F382947

General Info

Members Datasets Scaffolds Average Seq Length
279 197 558 234

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10013881|Ga0081455_1001388110
Length 251
Sequence VTAYAARSMAAALGWGTLAASSLVIGAVIAIRLDIGLRAIGIVMAFGSGVLISAIAFDLVGEALDKETAHWAVVTGIFAGCGVFFGGDWLIDRMGGADRKDAKGGQESGSPLAIVLGTVLDGIPESMVIGLTILEGGAVGAAYLTAVFVSNLPESISSTAGLASSGWKSARILWMWIGITLVSGLASLAGYALFQNASPDVVAFVLAFAAGAILTMLADTMMPEAFEHGGKLVGVVTTLGFVVAFAIHQLD

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
103 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
104 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
105 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
118 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
125 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
126 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
133 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
134 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
135 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
138 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
139 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 12.9
Rhizosphere 85.66
Stem 0
Stem Tuber 0
Unclassified 1.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10013881 3300005937 Bacteria 7920
2 JGI25405J52794_10009490 3300003911 Bacteria 1838
3 Ga0070666_10202150 3300005335 Bacteria 1398
4 Ga0070682_100228475 3300005337 Bacteria 1329
5 Ga0068868_100355105 3300005338 Bacteria 1256
6 Ga0070675_100045140 3300005354 Bacteria 3605
7 Ga0070675_100877285 3300005354 Bacteria 822
8 Ga0070674_100476828 3300005356 Bacteria 1035
9 Ga0070659_100158300 3300005366 Bacteria 1851
10 Ga0070667_100479322 3300005367 Bacteria 1139
11 Ga0070709_10012163 3300005434 Bacteria 4812
12 Ga0070714_100101323 3300005435 Bacteria 2537
13 Ga0070700_100015123 3300005441 Bacteria 4369
14 Ga0070663_100013436 3300005455 Bacteria 5222
15 Ga0070678_100002443 3300005456 Bacteria 10182
16 Ga0070678_100194093 3300005456 Bacteria 1671
17 Ga0070662_100350832 3300005457 Bacteria 1209
18 Ga0070681_10029006 3300005458 Bacteria 5557
19 Ga0070679_100009966 3300005530 Bacteria 8993
20 Ga0070684_100003833 3300005535 Bacteria 11371
21 Ga0070684_100145729 3300005535 Bacteria 2143
22 Ga0070672_100586767 3300005543 Bacteria 970
23 Ga0070686_100023564 3300005544 Bacteria 3680
24 Ga0070696_100270009 3300005546 Bacteria 1293
25 Ga0070693_100015163 3300005547 Bacteria 3964
26 Ga0070704_100055780 3300005549 Bacteria 2803
27 Ga0070704_100102592 3300005549 Bacteria 2159
28 Ga0068857_100002104 3300005577 Bacteria 16171
29 Ga0068856_100024154 3300005614 Bacteria 5914
30 Ga0070702_100047437 3300005615 Bacteria 2440
31 Ga0070702_100196764 3300005615 Bacteria 1331
32 Ga0068864_100342982 3300005618 Bacteria 1408
33 Ga0068864_100537857 3300005618 Bacteria 1128
34 Ga0081455_10002768 3300005937 Bacteria 20669
35 Ga0081455_10229102 3300005937 Bacteria 1372
36 Ga0081538_10009383 3300005981 Bacteria 8175
37 Ga0081538_10026521 3300005981 Bacteria 4049
38 Ga0081540_1002631 3300005983 Bacteria 14595
39 Ga0070715_10151670 3300006163 Bacteria 1136
40 Ga0070712_100047457 3300006175 Bacteria 2972
41 Ga0097621_100013489 3300006237 Bacteria 6091
42 Ga0068871_100097351 3300006358 Bacteria 2459
43 Ga0068871_100367668 3300006358 Bacteria 1275
44 Ga0075433_10277311 3300006852 Bacteria 1485
45 Ga0075435_100025228 3300007076 Bacteria 4626
46 Ga0111539_10007516 3300009094 Bacteria 13940
47 Ga0111539_10120537 3300009094 Bacteria 3073
48 Ga0105245_10127855 3300009098 Bacteria 2380
49 Ga0105245_10285779 3300009098 Bacteria 1614
50 Ga0105245_10849063 3300009098 Bacteria 953
51 Ga0105247_10030637 3300009101 Bacteria 3261
52 Ga0114129_10989466 3300009147 Bacteria 1060
53 Ga0105243_10059341 3300009148 Bacteria 3053
54 Ga0105243_10060165 3300009148 Bacteria 3034
55 Ga0105243_10137272 3300009148 Bacteria 2082
56 Ga0105241_10132907 3300009174 Bacteria 2017
57 Ga0105241_10324713 3300009174 Bacteria 1328
58 Ga0105242_10001187 3300009176 Bacteria 20541
59 Ga0105242_10032431 3300009176 Bacteria 4177
60 Ga0105248_10053213 3300009177 Bacteria 4543
61 Ga0105239_10634151 3300010375 Bacteria 1220
62 Ga0105246_10365290 3300011119 Bacteria 1187
63 Ga0105246_10376013 3300011119 Bacteria 1172
64 Ga0157374_10337302 3300013296 Bacteria 1496
65 Ga0157378_10217247 3300013297 Bacteria 1816
66 Ga0157372_10744206 3300013307 Bacteria 1140
67 Ga0157375_10086593 3300013308 Bacteria 3184
68 Ga0157375_10180336 3300013308 Bacteria 2263
69 Ga0157375_10397580 3300013308 Bacteria 1545
70 Ga0157375_10431562 3300013308 Unclassified 1483
71 Ga0163163_10789882 3300014325 Bacteria 1013
72 Ga0157380_10076842 3300014326 Bacteria 2719
73 Ga0157380_10148953 3300014326 Bacteria 2020
74 Ga0157379_10139166 3300014968 Bacteria 2188
75 Ga0157376_10133261 3300014969 Bacteria 2220
76 Ga0207642_10021193 3300025899 Bacteria 2555
77 Ga0207710_10016539 3300025900 Bacteria 3122
78 Ga0207688_10070324 3300025901 Bacteria 1984
79 Ga0207680_10162609 3300025903 Bacteria 1498
80 Ga0207685_10014849 3300025905 Bacteria 2449
81 Ga0207685_10147980 3300025905 Bacteria 1060
82 Ga0207654_10268882 3300025911 Bacteria 1149
83 Ga0207654_10446541 3300025911 Unclassified 906
84 Ga0207707_10020686 3300025912 Bacteria 5747
85 Ga0207693_10031721 3300025915 Bacteria 4176
86 Ga0207652_10004786 3300025921 Bacteria 10966
87 Ga0207659_10247030 3300025926 Bacteria 1446
88 Ga0207687_10001604 3300025927 Bacteria 15572
89 Ga0207687_10522629 3300025927 Bacteria 993
90 Ga0207700_10046705 3300025928 Bacteria 3204
91 Ga0207664_10069625 3300025929 Bacteria 2829
92 Ga0207644_10448274 3300025931 Bacteria 1060
93 Ga0207690_10117146 3300025932 Bacteria 1928
94 Ga0207706_10070894 3300025933 Bacteria 3065
95 Ga0207686_10064261 3300025934 Bacteria 2336
96 Ga0207669_10015201 3300025937 Bacteria 3877
97 Ga0207669_10223661 3300025937 Bacteria 1383
98 Ga0207665_10534025 3300025939 Bacteria 910
99 Ga0207711_10715908 3300025941 Bacteria 933
100 Ga0207661_10001095 3300025944 Bacteria 17995
101 Ga0207661_10047726 3300025944 Bacteria 3401
102 Ga0207677_10443529 3300026023 Bacteria 1111
103 Ga0207708_10019502 3300026075 Bacteria 5113
104 Ga0207708_10061082 3300026075 Bacteria 2877
105 Ga0207702_10006015 3300026078 Bacteria 10528
106 Ga0207702_10540964 3300026078 Bacteria 1138
107 Ga0207683_10000271 3300026121 Bacteria 46316
108 Ga0207683_10004733 3300026121 Bacteria 11726
109 Ga0207683_10354475 3300026121 Unclassified 1347
110 Ga0268264_10036529 3300028381 Bacteria 4048
111 Ga0307509_10217451 3300031507 Bacteria 1728
112 Ga0307408_100008424 3300031548 Bacteria 6805
113 Ga0307516_10023597 3300031730 Bacteria 6300
114 Ga0307405_10064126 3300031731 Bacteria 2333
115 Ga0307413_10381470 3300031824 Bacteria 1098
116 Ga0307410_10102974 3300031852 Bacteria 2049
117 Ga0307406_10010746 3300031901 Bacteria 5173
118 Ga0307407_10006856 3300031903 Bacteria 5109
119 Ga0307412_10027026 3300031911 Bacteria 3573
120 Ga0307409_100004768 3300031995 Bacteria 7685
121 Ga0307409_100655223 3300031995 Bacteria 1044
122 Ga0307416_100070312 3300032002 Bacteria 2901
123 Ga0307414_10066041 3300032004 Bacteria 2584
124 Ga0307411_10477437 3300032005 Bacteria 1049
125 Ga0307415_100103776 3300032126 Bacteria 2092
126 Ga0373933_0086777 3300035724 Bacteria 1926
127 Ga0373947_0042646 3300035725 Bacteria 2708
128 Ga0373937_0000936 3300036401 Bacteria 24766
129 Ga0395899_0141319 3300037312 Bacteria 1712
130 Ga0395900_0090675 3300037418 Bacteria 3142
131 Ga0395900_0105423 3300037418 Bacteria 2896
132 Ga0395898_0622062 3300037466 Bacteria 1022
133 Ga0395905_0116936 3300037471 Bacteria 2506
134 Ga0395905_0311111 3300037471 Bacteria 1464
135 Ga0395901_0050615 3300038443 Bacteria 4315
136 Ga0395901_0100304 3300038443 Bacteria 3037
137 Ga0395901_0310310 3300038443 Bacteria 1634
138 Ga0395901_0444491 3300038443 Bacteria 1327
139 Ga0439453_0004573 3300041408 Bacteria 2062
140 Ga0451853_3417065 3300041512 Bacteria 2378
141 Ga0439448_0079881 3300042005 Bacteria 1097
142 Ga0439448_0102705 3300042005 Bacteria 973
143 Ga0439454_014456 3300042011 Bacteria 1095
144 Ga0451576_0147363 3300045051 Bacteria 2454
145 Ga0451576_1179322 3300045051 Bacteria 800
146 Ga0495592_0000362 3300046454 Bacteria 36022
147 Ga0495592_0138467 3300046454 Bacteria 1695
148 Ga0495603_0235031 3300046455 Bacteria 1056
149 Ga0495641_0064659 3300046461 Bacteria 1647
150 Ga0495641_0245145 3300046461 Bacteria 805
151 Ga0495651_0000037 3300046462 Bacteria 97257
152 Ga0495653_0005841 3300046463 Bacteria 10069
153 Ga0495580_0161286 3300046472 Bacteria 1552
154 Ga0495639_0366216 3300046475 Bacteria 725
155 Ga0495664_0234527 3300046477 Bacteria 1110
156 Ga0495584_0151380 3300046491 Bacteria 1178
157 Ga0495585_0270292 3300046492 Bacteria 843
158 Ga0495596_0033501 3300046500 Bacteria 2044
159 Ga0495596_0099835 3300046500 Bacteria 1127
160 Ga0495607_0302845 3300046501 Bacteria 752
161 Ga0495583_0054606 3300046506 Bacteria 1808
162 Ga0495608_0000561 3300046511 Bacteria 25603
163 Ga0495618_0001126 3300046514 Bacteria 18066
164 Ga0495618_0252102 3300046514 Bacteria 1107
165 Ga0495628_0000295 3300046516 Bacteria 44980
166 Ga0495630_0014263 3300046517 Bacteria 5786
167 Ga0495644_0173852 3300046523 Bacteria 827
168 Ga0495663_0073065 3300046525 Bacteria 1095
169 Ga0495642_0187143 3300046528 Bacteria 902
170 Ga0495652_0000015 3300046529 Bacteria 222624
171 Ga0495652_0073745 3300046529 Bacteria 2841
172 Ga0495587_0000288 3300046536 Bacteria 35655
173 Ga0495587_0059011 3300046536 Bacteria 2253
174 Ga0495645_0081293 3300046543 Bacteria 2325
175 Ga0495645_0247146 3300046543 Bacteria 1187
176 Ga0495667_0186858 3300046559 Bacteria 1329
177 Ga0495656_0210462 3300046615 Bacteria 968
178 Ga0495611_0106718 3300046648 Bacteria 1303
179 Ga0495659_0038404 3300046664 Bacteria 1700
180 Ga0495588_0330067 3300046674 Bacteria 802
181 Ga0495657_0010648 3300046675 Bacteria 6915
182 Ga0495599_0000132 3300046678 Bacteria 48518
183 Ga0495599_0029595 3300046678 Bacteria 3433
184 Ga0495623_0000392 3300046679 Bacteria 28835
185 Ga0495646_0000745 3300046680 Bacteria 18128
186 Ga0495647_0010143 3300046681 Bacteria 3204
187 Ga0495670_0075241 3300046691 Bacteria 1714
188 Ga0495671_0274247 3300046692 Bacteria 813
189 Ga0495600_0081764 3300046809 Unclassified 2108
190 Ga0495604_0000077 3300047317 Bacteria 84167
191 Ga0495604_0069870 3300047317 Bacteria 2661
192 Ga0495636_0064722 3300047318 Bacteria 1552
193 Ga0495674_0191038 3300047319 Bacteria 1702
194 Ga0495676_0126024 3300047321 Bacteria 1856
195 Ga0495680_0005458 3300047322 Bacteria 11966
196 Ga0495683_0185848 3300047323 Bacteria 946
197 Ga0495675_0000156 3300047444 Bacteria 48295
198 Ga0495685_071945 3300047447 Bacteria 1157
199 Ga0495602_0000604 3300048088 Bacteria 33752
200 Ga0496100_0030660 3300048903 Bacteria 3337
201 Ga0496100_0299404 3300048903 Bacteria 1203
202 Ga0496100_0318608 3300048903 Bacteria 1167
203 Ga0496101_0001547 3300048904 Bacteria 13788
204 Ga0496101_0013465 3300048904 Bacteria 5481
205 Ga0496101_0039251 3300048904 Bacteria 3366
206 Ga0496102_0001980 3300048905 Bacteria 17696
207 Ga0496102_0026830 3300048905 Bacteria 5141
208 Ga0496103_0011764 3300048906 Bacteria 5192
209 Ga0496103_0047751 3300048906 Bacteria 2646
210 Ga0496103_0088852 3300048906 Bacteria 1949
211 Ga0496104_0001009 3300048907 Bacteria 24141
212 Ga0496104_0001813 3300048907 Bacteria 18528
213 Ga0496104_0019384 3300048907 Bacteria 6222
214 Ga0496105_0000621 3300048908 Bacteria 23731
215 Ga0496106_0016357 3300048909 Bacteria 5488
216 Ga0496106_0090573 3300048909 Bacteria 2360
217 Ga0496107_0035565 3300048910 Bacteria 3570
218 Ga0496107_0052375 3300048910 Bacteria 2944
219 Ga0496108_0003945 3300048911 Bacteria 11912
220 Ga0496108_0004554 3300048911 Bacteria 11169
221 Ga0496109_0002568 3300048912 Bacteria 15206
222 Ga0496109_0016283 3300048912 Bacteria 6499
223 Ga0496109_0095317 3300048912 Bacteria 2755
224 Ga0496110_0000075 3300048913 Bacteria 51198
225 Ga0496110_0114069 3300048913 Bacteria 2431
226 Ga0496110_0285252 3300048913 Bacteria 1504
227 Ga0496110_0403403 3300048913 Bacteria 1246
228 Ga0496111_0001251 3300048914 Bacteria 14216
229 Ga0496111_0010122 3300048914 Bacteria 6313
230 Ga0496113_0121447 3300048916 Bacteria 2043
231 Ga0496113_0371331 3300048916 Bacteria 1148
232 Ga0496114_0000435 3300048917 Bacteria 30892
233 Ga0496114_0005850 3300048917 Bacteria 9659
234 Ga0496114_0017737 3300048917 Bacteria 5752
235 Ga0496115_0029252 3300048918 Bacteria 4326
236 Ga0501032_0303937 3300049569 Bacteria 1031
237 Ga0501034_0330736 3300049571 Bacteria 1455
238 Ga0501036_0010806 3300049572 Bacteria 7544
239 Ga0501039_0180300 3300049575 Bacteria 1661
240 Ga0501040_0055266 3300049576 Bacteria 2722
241 Ga0501041_0113279 3300049577 Bacteria 1683
242 Ga0501042_0247453 3300049578 Bacteria 1286
243 Ga0501046_0208388 3300049580 Bacteria 1452
244 Ga0501048_0032100 3300049582 Bacteria 3797
245 Ga0501067_0005654 3300049583 Bacteria 6941
246 Ga0501068_0013346 3300049584 Bacteria 4672
247 Ga0501068_0207393 3300049584 Bacteria 1244
248 Ga0501070_0120751 3300049586 Bacteria 2166
249 Ga0501070_0147738 3300049586 Bacteria 1940
250 Ga0501071_0427526 3300049587 Bacteria 1012
251 Ga0501072_0164335 3300049588 Bacteria 1771
252 Ga0501072_0537225 3300049588 Bacteria 924
253 Ga0501073_0250184 3300049589 Bacteria 1223
254 Ga0501074_0044004 3300049590 Bacteria 3232
255 Ga0501074_0428244 3300049590 Bacteria 938
256 Ga0501075_0149138 3300049591 Bacteria 1782
257 Ga0501075_0639553 3300049591 Bacteria 811
258 Ga0501076_0009273 3300049592 Bacteria 7260
259 Ga0501076_0221297 3300049592 Bacteria 1547
260 Ga0501077_0155518 3300049593 Bacteria 1451
261 Ga0501077_0375571 3300049593 Bacteria 908
262 Ga0501081_0181956 3300049743 Bacteria 1520
263 Ga0501081_0338307 3300049743 Bacteria 1108
264 Ga0501035_0104968 3300049822 Bacteria 2478
265 Ga0501045_0197695 3300049824 Bacteria 1498
266 nmdc:mga0yw44_13405_c1 3300050492 Bacteria 4316
267 nmdc:mga05p37_1004875_c1 3300050507 Bacteria 885
268 nmdc:mga0n895_100608_c1 3300050512 Bacteria 2900
269 nmdc:mga0rr50_57700_c1 3300050513 Bacteria 2905
270 Ga0495601_0000133 3300053077 Bacteria 42065
271 Ga0495601_0017928 3300053077 Bacteria 4303
272 Ga0495595_0076347 3300053084 Unclassified 1590
273 Ga0495619_0000400 3300053085 Bacteria 29573
274 Ga0501082_0091870 3300060353 Bacteria 2621
275 Ga0501082_0355185 3300060353 Bacteria 1278
276 Ga0530510_0108386 3300061734 Bacteria 2033
277 Ga0530510_0108902 3300061734 Bacteria 2028
278 Ga0530510_0176906 3300061734 Bacteria 1582
279 Ga0530510_0613136 3300061734 Bacteria 828
280 Ga0081455_10013881
281 JGI25405J52794_10009490
282 Ga0070666_10202150
283 Ga0070682_100228475
284 Ga0068868_100355105
285 Ga0070675_100045140
286 Ga0070675_100877285
287 Ga0070674_100476828
288 Ga0070659_100158300
289 Ga0070667_100479322
290 Ga0070709_10012163
291 Ga0070714_100101323
292 Ga0070700_100015123
293 Ga0070663_100013436
294 Ga0070678_100002443
295 Ga0070678_100194093
296 Ga0070662_100350832
297 Ga0070681_10029006
298 Ga0070679_100009966
299 Ga0070684_100003833
300 Ga0070684_100145729
301 Ga0070672_100586767
302 Ga0070686_100023564
303 Ga0070696_100270009
304 Ga0070693_100015163
305 Ga0070704_100055780
306 Ga0070704_100102592
307 Ga0068857_100002104
308 Ga0068856_100024154
309 Ga0070702_100047437
310 Ga0070702_100196764
311 Ga0068864_100342982
312 Ga0068864_100537857
313 Ga0081455_10002768
314 Ga0081455_10229102
315 Ga0081538_10009383
316 Ga0081538_10026521
317 Ga0081540_1002631
318 Ga0070715_10151670
319 Ga0070712_100047457
320 Ga0097621_100013489
321 Ga0068871_100097351
322 Ga0068871_100367668
323 Ga0075433_10277311
324 Ga0075435_100025228
325 Ga0111539_10007516
326 Ga0111539_10120537
327 Ga0105245_10127855
328 Ga0105245_10285779
329 Ga0105245_10849063
330 Ga0105247_10030637
331 Ga0114129_10989466
332 Ga0105243_10059341
333 Ga0105243_10060165
334 Ga0105243_10137272
335 Ga0105241_10132907
336 Ga0105241_10324713
337 Ga0105242_10001187
338 Ga0105242_10032431
339 Ga0105248_10053213
340 Ga0105239_10634151
341 Ga0105246_10365290
342 Ga0105246_10376013
343 Ga0157374_10337302
344 Ga0157378_10217247
345 Ga0157372_10744206
346 Ga0157375_10086593
347 Ga0157375_10180336
348 Ga0157375_10397580
349 Ga0157375_10431562
350 Ga0163163_10789882
351 Ga0157380_10076842
352 Ga0157380_10148953
353 Ga0157379_10139166
354 Ga0157376_10133261
355 Ga0207642_10021193
356 Ga0207710_10016539
357 Ga0207688_10070324
358 Ga0207680_10162609
359 Ga0207685_10014849
360 Ga0207685_10147980
361 Ga0207654_10268882
362 Ga0207654_10446541
363 Ga0207707_10020686
364 Ga0207693_10031721
365 Ga0207652_10004786
366 Ga0207659_10247030
367 Ga0207687_10001604
368 Ga0207687_10522629
369 Ga0207700_10046705
370 Ga0207664_10069625
371 Ga0207644_10448274
372 Ga0207690_10117146
373 Ga0207706_10070894
374 Ga0207686_10064261
375 Ga0207669_10015201
376 Ga0207669_10223661
377 Ga0207665_10534025
378 Ga0207711_10715908
379 Ga0207661_10001095
380 Ga0207661_10047726
381 Ga0207677_10443529
382 Ga0207708_10019502
383 Ga0207708_10061082
384 Ga0207702_10006015
385 Ga0207702_10540964
386 Ga0207683_10000271
387 Ga0207683_10004733
388 Ga0207683_10354475
389 Ga0268264_10036529
390 Ga0307509_10217451
391 Ga0307408_100008424
392 Ga0307516_10023597
393 Ga0307405_10064126
394 Ga0307413_10381470
395 Ga0307410_10102974
396 Ga0307406_10010746
397 Ga0307407_10006856
398 Ga0307412_10027026
399 Ga0307409_100004768
400 Ga0307409_100655223
401 Ga0307416_100070312
402 Ga0307414_10066041
403 Ga0307411_10477437
404 Ga0307415_100103776
405 Ga0373933_0086777
406 Ga0373947_0042646
407 Ga0373937_0000936
408 Ga0395899_0141319
409 Ga0395900_0090675
410 Ga0395900_0105423
411 Ga0395898_0622062
412 Ga0395905_0116936
413 Ga0395905_0311111
414 Ga0395901_0050615
415 Ga0395901_0100304
416 Ga0395901_0310310
417 Ga0395901_0444491
418 Ga0439453_0004573
419 Ga0451853_3417065
420 Ga0439448_0079881
421 Ga0439448_0102705
422 Ga0439454_014456
423 Ga0451576_0147363
424 Ga0451576_1179322
425 Ga0495592_0000362
426 Ga0495592_0138467
427 Ga0495603_0235031
428 Ga0495641_0064659
429 Ga0495641_0245145
430 Ga0495651_0000037
431 Ga0495653_0005841
432 Ga0495580_0161286
433 Ga0495639_0366216
434 Ga0495664_0234527
435 Ga0495584_0151380
436 Ga0495585_0270292
437 Ga0495596_0033501
438 Ga0495596_0099835
439 Ga0495607_0302845
440 Ga0495583_0054606
441 Ga0495608_0000561
442 Ga0495618_0001126
443 Ga0495618_0252102
444 Ga0495628_0000295
445 Ga0495630_0014263
446 Ga0495644_0173852
447 Ga0495663_0073065
448 Ga0495642_0187143
449 Ga0495652_0000015
450 Ga0495652_0073745
451 Ga0495587_0000288
452 Ga0495587_0059011
453 Ga0495645_0081293
454 Ga0495645_0247146
455 Ga0495667_0186858
456 Ga0495656_0210462
457 Ga0495611_0106718
458 Ga0495659_0038404
459 Ga0495588_0330067
460 Ga0495657_0010648
461 Ga0495599_0000132
462 Ga0495599_0029595
463 Ga0495623_0000392
464 Ga0495646_0000745
465 Ga0495647_0010143
466 Ga0495670_0075241
467 Ga0495671_0274247
468 Ga0495600_0081764
469 Ga0495604_0000077
470 Ga0495604_0069870
471 Ga0495636_0064722
472 Ga0495674_0191038
473 Ga0495676_0126024
474 Ga0495680_0005458
475 Ga0495683_0185848
476 Ga0495675_0000156
477 Ga0495685_071945
478 Ga0495602_0000604
479 Ga0496100_0030660
480 Ga0496100_0299404
481 Ga0496100_0318608
482 Ga0496101_0001547
483 Ga0496101_0013465
484 Ga0496101_0039251
485 Ga0496102_0001980
486 Ga0496102_0026830
487 Ga0496103_0011764
488 Ga0496103_0047751
489 Ga0496103_0088852
490 Ga0496104_0001009
491 Ga0496104_0001813
492 Ga0496104_0019384
493 Ga0496105_0000621
494 Ga0496106_0016357
495 Ga0496106_0090573
496 Ga0496107_0035565
497 Ga0496107_0052375
498 Ga0496108_0003945
499 Ga0496108_0004554
500 Ga0496109_0002568
501 Ga0496109_0016283
502 Ga0496109_0095317
503 Ga0496110_0000075
504 Ga0496110_0114069
505 Ga0496110_0285252
506 Ga0496110_0403403
507 Ga0496111_0001251
508 Ga0496111_0010122
509 Ga0496113_0121447
510 Ga0496113_0371331
511 Ga0496114_0000435
512 Ga0496114_0005850
513 Ga0496114_0017737
514 Ga0496115_0029252
515 Ga0501032_0303937
516 Ga0501034_0330736
517 Ga0501036_0010806
518 Ga0501039_0180300
519 Ga0501040_0055266
520 Ga0501041_0113279
521 Ga0501042_0247453
522 Ga0501046_0208388
523 Ga0501048_0032100
524 Ga0501067_0005654
525 Ga0501068_0013346
526 Ga0501068_0207393
527 Ga0501070_0120751
528 Ga0501070_0147738
529 Ga0501071_0427526
530 Ga0501072_0164335
531 Ga0501072_0537225
532 Ga0501073_0250184
533 Ga0501074_0044004
534 Ga0501074_0428244
535 Ga0501075_0149138
536 Ga0501075_0639553
537 Ga0501076_0009273
538 Ga0501076_0221297
539 Ga0501077_0155518
540 Ga0501077_0375571
541 Ga0501081_0181956
542 Ga0501081_0338307
543 Ga0501035_0104968
544 Ga0501045_0197695
545 nmdc:mga0yw44_13405_c1
546 nmdc:mga05p37_1004875_c1
547 nmdc:mga0n895_100608_c1
548 nmdc:mga0rr50_57700_c1
549 Ga0495601_0000133
550 Ga0495601_0017928
551 Ga0495595_0076347
552 Ga0495619_0000400
553 Ga0501082_0091870
554 Ga0501082_0355185
555 Ga0530510_0108386
556 Ga0530510_0108902
557 Ga0530510_0176906
558 Ga0530510_0613136

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tsb-assembly1.cif.gz_A crystal structure of the zrt-/irt-like protein from bordetella bronchiseptica with bound cd2+ 0.8381 1 243
5tsb-assembly1.cif.gz_A crystal structure of the zrt-/irt-like protein from bordetella bronchiseptica with bound cd2+ 0.8347 1 243
8czj-assembly1.cif.gz_B a bacteria zrt/irt-like protein in the apo state 0.8263 4 242
7z6n-assembly1.cif.gz_B crystal structure of zn2+-transporter bbzip in a metal-stripped state 0.815 4 241
8czj-assembly1.cif.gz_A a bacteria zrt/irt-like protein in the apo state 0.8123 4 242
ID Description Score Start End Superfamily
af_Q9VJ63_40_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.402 28 210 1.20.1250.20
af_P9WJW9_258_425_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3844 25 185 1.20.1250.20
af_A0A2R8PVN8_33_457_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3719 31 238 1.20.1250.20
af_K7LCK9_143_607_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.3695 3 242 1.20.1740.10
af_B7YZU1_345_528_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3676 29 205 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3N5W5H6-F1-model_v4 ZIP family zinc transporter 0.9784 1 243 GO:0016020
AF-A0A3N5W5H6-F1-model_v4 ZIP family zinc transporter 0.9745 1 243 GO:0016020
AF-A0A2U0AEX8-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9736 103 242 GO:0003700
GO:0005829
GO:0016020
AF-V5RXP6-F1-model_v4 ZIP family zinc transporter 0.9702 1 243 GO:0016020
AF-A0A542IV20-F1-model_v4 ZIP family zinc transporter 0.9701 2 242 GO:0016020

Map