F382943

General Info

Members Datasets Scaffolds Average Seq Length
279 161 552 153

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100854419|Ga0068862_1008544192
Length 171
Sequence VVSGEWLPLTGQTLILLDMLNLRVYGILIGENKQVLVSDEYIRGGLYTKFPGGGLEFGEGTRDCLKREFKEEMDLDIQVGDHIYTTDYFQISAFNPGHQIISIYYFAHPLEPIKVPLRNKPFDFDEQQMTVYKETGTTETFRFIEWNDFSEASVTLPIDKIVAKMLKDRES

Samples

Sample ID Description Type Environment
1 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
117 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
118 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
119 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
120 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
123 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
124 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
125 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
126 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
139 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
144 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
147 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
153 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
154 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
155 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
156 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
157 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
158 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
159 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
160 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
161 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.53
Nodule 0
Rhizoplane 0.72
Rhizosphere 87.1
Stem 0
Stem Tuber 0
Unclassified 23.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068862_100854419 3300005844 Unclassified 892
2 JGI25154J39366_1017854 3300002738 Bacteria 702
3 rootL2_10102082 3300003322 Bacteria 1457
4 rootL2_10356673 3300003322 Bacteria 1181
5 rootL2_10357336 3300003322 Bacteria 1455
6 rootH1_10186669 3300003323 Bacteria 1545
7 Ga0065714_10359262 3300005288 Unclassified 627
8 Ga0065712_10015242 3300005290 Unclassified 1512
9 Ga0065712_10313177 3300005290 Bacteria 840
10 Ga0065715_10035857 3300005293 Bacteria 1597
11 Ga0065715_10450530 3300005293 Unclassified 796
12 Ga0070690_100180246 3300005330 Unclassified 1459
13 Ga0070670_100162469 3300005331 Bacteria 1936
14 Ga0070670_100213202 3300005331 Bacteria 1679
15 Ga0070670_100224212 3300005331 Bacteria 1636
16 Ga0070670_100653653 3300005331 Bacteria 943
17 Ga0070670_100816196 3300005331 Unclassified 843
18 Ga0068869_100285816 3300005334 Bacteria 1327
19 Ga0068869_100343728 3300005334 Bacteria 1215
20 Ga0068869_100751980 3300005334 Bacteria 835
21 Ga0070666_10928696 3300005335 Bacteria 644
22 Ga0070682_100714111 3300005337 Bacteria 805
23 Ga0068868_100542698 3300005338 Bacteria 1024
24 Ga0070689_100441701 3300005340 Unclassified 1106
25 Ga0070689_100725203 3300005340 Bacteria 870
26 Ga0070691_10012741 3300005341 Bacteria 3853
27 Ga0070691_10019692 3300005341 Bacteria 3115
28 Ga0070669_100081846 3300005353 Unclassified 2406
29 Ga0070669_100177351 3300005353 Unclassified 1665
30 Ga0070669_100257770 3300005353 Bacteria 1391
31 Ga0070669_100283651 3300005353 Unclassified 1328
32 Ga0070675_100481755 3300005354 Bacteria 1116
33 Ga0070675_100675801 3300005354 Bacteria 939
34 Ga0070671_101251104 3300005355 Unclassified 654
35 Ga0070673_100046479 3300005364 Unclassified 3372
36 Ga0070667_100478629 3300005367 Unclassified 1140
37 Ga0070678_100334077 3300005456 Bacteria 1298
38 Ga0070662_101205346 3300005457 Unclassified 651
39 Ga0070681_10035533 3300005458 Bacteria 5007
40 Ga0070685_10027443 3300005466 Unclassified 3146
41 Ga0070685_10296634 3300005466 Bacteria 1088
42 Ga0070698_100006768 3300005471 Bacteria 12425
43 Ga0070698_100043563 3300005471 Bacteria 4601
44 Ga0070698_100081889 3300005471 Bacteria 3221
45 Ga0070698_100942144 3300005471 Bacteria 810
46 Ga0070698_101243449 3300005471 Bacteria 694
47 Ga0070699_100871864 3300005518 Unclassified 824
48 Ga0070684_100669999 3300005535 Bacteria 966
49 Ga0070684_100762926 3300005535 Bacteria 903
50 Ga0070672_100060806 3300005543 Bacteria 2975
51 Ga0070672_100411239 3300005543 Unclassified 1161
52 Ga0070672_100780565 3300005543 Unclassified 840
53 Ga0070672_100970067 3300005543 Bacteria 752
54 Ga0068855_100082680 3300005563 Bacteria 3721
55 Ga0068857_100217199 3300005577 Unclassified 1746
56 Ga0068854_100162638 3300005578 Unclassified 1730
57 Ga0068856_100021876 3300005614 Bacteria 6215
58 Ga0068856_100105967 3300005614 Bacteria 2805
59 Ga0068852_100014576 3300005616 Bacteria 6058
60 Ga0068852_100679232 3300005616 Bacteria 1039
61 Ga0068859_100000534 3300005617 Bacteria 37702
62 Ga0068859_100296845 3300005617 Unclassified 1709
63 Ga0068859_100373549 3300005617 Bacteria 1521
64 Ga0068859_101228407 3300005617 Bacteria 825
65 Ga0068859_101511048 3300005617 Unclassified 741
66 Ga0068864_100086250 3300005618 Bacteria 2762
67 Ga0068864_100172548 3300005618 Bacteria 1973
68 Ga0068864_100173025 3300005618 Unclassified 1970
69 Ga0068861_100056812 3300005719 Bacteria 2988
70 Ga0068861_100131443 3300005719 Bacteria 2032
71 Ga0068851_10088311 3300005834 Bacteria 1629
72 Ga0068870_10264026 3300005840 Bacteria 1073
73 Ga0068863_100033540 3300005841 Bacteria 4891
74 Ga0068858_100124958 3300005842 Unclassified 2408
75 Ga0068860_100055781 3300005843 Bacteria 3757
76 Ga0068860_100294809 3300005843 Unclassified 1588
77 Ga0068862_100222457 3300005844 Bacteria 1709
78 Ga0068862_101137873 3300005844 Unclassified 777
79 Ga0075366_10023659 3300006195 Bacteria 3580
80 Ga0075366_10188069 3300006195 Bacteria 1255
81 Ga0075366_10828384 3300006195 Bacteria 576
82 Ga0097621_100061132 3300006237 Bacteria 3089
83 Ga0097621_100383028 3300006237 Unclassified 1256
84 Ga0097621_100493407 3300006237 Bacteria 1108
85 Ga0068871_102338262 3300006358 Bacteria 510
86 Ga0075428_100023774 3300006844 Bacteria 6781
87 Ga0075428_100080948 3300006844 Bacteria 3545
88 Ga0075430_100003342 3300006846 Bacteria 13436
89 Ga0075431_100013434 3300006847 Bacteria 8272
90 Ga0075429_100236956 3300006880 Bacteria 1598
91 Ga0068865_100465690 3300006881 Bacteria 1048
92 Ga0097620_100000534 3300006931 Bacteria 37702
93 Ga0097620_100296817 3300006931 Unclassified 1709
94 Ga0097620_100373576 3300006931 Bacteria 1521
95 Ga0097620_101228398 3300006931 Bacteria 825
96 Ga0097620_101510715 3300006931 Unclassified 741
97 Ga0105240_10010489 3300009093 Bacteria 13024
98 Ga0105240_10244431 3300009093 Bacteria 2079
99 Ga0111539_10914763 3300009094 Bacteria 1020
100 Ga0105247_10001821 3300009101 Bacteria 14947
101 Ga0114129_10030503 3300009147 Bacteria 7629
102 Ga0114129_10356753 3300009147 Bacteria 1935
103 Ga0105241_10015646 3300009174 Bacteria 5559
104 Ga0105241_12024611 3300009174 Bacteria 567
105 Ga0105242_10060996 3300009176 Bacteria 3101
106 Ga0105242_10160988 3300009176 Bacteria 1965
107 Ga0105242_10870914 3300009176 Bacteria 898
108 Ga0105248_10346705 3300009177 Bacteria 1672
109 Ga0105237_10074135 3300009545 Bacteria 3395
110 Ga0105249_10003692 3300009553 Bacteria 13197
111 Ga0105249_10087561 3300009553 Bacteria 2906
112 Ga0105249_10465548 3300009553 Unclassified 1305
113 Ga0105239_10076642 3300010375 Bacteria 3678
114 Ga0105239_10079873 3300010375 Bacteria 3599
115 Ga0105239_10158676 3300010375 Bacteria 2527
116 Ga0105246_10845899 3300011119 Unclassified 816
117 Ga0105246_11600735 3300011119 Bacteria 615
118 Ga0157374_10013261 3300013296 Bacteria 7191
119 Ga0157378_10899933 3300013297 Unclassified 916
120 Ga0157372_10097545 3300013307 Bacteria 3352
121 Ga0157372_10159455 3300013307 Bacteria 2606
122 Ga0157372_10210878 3300013307 Unclassified 2251
123 Ga0157372_10373913 3300013307 Unclassified 1661
124 Ga0157372_11056731 3300013307 Bacteria 940
125 Ga0157372_12479053 3300013307 Bacteria 595
126 Ga0157372_12501866 3300013307 Bacteria 593
127 Ga0157375_10164836 3300013308 Unclassified 2360
128 Ga0163163_10342922 3300014325 Bacteria 1549
129 Ga0163163_10463769 3300014325 Unclassified 1327
130 Ga0163163_11069574 3300014325 Bacteria 870
131 Ga0163163_11283001 3300014325 Unclassified 795
132 Ga0157380_10312879 3300014326 Unclassified 1452
133 Ga0157380_10405301 3300014326 Bacteria 1295
134 Ga0157380_10507175 3300014326 Bacteria 1173
135 Ga0157380_10671392 3300014326 Bacteria 1037
136 Ga0157380_10994423 3300014326 Bacteria 872
137 Ga0157380_11031783 3300014326 Bacteria 858
138 Ga0157377_10004290 3300014745 Bacteria 6539
139 Ga0157377_10022699 3300014745 Bacteria 3318
140 Ga0157379_11266565 3300014968 Unclassified 711
141 Ga0157376_10356105 3300014969 Bacteria 1402
142 Ga0157376_10832418 3300014969 Bacteria 937
143 Ga0157376_11455554 3300014969 Bacteria 717
144 Ga0209646_1002139 3300025246 Bacteria 4588
145 Ga0207656_10169245 3300025321 Bacteria 1044
146 Ga0207682_10242019 3300025893 Unclassified 839
147 Ga0207710_10001437 3300025900 Bacteria 11892
148 Ga0207688_10127601 3300025901 Bacteria 1489
149 Ga0207688_10323700 3300025901 Bacteria 946
150 Ga0207680_10506817 3300025903 Unclassified 860
151 Ga0207643_10208113 3300025908 Bacteria 1193
152 Ga0207643_10770720 3300025908 Bacteria 623
153 Ga0207654_10119074 3300025911 Bacteria 1655
154 Ga0207707_10034960 3300025912 Bacteria 4395
155 Ga0207695_10002676 3300025913 Bacteria 26013
156 Ga0207662_10173041 3300025918 Unclassified 1385
157 Ga0207681_10020086 3300025923 Bacteria 4230
158 Ga0207681_10290775 3300025923 Unclassified 1290
159 Ga0207681_10315702 3300025923 Bacteria 1241
160 Ga0207650_10009161 3300025925 Bacteria 6765
161 Ga0207650_10154335 3300025925 Bacteria 1814
162 Ga0207650_10575129 3300025925 Bacteria 946
163 Ga0207659_10102837 3300025926 Bacteria 2157
164 Ga0207659_10185962 3300025926 Unclassified 1650
165 Ga0207644_11056217 3300025931 Unclassified 682
166 Ga0207706_10697751 3300025933 Bacteria 867
167 Ga0207686_10000403 3300025934 Bacteria 30043
168 Ga0207686_10869364 3300025934 Bacteria 726
169 Ga0207670_10063612 3300025936 Bacteria 2525
170 Ga0207670_10093301 3300025936 Unclassified 2133
171 Ga0207670_11110287 3300025936 Bacteria 668
172 Ga0207704_10057439 3300025938 Bacteria 2390
173 Ga0207691_10032378 3300025940 Bacteria 4874
174 Ga0207691_10711567 3300025940 Unclassified 847
175 Ga0207689_10126238 3300025942 Bacteria 2105
176 Ga0207667_10067652 3300025949 Bacteria 3721
177 Ga0207651_10029622 3300025960 Unclassified 3471
178 Ga0207651_11907401 3300025960 Bacteria 534
179 Ga0207712_10002957 3300025961 Bacteria 10845
180 Ga0207712_10070325 3300025961 Bacteria 2514
181 Ga0207712_10473989 3300025961 Bacteria 1066
182 Ga0207712_11016817 3300025961 Unclassified 736
183 Ga0207668_10024960 3300025972 Bacteria 3864
184 Ga0207640_10106203 3300025981 Bacteria 1980
185 Ga0207658_10406264 3300025986 Unclassified 1198
186 Ga0207677_10397669 3300026023 Unclassified 1168
187 Ga0207639_10298008 3300026041 Bacteria 1424
188 Ga0207708_10134672 3300026075 Bacteria 1934
189 Ga0207702_10594344 3300026078 Bacteria 1085
190 Ga0207702_11248301 3300026078 Unclassified 737
191 Ga0207641_10013412 3300026088 Bacteria 6719
192 Ga0207641_10244022 3300026088 Unclassified 1675
193 Ga0207641_10729172 3300026088 Bacteria 977
194 Ga0207641_11671095 3300026088 Bacteria 639
195 Ga0207648_10028787 3300026089 Bacteria 4925
196 Ga0207676_10030930 3300026095 Unclassified 4023
197 Ga0207676_10201665 3300026095 Bacteria 1758
198 Ga0207674_10068266 3300026116 Bacteria 3578
199 Ga0207674_10651127 3300026116 Unclassified 1017
200 Ga0207675_100175387 3300026118 Bacteria 2051
201 Ga0207675_100178533 3300026118 Bacteria 2032
202 Ga0207675_101663616 3300026118 Bacteria 658
203 Ga0207675_102002464 3300026118 Bacteria 597
204 Ga0207683_10159086 3300026121 Bacteria 2041
205 Ga0207698_10518618 3300026142 Unclassified 1163
206 Ga0207698_11177524 3300026142 Unclassified 780
207 Ga0268265_10406395 3300028380 Bacteria 1260
208 Ga0268265_10406710 3300028380 Bacteria 1260
209 Ga0268264_10190059 3300028381 Unclassified 1871
210 Ga0268264_12221351 3300028381 Bacteria 556
211 Ga0265327_10120970 3300031251 Bacteria 1240
212 Ga0307513_10251820 3300031456 Bacteria 1562
213 Ga0307509_10081426 3300031507 Bacteria 3344
214 Ga0307412_11330387 3300031911 Bacteria 648
215 Ga0373955_0704131 3300035172 Bacteria 620
216 Ga0439436_0016133 3300041404 Bacteria 2244
217 Ga0439439_0037650 3300041406 Bacteria 1247
218 Ga0451802_0974240 3300041460 Bacteria 575
219 Ga0451804_0243142 3300041463 Bacteria 702
220 Ga0451851_0102634 3300041507 Bacteria 1013
221 Ga0451853_0390807 3300041512 Bacteria 840
222 Ga0451853_1210032 3300041512 Unclassified 580
223 Ga0451853_2558473 3300041512 Bacteria 2367
224 Ga0439441_010584 3300042001 Bacteria 1549
225 Ga0439457_001748 3300042014 Bacteria 6426
226 Ga0439457_087176 3300042014 Unclassified 720
227 Ga0439462_0019389 3300042015 Bacteria 1770
228 Ga0450923_015238 3300042125 Bacteria 1435
229 Ga0466972_0000038 3300044658 Bacteria 135937
230 Ga0466972_0021899 3300044658 Bacteria 3184
231 Ga0466966_0000630 3300044684 Bacteria 22411
232 Ga0466961_0190331 3300044693 Unclassified 1272
233 Ga0466961_0318272 3300044693 Bacteria 949
234 Ga0466964_0060437 3300044706 Bacteria 1576
235 Ga0466971_0520651 3300044719 Bacteria 588
236 Ga0466970_0213509 3300044765 Bacteria 1076
237 Ga0466957_0002001 3300044842 Bacteria 10851
238 Ga0466957_0015022 3300044842 Bacteria 4517
239 Ga0466959_0001090 3300045049 Bacteria 16267
240 Ga0495638_0246214 3300046460 Unclassified 987
241 Ga0495594_0328060 3300046499 Unclassified 872
242 Ga0495632_0095244 3300046519 Bacteria 1407
243 Ga0495625_0140139 3300046660 Bacteria 1632
244 Ga0495682_0153930 3300049460 Bacteria 820
245 Ga0501031_0033961 3300049568 Bacteria 3328
246 Ga0501038_0017091 3300049574 Bacteria 6563
247 Ga0501043_0631478 3300049579 Bacteria 788
248 Ga0501047_0188323 3300049581 Bacteria 1928
249 Ga0501047_0535232 3300049581 Bacteria 997
250 Ga0501257_005129 3300049686 Bacteria 2881
251 Ga0501225_0010304 3300049705 Bacteria 2650
252 Ga0501035_0353715 3300049822 Bacteria 1229
253 Ga0501284_00058 3300050005 Bacteria 39736
254 nmdc:mga0k408_131620_c1 3300050493 Bacteria 849
255 nmdc:mga0k408_22098_c1 3300050493 Bacteria 3580
256 nmdc:mga0k408_612611_c1 3300050493 Bacteria 642
257 nmdc:mga05p37_437639_c1 3300050507 Bacteria 1517
258 nmdc:mga05p37_86645_c1 3300050507 Bacteria 3860
259 nmdc:mga0qj67_70886_c1 3300050509 Bacteria 2781
260 nmdc:mga06r32_153545_c1 3300050510 Bacteria 2282
261 nmdc:mga08y16_2147459_c1 3300050511 Bacteria 505
262 nmdc:mga08y16_404546_c1 3300050511 Bacteria 1396
263 nmdc:mga08y16_702414_c1 3300050511 Bacteria 1011
264 Ga0500578_0000009 3300053086 Bacteria 219807
265 Ga0500578_0007372 3300053086 Bacteria 7269
266 Ga0500583_0000036 3300053092 Bacteria 95404
267 Ga0500583_0026391 3300053092 Bacteria 2494
268 Ga0500651_0505102 3300053093 Bacteria 666
269 Ga0500562_000085 3300053108 Bacteria 39648
270 Ga0500562_021631 3300053108 Bacteria 1675
271 Ga0500572_012943 3300053111 Bacteria 2055
272 Ga0500573_0503412 3300053140 Unclassified 547
273 Ga0500604_0207296 3300053151 Unclassified 675
274 Ga0500622_0086849 3300053156 Bacteria 1558
275 Ga0500611_059464 3300053727 Bacteria 901
276 2738726552 2738541278 Bacteria 9755573
277 Ga0068862_100854419
278 JGI25154J39366_1017854
279 rootL2_10102082
280 rootL2_10356673
281 rootL2_10357336
282 rootH1_10186669
283 Ga0065714_10359262
284 Ga0065712_10015242
285 Ga0065712_10313177
286 Ga0065715_10035857
287 Ga0065715_10450530
288 Ga0070690_100180246
289 Ga0070670_100162469
290 Ga0070670_100213202
291 Ga0070670_100224212
292 Ga0070670_100653653
293 Ga0070670_100816196
294 Ga0068869_100285816
295 Ga0068869_100343728
296 Ga0068869_100751980
297 Ga0070666_10928696
298 Ga0070682_100714111
299 Ga0068868_100542698
300 Ga0070689_100441701
301 Ga0070689_100725203
302 Ga0070691_10012741
303 Ga0070691_10019692
304 Ga0070669_100081846
305 Ga0070669_100177351
306 Ga0070669_100257770
307 Ga0070669_100283651
308 Ga0070675_100481755
309 Ga0070675_100675801
310 Ga0070671_101251104
311 Ga0070673_100046479
312 Ga0070667_100478629
313 Ga0070678_100334077
314 Ga0070662_101205346
315 Ga0070681_10035533
316 Ga0070685_10027443
317 Ga0070685_10296634
318 Ga0070698_100006768
319 Ga0070698_100043563
320 Ga0070698_100081889
321 Ga0070698_100942144
322 Ga0070698_101243449
323 Ga0070699_100871864
324 Ga0070684_100669999
325 Ga0070684_100762926
326 Ga0070672_100060806
327 Ga0070672_100411239
328 Ga0070672_100780565
329 Ga0070672_100970067
330 Ga0068855_100082680
331 Ga0068857_100217199
332 Ga0068854_100162638
333 Ga0068856_100021876
334 Ga0068856_100105967
335 Ga0068852_100014576
336 Ga0068852_100679232
337 Ga0068859_100000534
338 Ga0068859_100296845
339 Ga0068859_100373549
340 Ga0068859_101228407
341 Ga0068859_101511048
342 Ga0068864_100086250
343 Ga0068864_100172548
344 Ga0068864_100173025
345 Ga0068861_100056812
346 Ga0068861_100131443
347 Ga0068851_10088311
348 Ga0068870_10264026
349 Ga0068863_100033540
350 Ga0068858_100124958
351 Ga0068860_100055781
352 Ga0068860_100294809
353 Ga0068862_100222457
354 Ga0068862_101137873
355 Ga0075366_10023659
356 Ga0075366_10188069
357 Ga0075366_10828384
358 Ga0097621_100061132
359 Ga0097621_100383028
360 Ga0097621_100493407
361 Ga0068871_102338262
362 Ga0075428_100023774
363 Ga0075428_100080948
364 Ga0075430_100003342
365 Ga0075431_100013434
366 Ga0075429_100236956
367 Ga0068865_100465690
368 Ga0097620_100000534
369 Ga0097620_100296817
370 Ga0097620_100373576
371 Ga0097620_101228398
372 Ga0097620_101510715
373 Ga0105240_10010489
374 Ga0105240_10244431
375 Ga0111539_10914763
376 Ga0105247_10001821
377 Ga0114129_10030503
378 Ga0114129_10356753
379 Ga0105241_10015646
380 Ga0105241_12024611
381 Ga0105242_10060996
382 Ga0105242_10160988
383 Ga0105242_10870914
384 Ga0105248_10346705
385 Ga0105237_10074135
386 Ga0105249_10003692
387 Ga0105249_10087561
388 Ga0105249_10465548
389 Ga0105239_10076642
390 Ga0105239_10079873
391 Ga0105239_10158676
392 Ga0105246_10845899
393 Ga0105246_11600735
394 Ga0157374_10013261
395 Ga0157378_10899933
396 Ga0157372_10097545
397 Ga0157372_10159455
398 Ga0157372_10210878
399 Ga0157372_10373913
400 Ga0157372_11056731
401 Ga0157372_12479053
402 Ga0157372_12501866
403 Ga0157375_10164836
404 Ga0163163_10342922
405 Ga0163163_10463769
406 Ga0163163_11069574
407 Ga0163163_11283001
408 Ga0157380_10312879
409 Ga0157380_10405301
410 Ga0157380_10507175
411 Ga0157380_10671392
412 Ga0157380_10994423
413 Ga0157380_11031783
414 Ga0157377_10004290
415 Ga0157377_10022699
416 Ga0157379_11266565
417 Ga0157376_10356105
418 Ga0157376_10832418
419 Ga0157376_11455554
420 Ga0209646_1002139
421 Ga0207656_10169245
422 Ga0207682_10242019
423 Ga0207710_10001437
424 Ga0207688_10127601
425 Ga0207688_10323700
426 Ga0207680_10506817
427 Ga0207643_10208113
428 Ga0207643_10770720
429 Ga0207654_10119074
430 Ga0207707_10034960
431 Ga0207695_10002676
432 Ga0207662_10173041
433 Ga0207681_10020086
434 Ga0207681_10290775
435 Ga0207681_10315702
436 Ga0207650_10009161
437 Ga0207650_10154335
438 Ga0207650_10575129
439 Ga0207659_10102837
440 Ga0207659_10185962
441 Ga0207644_11056217
442 Ga0207706_10697751
443 Ga0207686_10000403
444 Ga0207686_10869364
445 Ga0207670_10063612
446 Ga0207670_10093301
447 Ga0207670_11110287
448 Ga0207704_10057439
449 Ga0207691_10032378
450 Ga0207691_10711567
451 Ga0207689_10126238
452 Ga0207667_10067652
453 Ga0207651_10029622
454 Ga0207651_11907401
455 Ga0207712_10002957
456 Ga0207712_10070325
457 Ga0207712_10473989
458 Ga0207712_11016817
459 Ga0207668_10024960
460 Ga0207640_10106203
461 Ga0207658_10406264
462 Ga0207677_10397669
463 Ga0207639_10298008
464 Ga0207708_10134672
465 Ga0207702_10594344
466 Ga0207702_11248301
467 Ga0207641_10013412
468 Ga0207641_10244022
469 Ga0207641_10729172
470 Ga0207641_11671095
471 Ga0207648_10028787
472 Ga0207676_10030930
473 Ga0207676_10201665
474 Ga0207674_10068266
475 Ga0207674_10651127
476 Ga0207675_100175387
477 Ga0207675_100178533
478 Ga0207675_101663616
479 Ga0207675_102002464
480 Ga0207683_10159086
481 Ga0207698_10518618
482 Ga0207698_11177524
483 Ga0268265_10406395
484 Ga0268265_10406710
485 Ga0268264_10190059
486 Ga0268264_12221351
487 Ga0265327_10120970
488 Ga0307513_10251820
489 Ga0307509_10081426
490 Ga0307412_11330387
491 Ga0373955_0704131
492 Ga0439436_0016133
493 Ga0439439_0037650
494 Ga0451802_0974240
495 Ga0451804_0243142
496 Ga0451851_0102634
497 Ga0451853_0390807
498 Ga0451853_1210032
499 Ga0451853_2558473
500 Ga0439441_010584
501 Ga0439457_001748
502 Ga0439457_087176
503 Ga0439462_0019389
504 Ga0450923_015238
505 Ga0466972_0000038
506 Ga0466972_0021899
507 Ga0466966_0000630
508 Ga0466961_0190331
509 Ga0466961_0318272
510 Ga0466964_0060437
511 Ga0466971_0520651
512 Ga0466970_0213509
513 Ga0466957_0002001
514 Ga0466957_0015022
515 Ga0466959_0001090
516 Ga0495638_0246214
517 Ga0495594_0328060
518 Ga0495632_0095244
519 Ga0495625_0140139
520 Ga0495682_0153930
521 Ga0501031_0033961
522 Ga0501038_0017091
523 Ga0501043_0631478
524 Ga0501047_0188323
525 Ga0501047_0535232
526 Ga0501257_005129
527 Ga0501225_0010304
528 Ga0501035_0353715
529 Ga0501284_00058
530 nmdc:mga0k408_131620_c1
531 nmdc:mga0k408_22098_c1
532 nmdc:mga0k408_612611_c1
533 nmdc:mga05p37_437639_c1
534 nmdc:mga05p37_86645_c1
535 nmdc:mga0qj67_70886_c1
536 nmdc:mga06r32_153545_c1
537 nmdc:mga08y16_2147459_c1
538 nmdc:mga08y16_404546_c1
539 nmdc:mga08y16_702414_c1
540 Ga0500578_0000009
541 Ga0500578_0007372
542 Ga0500583_0000036
543 Ga0500583_0026391
544 Ga0500651_0505102
545 Ga0500562_000085
546 Ga0500562_021631
547 Ga0500572_012943
548 Ga0500573_0503412
549 Ga0500604_0207296
550 Ga0500622_0086849
551 Ga0500611_059464
552 2738726552

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

19

168

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ef5-assembly1.cif.gz_B structure of the rna pyrophosphohydrolase bdrpph in complex with dgtp 0.8854 1 96
3grn-assembly1.cif.gz_A crystal structure of mutt protein from methanosarcina mazei go1 0.8233 2 98
2rrk-assembly1.cif.gz_A solution structure of the e. coli orf135 protein 0.805 2 102
3x0r-assembly1.cif.gz_A-2 dp ribose pyrophosphatase from thermus thermophilus hb8 in e'-state at reaction time of 30 min 0.8035 4 97
5xd2-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with ap5a, atp and manganese 0.8008 1 150
ID Description Score Start End Superfamily
af_P77788_1_135_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8349 2 96 3.90.79.10
3eesB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7934 2 149 3.90.79.10
2b0vA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7915 1 146 3.90.79.10
5zrcA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7784 3 143 3.90.79.10
4dywB00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7714 1 144 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A7V9M0S6-F1-model_v4 NUDIX domain-containing protein 1 1 149 GO:0016787
AF-A0A0E9N200-F1-model_v4 Putative hydrolase 0.999 1 150 GO:0016787
AF-A0A4R2WB59-F1-model_v4 deleted 0.9981 1 150
AF-A0A0E9N200-F1-model_v4 Putative hydrolase 0.9923 1 150 GO:0016787
AF-A0A4R2WB59-F1-model_v4 deleted 0.9915 1 150

Map