F382726

General Info

Members Datasets Scaffolds Average Seq Length
278 177 556 259

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2675903060|2676493063
Length 264
Sequence EQNRRERRQGQAVVRGSLVPSSTHDQRLLARQGSSDWVHMDPWRVMRIQAEFVEGFGQLAELPPAVTVFGSARTPGDSPDYVMGRALGQALAEAGYAVITGGGPGVMEAANRGARDVEGAISVGLGIELPFEQRMNDFVDLGIEFRYFFVRKTMFVKYSCGFIALPGGFGTLDELFEALTLVQTHKVTSFPVVLVGSDFWGGLLDWIKSSLLGTGKIASHDLDLITVTDDIDDAVRIIVESDRARSRQRQEEIEAAAGHTAEPQ

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
6 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
11 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
12 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
13 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
14 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
15 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
16 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
17 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
20 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
21 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
22 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
23 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
24 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
40 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
41 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
42 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
43 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
44 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
47 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
48 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
49 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
50 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
51 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
52 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
53 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
54 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
55 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
56 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
57 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
58 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
59 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
60 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
61 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
62 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
63 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
64 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
65 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
66 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
67 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
68 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
69 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
72 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
73 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
74 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
83 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
84 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
85 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
86 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
87 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
88 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
93 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
94 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
97 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
101 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
102 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
103 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
106 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
110 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
111 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
112 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
113 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
114 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
128 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
154 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
156 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
157 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
158 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
159 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
160 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
161 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
162 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
163 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
164 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
165 2867369537 Streptomyces sp. Z26 Isolate Unclassified
166 2867475112 Streptomyces sp. TM32 Isolate Unclassified
167 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
168 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
169 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
170 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
171 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
172 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
173 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
174 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
175 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
176 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
177 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.37
Metatranscriptomes 0.72
Isolates 7.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.52
Nodule 0.72
Rhizoplane 15.47
Rhizosphere 74.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10040081 3300005327 Bacteria 3779
2 Ga0070658_10042093 3300005327 Bacteria 3687
3 Ga0070658_10098428 3300005327 Bacteria 2416
4 Ga0070683_100036962 3300005329 Bacteria 4469
5 Ga0070683_100311100 3300005329 Bacteria 1499
6 Ga0070680_100010871 3300005336 Bacteria 7032
7 Ga0070659_100573248 3300005366 Bacteria 968
8 Ga0070681_10000109 3300005458 Bacteria 61563
9 Ga0070681_10049900 3300005458 Bacteria 4177
10 Ga0070679_100000237 3300005530 Bacteria 45794
11 Ga0070679_100043708 3300005530 Bacteria 4462
12 Ga0070684_100057303 3300005535 Bacteria 3402
13 Ga0070684_100338167 3300005535 Bacteria 1384
14 Ga0070665_100009311 3300005548 Bacteria 9941
15 Ga0068855_100004853 3300005563 Bacteria 16415
16 Ga0068855_100169911 3300005563 Bacteria 2470
17 Ga0068861_100126874 3300005719 Bacteria 2066
18 Ga0068861_100507965 3300005719 Bacteria 1091
19 Ga0075365_10003909 3300006038 Bacteria 7802
20 Ga0075365_10066575 3300006038 Bacteria 2417
21 Ga0075368_10028541 3300006042 Bacteria 2156
22 Ga0105245_10185901 3300009098 Bacteria 1988
23 Ga0105245_10283407 3300009098 Bacteria 1620
24 Ga0105243_10031986 3300009148 Bacteria 4060
25 Ga0105243_10104024 3300009148 Bacteria 2362
26 Ga0105242_10483841 3300009176 Bacteria 1174
27 Ga0105242_10559831 3300009176 Bacteria 1098
28 Ga0105248_10500511 3300009177 Bacteria 1370
29 Ga0105237_10515364 3300009545 Bacteria 1202
30 Ga0105239_10322478 3300010375 Bacteria 1742
31 Ga0105239_11062323 3300010375 Bacteria 932
32 Ga0157375_10537766 3300013308 Bacteria 1331
33 Ga0157375_11328810 3300013308 Bacteria 846
34 Ga0157380_10254392 3300014326 Bacteria 1592
35 Ga0206354_10850932 3300020081 Bacteria 2982
36 Ga0206353_11894164 3300020082 Bacteria 5619
37 Ga0207426_1002494 3300025302 Bacteria 11662
38 Ga0207710_10050836 3300025900 Bacteria 1860
39 Ga0207688_10191478 3300025901 Bacteria 1223
40 Ga0207705_10112267 3300025909 Bacteria 2015
41 Ga0207707_10000290 3300025912 Bacteria 53506
42 Ga0207660_10007410 3300025917 Bacteria 7100
43 Ga0207660_10050657 3300025917 Bacteria 2949
44 Ga0207652_10268098 3300025921 Bacteria 1540
45 Ga0207687_10435093 3300025927 Bacteria 1085
46 Ga0207709_10180617 3300025935 Bacteria 1490
47 Ga0207709_10180861 3300025935 Bacteria 1489
48 Ga0207709_10238372 3300025935 Bacteria 1322
49 Ga0207661_10087148 3300025944 Bacteria 2592
50 Ga0207661_10328258 3300025944 Bacteria 1377
51 Ga0207667_10063136 3300025949 Bacteria 3870
52 Ga0207667_10120875 3300025949 Bacteria 2699
53 Ga0207708_10016451 3300026075 Bacteria 5562
54 Ga0207702_10370064 3300026078 Bacteria 1376
55 Ga0207675_100044708 3300026118 Bacteria 4139
56 Ga0207683_10038830 3300026121 Bacteria 4152
57 Ga0207683_10051814 3300026121 Bacteria 3596
58 Ga0268266_10000794 3300028379 Bacteria 42029
59 Ga0307408_100173540 3300031548 Bacteria 1723
60 Ga0316576_10002847 3300031727 Bacteria 9972
61 Ga0316576_10021678 3300031727 Bacteria 4448
62 Ga0316576_10159430 3300031727 Bacteria 1701
63 Ga0316578_10289370 3300031728 Bacteria 980
64 Ga0307413_10653817 3300031824 Bacteria 867
65 Ga0307410_10012711 3300031852 Bacteria 4880
66 Ga0307407_10031876 3300031903 Bacteria 2859
67 Ga0307409_100052857 3300031995 Bacteria 3117
68 Ga0307409_100399109 3300031995 Bacteria 1313
69 Ga0307416_100207044 3300032002 Bacteria 1867
70 Ga0307416_100469995 3300032002 Bacteria 1315
71 Ga0316583_10056280 3300032133 Bacteria 1382
72 Ga0307507_10000113 3300033179 Bacteria 133812
73 Ga0316574_0014589 3300035398 Bacteria 4542
74 Ga0316584_0043699 3300036712 Bacteria 3341
75 Ga0316584_0078702 3300036712 Bacteria 2469
76 Ga0395899_0022143 3300037312 Bacteria 4819
77 Ga0395900_0193478 3300037418 Bacteria 2062
78 Ga0395898_0003717 3300037466 Bacteria 16927
79 Ga0395898_0105537 3300037466 Bacteria 2702
80 Ga0395901_0007316 3300038443 Bacteria 11145
81 Ga0395901_0029299 3300038443 Bacteria 5666
82 Ga0395901_0180288 3300038443 Bacteria 2215
83 Ga0436365_0512892 3300039437 Bacteria 2095
84 Ga0451797_0064374 3300041453 Bacteria 2304
85 Ga0451797_0400138 3300041453 Bacteria 3240
86 Ga0451837_0932900 3300041494 Bacteria 1675
87 Ga0451843_0078379 3300041509 Bacteria 1307
88 Ga0439457_001349 3300042014 Bacteria 7373
89 Ga0450897_003135 3300042128 Bacteria 1304
90 Ga0450894_000037 3300042131 Bacteria 19538
91 Ga0450896_000889 3300042133 Bacteria 3436
92 Ga0450899_000077 3300042135 Bacteria 8149
93 Ga0450906_000093 3300042145 Bacteria 14880
94 Ga0466969_0062987 3300044656 Bacteria 1798
95 Ga0466972_0010295 3300044658 Bacteria 4696
96 Ga0466972_0067102 3300044658 Bacteria 1714
97 Ga0466972_0138596 3300044658 Bacteria 1145
98 Ga0466965_0000976 3300044683 Bacteria 11072
99 Ga0466966_0000761 3300044684 Bacteria 20458
100 Ga0466966_0017463 3300044684 Bacteria 4740
101 Ga0466966_0043230 3300044684 Bacteria 2889
102 Ga0466966_0076066 3300044684 Bacteria 2097
103 Ga0466966_0107985 3300044684 Bacteria 1717
104 Ga0466961_0001613 3300044693 Bacteria 13987
105 Ga0466961_0018100 3300044693 Bacteria 4530
106 Ga0466961_0021962 3300044693 Bacteria 4106
107 Ga0466961_0086931 3300044693 Bacteria 1976
108 Ga0466961_0093146 3300044693 Bacteria 1901
109 Ga0466963_0000616 3300044694 Bacteria 17068
110 Ga0466963_0011310 3300044694 Bacteria 5431
111 Ga0466963_0023001 3300044694 Bacteria 3953
112 Ga0466963_0024083 3300044694 Bacteria 3873
113 Ga0466963_0042710 3300044694 Bacteria 2978
114 Ga0466963_0045097 3300044694 Bacteria 2903
115 Ga0466964_0008324 3300044706 Bacteria 3892
116 Ga0466971_0001392 3300044719 Bacteria 10146
117 Ga0466971_0019402 3300044719 Bacteria 3019
118 Ga0466968_0126070 3300044735 Bacteria 1162
119 Ga0466970_0009370 3300044765 Bacteria 4947
120 Ga0466970_0034605 3300044765 Bacteria 2675
121 Ga0466957_0012819 3300044842 Bacteria 4857
122 Ga0466957_0200692 3300044842 Bacteria 1310
123 Ga0466960_0026908 3300044901 Bacteria 2617
124 Ga0466959_0003006 3300045049 Bacteria 10895
125 Ga0466959_0009079 3300045049 Bacteria 7056
126 Ga0466959_0012555 3300045049 Bacteria 6125
127 Ga0466959_0023451 3300045049 Bacteria 4566
128 Ga0466958_0004130 3300045836 Bacteria 7622
129 Ga0466958_0015983 3300045836 Bacteria 4314
130 Ga0466967_0036600 3300045976 Bacteria 4191
131 Ga0466967_0246932 3300045976 Bacteria 1704
132 Ga0466967_0483636 3300045976 Bacteria 1213
133 Ga0466967_0826056 3300045976 Bacteria 920
134 Ga0495592_0027997 3300046454 Bacteria 4269
135 Ga0495629_0057861 3300046459 Bacteria 2710
136 Ga0495629_0217923 3300046459 Bacteria 1317
137 Ga0495629_0262566 3300046459 Bacteria 1187
138 Ga0495641_0072017 3300046461 Bacteria 1551
139 Ga0495641_0081699 3300046461 Bacteria 1447
140 Ga0495641_0131480 3300046461 Bacteria 1117
141 Ga0495651_0007070 3300046462 Bacteria 8582
142 Ga0495653_0028417 3300046463 Bacteria 4470
143 Ga0495580_0233844 3300046472 Bacteria 1261
144 Ga0495582_0102536 3300046473 Bacteria 1603
145 Ga0495662_0014209 3300046476 Bacteria 3873
146 Ga0495664_0015545 3300046477 Bacteria 4327
147 Ga0495664_0030067 3300046477 Bacteria 3181
148 Ga0495608_0014760 3300046511 Bacteria 5420
149 Ga0495628_0000880 3300046516 Bacteria 27703
150 Ga0495630_0635582 3300046517 Bacteria 818
151 Ga0495665_0006146 3300046531 Bacteria 6488
152 Ga0495640_0007846 3300046533 Bacteria 8393
153 Ga0495586_0015944 3300046535 Bacteria 3998
154 Ga0495645_0013801 3300046543 Bacteria 5724
155 Ga0495645_0203087 3300046543 Bacteria 1343
156 Ga0495667_0006183 3300046559 Bacteria 8113
157 Ga0495656_0063689 3300046615 Bacteria 1617
158 Ga0495634_0103106 3300046642 Bacteria 1841
159 Ga0495635_0028848 3300046663 Bacteria 3857
160 Ga0495635_0221827 3300046663 Bacteria 1278
161 Ga0495657_0009246 3300046675 Bacteria 7478
162 Ga0495657_0237072 3300046675 Bacteria 1102
163 Ga0495599_0028848 3300046678 Bacteria 3477
164 Ga0495658_0141115 3300046683 Bacteria 1473
165 Ga0495613_0017225 3300046689 Bacteria 5382
166 Ga0495600_0001545 3300046809 Bacteria 12802
167 Ga0495581_0003426 3300047315 Bacteria 9105
168 Ga0495604_0007092 3300047317 Bacteria 8883
169 Ga0495674_0042526 3300047319 Bacteria 4051
170 Ga0495680_0325070 3300047322 Bacteria 1076
171 Ga0495675_0008885 3300047444 Bacteria 6241
172 Ga0495675_0039013 3300047444 Bacteria 3024
173 Ga0495684_0227015 3300047471 Bacteria 1367
174 Ga0495593_0012453 3300047673 Bacteria 4862
175 Ga0495593_0074233 3300047673 Bacteria 1764
176 Ga0495602_0084114 3300048088 Bacteria 2662
177 Ga0496100_0045280 3300048903 Bacteria 2823
178 Ga0496100_0359430 3300048903 Bacteria 1101
179 Ga0496101_0031923 3300048904 Bacteria 3705
180 Ga0496101_0074820 3300048904 Bacteria 2492
181 Ga0496101_0248884 3300048904 Bacteria 1384
182 Ga0496101_0377841 3300048904 Bacteria 1115
183 Ga0496101_0586726 3300048904 Bacteria 881
184 Ga0496102_0001789 3300048905 Bacteria 18636
185 Ga0496102_0081317 3300048905 Bacteria 2987
186 Ga0496102_0206454 3300048905 Bacteria 1852
187 Ga0496102_0383296 3300048905 Bacteria 1323
188 Ga0496103_0018847 3300048906 Bacteria 4143
189 Ga0496104_0006528 3300048907 Bacteria 10257
190 Ga0496104_0085163 3300048907 Bacteria 3017
191 Ga0496104_0199994 3300048907 Bacteria 1910
192 Ga0496104_0248970 3300048907 Bacteria 1690
193 Ga0496105_0000345 3300048908 Bacteria 30539
194 Ga0496105_0128704 3300048908 Bacteria 2088
195 Ga0496106_0017871 3300048909 Bacteria 5244
196 Ga0496106_0052336 3300048909 Bacteria 3080
197 Ga0496106_0146394 3300048909 Bacteria 1861
198 Ga0496107_0342956 3300048910 Bacteria 1111
199 Ga0496108_0044064 3300048911 Bacteria 3726
200 Ga0496108_0232580 3300048911 Bacteria 1603
201 Ga0496108_0262501 3300048911 Bacteria 1503
202 Ga0496108_0321616 3300048911 Bacteria 1349
203 Ga0496109_0005719 3300048912 Bacteria 10407
204 Ga0496109_0221056 3300048912 Bacteria 1781
205 Ga0496109_0714952 3300048912 Bacteria 939
206 Ga0496110_0079076 3300048913 Bacteria 2928
207 Ga0496110_0263534 3300048913 Bacteria 1569
208 Ga0496111_0117674 3300048914 Bacteria 1961
209 Ga0496111_0196619 3300048914 Bacteria 1499
210 Ga0496111_0303372 3300048914 Bacteria 1184
211 Ga0496114_0009013 3300048917 Bacteria 7909
212 Ga0496114_0054429 3300048917 Bacteria 3336
213 Ga0496114_0073755 3300048917 Bacteria 2872
214 Ga0496114_0090928 3300048917 Bacteria 2591
215 Ga0496114_0458078 3300048917 Bacteria 1129
216 Ga0496115_0001682 3300048918 Bacteria 15899
217 Ga0496115_0216686 3300048918 Bacteria 1580
218 Ga0496126_0082570 3300048929 Bacteria 2839
219 Ga0501031_0020219 3300049568 Bacteria 4340
220 Ga0501031_0315920 3300049568 Bacteria 1012
221 Ga0501034_0262720 3300049571 Bacteria 1669
222 Ga0501036_0002508 3300049572 Bacteria 14408
223 Ga0501037_0284497 3300049573 Bacteria 1151
224 Ga0501038_0009383 3300049574 Bacteria 8977
225 Ga0501038_0566011 3300049574 Bacteria 863
226 Ga0501039_0002221 3300049575 Bacteria 14358
227 Ga0501039_0303137 3300049575 Bacteria 1256
228 Ga0501040_0016592 3300049576 Bacteria 4878
229 Ga0501041_0001530 3300049577 Bacteria 12846
230 Ga0501041_0293017 3300049577 Bacteria 1025
231 Ga0501042_0000370 3300049578 Bacteria 22742
232 Ga0501042_0190947 3300049578 Bacteria 1477
233 Ga0501046_0006576 3300049580 Bacteria 10274
234 Ga0501048_0002287 3300049582 Bacteria 14615
235 Ga0501070_0020832 3300049586 Bacteria 5500
236 Ga0501071_0006249 3300049587 Bacteria 7729
237 Ga0501074_0096338 3300049590 Bacteria 2118
238 Ga0501075_0001694 3300049591 Bacteria 14488
239 Ga0501076_0157745 3300049592 Bacteria 1848
240 Ga0501077_0169023 3300049593 Bacteria 1389
241 Ga0501079_0006670 3300049741 Bacteria 8684
242 Ga0501080_0002472 3300049742 Bacteria 16179
243 Ga0501080_0023625 3300049742 Bacteria 5696
244 Ga0501081_0025375 3300049743 Bacteria 3986
245 Ga0501045_0001786 3300049824 Bacteria 14539
246 Ga0501045_0599425 3300049824 Bacteria 816
247 nmdc:mga0yw44_1378_c1 3300050492 Bacteria 9638
248 nmdc:mga0yw44_416945_c1 3300050492 Bacteria 909
249 nmdc:mga06r32_452659_c1 3300050510 Bacteria 1263
250 Ga0495595_0026265 3300053084 Bacteria 2587
251 Ga0495619_0052845 3300053085 Bacteria 2686
252 Ga0495619_0079539 3300053085 Bacteria 2205
253 Ga0500573_0060902 3300053140 Bacteria 2162
254 Ga0466962_0000455 3300061719 Bacteria 17755
255 Ga0466962_0080888 3300061719 Bacteria 1553
256 Ga0530510_0000886 3300061734 Bacteria 19746
257 2676493063 2675903060 Bacteria 10051191
258 2585307043 2582581313 Bacteria 10042643
259 2643851087 2643221567 Bacteria 4163945
260 2644134840 2643221624 Bacteria 4384879
261 2785341436 2784746763 Bacteria 9783172
262 2808913343 2808606375 Bacteria 9466072
263 2812356243 2811994879 Bacteria 9313447
264 2862385462 2862382967 Bacteria 10317375
265 2863408371 2863404153 Bacteria 9672205
266 2867373638 2867369537 Bacteria 6501581
267 2867478352 2867475112 Bacteria 6909112
268 2884702884 2884693830 Bacteria 11273186
269 2895433975 2895427314 Bacteria 13147766
270 2895443933 2895442618 Bacteria 11027144
271 2919474306 2919468124 Bacteria 9133025
272 2946069613 2946064051 Bacteria 8957905
273 2990089452 2990088156 Bacteria 6657676
274 2995467320 2995463766 Bacteria 8577691
275 8008562543 8008558824 Bacteria 10610750
276 8048406694 8048406513 Bacteria 8936924
277 8054161235 8054160619 Bacteria 7783213
278 8056061272 8056060235 Bacteria 7259403
279 Ga0070658_10040081
280 Ga0070658_10042093
281 Ga0070658_10098428
282 Ga0070683_100036962
283 Ga0070683_100311100
284 Ga0070680_100010871
285 Ga0070659_100573248
286 Ga0070681_10000109
287 Ga0070681_10049900
288 Ga0070679_100000237
289 Ga0070679_100043708
290 Ga0070684_100057303
291 Ga0070684_100338167
292 Ga0070665_100009311
293 Ga0068855_100004853
294 Ga0068855_100169911
295 Ga0068861_100126874
296 Ga0068861_100507965
297 Ga0075365_10003909
298 Ga0075365_10066575
299 Ga0075368_10028541
300 Ga0105245_10185901
301 Ga0105245_10283407
302 Ga0105243_10031986
303 Ga0105243_10104024
304 Ga0105242_10483841
305 Ga0105242_10559831
306 Ga0105248_10500511
307 Ga0105237_10515364
308 Ga0105239_10322478
309 Ga0105239_11062323
310 Ga0157375_10537766
311 Ga0157375_11328810
312 Ga0157380_10254392
313 Ga0206354_10850932
314 Ga0206353_11894164
315 Ga0207426_1002494
316 Ga0207710_10050836
317 Ga0207688_10191478
318 Ga0207705_10112267
319 Ga0207707_10000290
320 Ga0207660_10007410
321 Ga0207660_10050657
322 Ga0207652_10268098
323 Ga0207687_10435093
324 Ga0207709_10180617
325 Ga0207709_10180861
326 Ga0207709_10238372
327 Ga0207661_10087148
328 Ga0207661_10328258
329 Ga0207667_10063136
330 Ga0207667_10120875
331 Ga0207708_10016451
332 Ga0207702_10370064
333 Ga0207675_100044708
334 Ga0207683_10038830
335 Ga0207683_10051814
336 Ga0268266_10000794
337 Ga0307408_100173540
338 Ga0316576_10002847
339 Ga0316576_10021678
340 Ga0316576_10159430
341 Ga0316578_10289370
342 Ga0307413_10653817
343 Ga0307410_10012711
344 Ga0307407_10031876
345 Ga0307409_100052857
346 Ga0307409_100399109
347 Ga0307416_100207044
348 Ga0307416_100469995
349 Ga0316583_10056280
350 Ga0307507_10000113
351 Ga0316574_0014589
352 Ga0316584_0043699
353 Ga0316584_0078702
354 Ga0395899_0022143
355 Ga0395900_0193478
356 Ga0395898_0003717
357 Ga0395898_0105537
358 Ga0395901_0007316
359 Ga0395901_0029299
360 Ga0395901_0180288
361 Ga0436365_0512892
362 Ga0451797_0064374
363 Ga0451797_0400138
364 Ga0451837_0932900
365 Ga0451843_0078379
366 Ga0439457_001349
367 Ga0450897_003135
368 Ga0450894_000037
369 Ga0450896_000889
370 Ga0450899_000077
371 Ga0450906_000093
372 Ga0466969_0062987
373 Ga0466972_0010295
374 Ga0466972_0067102
375 Ga0466972_0138596
376 Ga0466965_0000976
377 Ga0466966_0000761
378 Ga0466966_0017463
379 Ga0466966_0043230
380 Ga0466966_0076066
381 Ga0466966_0107985
382 Ga0466961_0001613
383 Ga0466961_0018100
384 Ga0466961_0021962
385 Ga0466961_0086931
386 Ga0466961_0093146
387 Ga0466963_0000616
388 Ga0466963_0011310
389 Ga0466963_0023001
390 Ga0466963_0024083
391 Ga0466963_0042710
392 Ga0466963_0045097
393 Ga0466964_0008324
394 Ga0466971_0001392
395 Ga0466971_0019402
396 Ga0466968_0126070
397 Ga0466970_0009370
398 Ga0466970_0034605
399 Ga0466957_0012819
400 Ga0466957_0200692
401 Ga0466960_0026908
402 Ga0466959_0003006
403 Ga0466959_0009079
404 Ga0466959_0012555
405 Ga0466959_0023451
406 Ga0466958_0004130
407 Ga0466958_0015983
408 Ga0466967_0036600
409 Ga0466967_0246932
410 Ga0466967_0483636
411 Ga0466967_0826056
412 Ga0495592_0027997
413 Ga0495629_0057861
414 Ga0495629_0217923
415 Ga0495629_0262566
416 Ga0495641_0072017
417 Ga0495641_0081699
418 Ga0495641_0131480
419 Ga0495651_0007070
420 Ga0495653_0028417
421 Ga0495580_0233844
422 Ga0495582_0102536
423 Ga0495662_0014209
424 Ga0495664_0015545
425 Ga0495664_0030067
426 Ga0495608_0014760
427 Ga0495628_0000880
428 Ga0495630_0635582
429 Ga0495665_0006146
430 Ga0495640_0007846
431 Ga0495586_0015944
432 Ga0495645_0013801
433 Ga0495645_0203087
434 Ga0495667_0006183
435 Ga0495656_0063689
436 Ga0495634_0103106
437 Ga0495635_0028848
438 Ga0495635_0221827
439 Ga0495657_0009246
440 Ga0495657_0237072
441 Ga0495599_0028848
442 Ga0495658_0141115
443 Ga0495613_0017225
444 Ga0495600_0001545
445 Ga0495581_0003426
446 Ga0495604_0007092
447 Ga0495674_0042526
448 Ga0495680_0325070
449 Ga0495675_0008885
450 Ga0495675_0039013
451 Ga0495684_0227015
452 Ga0495593_0012453
453 Ga0495593_0074233
454 Ga0495602_0084114
455 Ga0496100_0045280
456 Ga0496100_0359430
457 Ga0496101_0031923
458 Ga0496101_0074820
459 Ga0496101_0248884
460 Ga0496101_0377841
461 Ga0496101_0586726
462 Ga0496102_0001789
463 Ga0496102_0081317
464 Ga0496102_0206454
465 Ga0496102_0383296
466 Ga0496103_0018847
467 Ga0496104_0006528
468 Ga0496104_0085163
469 Ga0496104_0199994
470 Ga0496104_0248970
471 Ga0496105_0000345
472 Ga0496105_0128704
473 Ga0496106_0017871
474 Ga0496106_0052336
475 Ga0496106_0146394
476 Ga0496107_0342956
477 Ga0496108_0044064
478 Ga0496108_0232580
479 Ga0496108_0262501
480 Ga0496108_0321616
481 Ga0496109_0005719
482 Ga0496109_0221056
483 Ga0496109_0714952
484 Ga0496110_0079076
485 Ga0496110_0263534
486 Ga0496111_0117674
487 Ga0496111_0196619
488 Ga0496111_0303372
489 Ga0496114_0009013
490 Ga0496114_0054429
491 Ga0496114_0073755
492 Ga0496114_0090928
493 Ga0496114_0458078
494 Ga0496115_0001682
495 Ga0496115_0216686
496 Ga0496126_0082570
497 Ga0501031_0020219
498 Ga0501031_0315920
499 Ga0501034_0262720
500 Ga0501036_0002508
501 Ga0501037_0284497
502 Ga0501038_0009383
503 Ga0501038_0566011
504 Ga0501039_0002221
505 Ga0501039_0303137
506 Ga0501040_0016592
507 Ga0501041_0001530
508 Ga0501041_0293017
509 Ga0501042_0000370
510 Ga0501042_0190947
511 Ga0501046_0006576
512 Ga0501048_0002287
513 Ga0501070_0020832
514 Ga0501071_0006249
515 Ga0501074_0096338
516 Ga0501075_0001694
517 Ga0501076_0157745
518 Ga0501077_0169023
519 Ga0501079_0006670
520 Ga0501080_0002472
521 Ga0501080_0023625
522 Ga0501081_0025375
523 Ga0501045_0001786
524 Ga0501045_0599425
525 nmdc:mga0yw44_1378_c1
526 nmdc:mga0yw44_416945_c1
527 nmdc:mga06r32_452659_c1
528 Ga0495595_0026265
529 Ga0495619_0052845
530 Ga0495619_0079539
531 Ga0500573_0060902
532 Ga0466962_0000455
533 Ga0466962_0080888
534 Ga0530510_0000886
535 2676493063
536 2585307043
537 2643851087
538 2644134840
539 2785341436
540 2808913343
541 2812356243
542 2862385462
543 2863408371
544 2867373638
545 2867478352
546 2884702884
547 2895433975
548 2895443933
549 2919474306
550 2946069613
551 2990089452
552 2995467320
553 8008562543
554 8048406694
555 8054161235
556 8056061272

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03641

Lysine_decarbox

Possible lysine decarboxylase

107

238

0.95

PF18306

LDcluster4

SLOG cluster4 family

63

198

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wek-assembly1.cif.gz_E crystal structure of the conserved hypothetical protein tt1465 from thermus thermophilus hb8 0.9692 59 260
1wek-assembly1.cif.gz_B crystal structure of the conserved hypothetical protein tt1465 from thermus thermophilus hb8 0.9595 57 258
5zi9-assembly1.cif.gz_A crystal structure of type-ii log from streptomyces coelicolor a3 0.9586 56 260
5wq3-assembly1.cif.gz_B-2 crystal structure of type-ii log from corynebacterium glutamicum 0.9459 56 263
1wek-assembly1.cif.gz_F crystal structure of the conserved hypothetical protein tt1465 from thermus thermophilus hb8 0.9417 59 259
ID Description Score Start End Superfamily
5wq3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9666 62 263 3.40.50.450
5wq3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9573 62 263 3.40.50.450
1wekF01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9509 63 259 3.40.50.450
1wekF01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9363 63 259 3.40.50.450
af_Q8I1V0_170_336_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.928 117 259 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A5J6V8A1-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9857 67 264 GO:0005829
GO:0009691
GO:0102682
AF-A0A7C4HNH5-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9849 88 259 GO:0005829
GO:0008714
GO:0009691
AF-A0A382YWA3-F1-model_v4 TIGR00730 family Rossman fold protein 0.9844 89 163 GO:0005829
AF-A0A535AYR3-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9841 61 264 GO:0005829
GO:0009691
GO:0016787
AF-A0A7Y2ZJN8-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9835 70 267 GO:0005829
GO:0009691
GO:0016787

Map