501045_0053424
515 nmdc:mga03n38_23825_c1
516 nmdc:mga00v17_137793_c1
517 nmdc:mga00v17_14633_c1
518 nmdc:mga00v17_23011_c1
519 nmdc:mga0yw44_3722_c1
520 nmdc:mga05p37_123337_c1
521 nmdc:mga05p37_234557_c1
522 nmdc:mga05p37_429340_c1
523 nmdc:mga05p37_93891_c1
524 nmdc:mga05p37_94154_c1
525 nmdc:mga0qj67_464609_c1
526 nmdc:mga06r32_128023_c1
527 nmdc:mga06r32_141226_c1
528 nmdc:mga06r32_19280_c1
529 nmdc:mga06r32_350063_c1
530 nmdc:mga08y16_113502_c1
531 nmdc:mga08y16_12935_c1
532 nmdc:mga08y16_138580_c1
533 nmdc:mga08y16_171817_c1
534 nmdc:mga08y16_45047_c1
535 nmdc:mga08y16_605540_c1
536 nmdc:mga08y16_726006_c1
537 nmdc:mga0n895_123921_c1
538 nmdc:mga0n895_42123_c1
539 nmdc:mga0rr50_36477_c1
540 nmdc:mga0rr50_387929_c1
541 nmdc:mga0a205_110375_c1
542 Ga0495655_0064506
543 Ga0495595_0027214
544 Ga0495619_0060523
545 Ga0495619_0274543
546 Ga0501084_0008466
547 Ga0501084_0125860
548 Ga0501084_0339907
549 Ga0501082_0022676
550 Ga0501082_0089810
551 Ga0501082_0439927
552 Ga0466962_0060717
553 Ga0530510_0003239
554 Ga0530510_0010378
555 Ga0530510_0024724
556 Ga0530510_0052652
557 Ga0530510_0105648
558 Ga0530510_0154698

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

15

124

0.94

PF18029

Glyoxalase_6

Glyoxalase-like domain

145

275

0.86

PF18029

Glyoxalase_6

Glyoxalase-like domain

14

125

0.83

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

141

273

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.9609 1 279
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.9272 1 279
2i7r-assembly1.cif.gz_B conserved domain protein 0.7357 224 279
3hdp-assembly1.cif.gz_A crystal structure of the ni(ii)-bound glyoxalase-i from clostridium acetobutylicum 0.7274 14 126
6xbs-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (e43q) in complex with 2-nitronate-propionyl-coa 0.7224 11 127
ID Description Score Start End Superfamily
3oxhA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9652 1 135 3.10.180.10
3oxhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9361 8 127 3.10.180.10
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9201 8 130 3.10.180.10
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9129 8 130 3.10.180.10
3oxhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9046 8 127 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7W1CKH5-F1-model_v4 VOC family protein 0.9889 1 285
AF-A0A7W1CKH5-F1-model_v4 VOC family protein 0.9786 1 285
AF-A0A3D3QBZ6-F1-model_v4 Glyoxalase 0.9708 9 169
AF-A0A7J9ZBF9-F1-model_v4 VOC family protein 0.9661 1 276
AF-A0A0H5RX42-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9591 2 280 GO:0051213

Map