F382711

General Info

Members Datasets Scaffolds Average Seq Length
278 177 556 161

Family's Representative Sequence

Representative Sequence 3300059652|Ga0587107_040388|Ga0587107_040388_37_600
Length 187
Sequence MAVKPIPEGYHTVTPFMTVKDCARAIEFYKQAFGAEERGIAKDPSGKVMHAEIKIGDSVIMMADEFPDFGALSPDSVGGSSMGLHIYVTDVDGAFARAVKAGAKVEMPVMDQFWGDRYGKLKDPFGHKWSIATHVKDMSSDEMKRAMDDAMAKMHAVVVHPVGDAAAGSWDQPEGATDPSESYKTDC

Samples

Sample ID Description Type Environment
1 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
57 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
94 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
100 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
101 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
119 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.81
Metatranscriptomes 7.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.08
Rhizosphere 98.56
Stem 0
Stem Tuber 0
Unclassified 30.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587107_040388 3300059652 Bacteria 751
2 Ga0065707_10838190 3300005295 Bacteria 586
3 Ga0070683_100682128 3300005329 Unclassified 984
4 Ga0070666_10123802 3300005335 Bacteria 1794
5 Ga0068868_100866835 3300005338 Unclassified 819
6 Ga0070689_100186088 3300005340 Bacteria 1689
7 Ga0070671_100210931 3300005355 Unclassified 1647
8 Ga0070674_100213792 3300005356 Unclassified 1496
9 Ga0070709_10002384 3300005434 Bacteria 10178
10 Ga0070709_10345375 3300005434 Bacteria 1098
11 Ga0070709_10593314 3300005434 Bacteria 852
12 Ga0070714_100003287 3300005435 Bacteria 12044
13 Ga0070714_100182314 3300005435 Unclassified 1911
14 Ga0070713_100001535 3300005436 Bacteria 14749
15 Ga0070713_100015124 3300005436 Bacteria 5752
16 Ga0070713_100108622 3300005436 Bacteria 2416
17 Ga0070713_100357319 3300005436 Unclassified 1356
18 Ga0070710_10237536 3300005437 Bacteria 1166
19 Ga0070711_100000528 3300005439 Bacteria 19841
20 Ga0070711_100106627 3300005439 Bacteria 2049
21 Ga0070711_100158622 3300005439 Bacteria 1713
22 Ga0070711_100306308 3300005439 Bacteria 1265
23 Ga0070711_100450710 3300005439 Bacteria 1053
24 Ga0070711_101052869 3300005439 Unclassified 700
25 Ga0070694_100000366 3300005444 Bacteria 24246
26 Ga0070708_100006197 3300005445 Bacteria 9510
27 Ga0070708_100087275 3300005445 Bacteria 2835
28 Ga0070708_100368996 3300005445 Bacteria 1353
29 Ga0070678_100007760 3300005456 Bacteria 6382
30 Ga0070706_100011903 3300005467 Bacteria 8075
31 Ga0070706_100060802 3300005467 Unclassified 3487
32 Ga0070707_100004065 3300005468 Bacteria 13745
33 Ga0070707_100200285 3300005468 Bacteria 1946
34 Ga0070707_100777102 3300005468 Unclassified 921
35 Ga0070698_100003910 3300005471 Bacteria 16383
36 Ga0070699_100001386 3300005518 Bacteria 22280
37 Ga0070679_100066092 3300005530 Unclassified 3605
38 Ga0070697_100004806 3300005536 Bacteria 10352
39 Ga0068853_100188385 3300005539 Bacteria 1873
40 Ga0070665_100010116 3300005548 Bacteria 9542
41 Ga0068855_100189763 3300005563 Bacteria 2319
42 Ga0068855_102165453 3300005563 Unclassified 559
43 Ga0070664_100693894 3300005564 Bacteria 948
44 Ga0070664_101941943 3300005564 Unclassified 558
45 Ga0068857_101240062 3300005577 Unclassified 723
46 Ga0068856_100065372 3300005614 Unclassified 3595
47 Ga0068856_100111519 3300005614 Bacteria 2733
48 Ga0068856_100345978 3300005614 Bacteria 1505
49 Ga0068859_100337994 3300005617 Unclassified 1600
50 Ga0068864_100280496 3300005618 Unclassified 1555
51 Ga0068863_100050992 3300005841 Unclassified 3922
52 Ga0068860_100141234 3300005843 Unclassified 2315
53 Ga0070717_10013000 3300006028 Bacteria 6359
54 Ga0070717_10017304 3300006028 Bacteria 5608
55 Ga0070717_10026549 3300006028 Bacteria 4619
56 Ga0070717_10045564 3300006028 Unclassified 3586
57 Ga0070717_10058195 3300006028 Unclassified 3196
58 Ga0070717_10097204 3300006028 Bacteria 2495
59 Ga0070717_10138900 3300006028 Bacteria 2095
60 Ga0070717_10684899 3300006028 Bacteria 931
61 Ga0070717_10777616 3300006028 Unclassified 871
62 Ga0070717_11293112 3300006028 Unclassified 663
63 Ga0070717_11406823 3300006028 Bacteria 633
64 Ga0070715_10001467 3300006163 Bacteria 6858
65 Ga0070716_100005805 3300006173 Bacteria 5994
66 Ga0070716_100015421 3300006173 Unclassified 3925
67 Ga0070716_100168717 3300006173 Unclassified 1426
68 Ga0070716_100175871 3300006173 Bacteria 1401
69 Ga0070716_100193474 3300006173 Bacteria 1346
70 Ga0070712_100000329 3300006175 Bacteria 26925
71 Ga0070712_100000870 3300006175 Bacteria 18026
72 Ga0070712_100007185 3300006175 Bacteria 6943
73 Ga0070712_100384555 3300006175 Bacteria 1156
74 Ga0070712_100407787 3300006175 Bacteria 1124
75 Ga0070712_100822585 3300006175 Unclassified 798
76 Ga0068871_100152274 3300006358 Unclassified 1973
77 Ga0068871_101051851 3300006358 Bacteria 760
78 Ga0075434_100000708 3300006871 Bacteria 26066
79 Ga0097620_100337962 3300006931 Unclassified 1600
80 Ga0075435_100031730 3300007076 Bacteria 4166
81 Ga0099795_10189171 3300007788 Bacteria 863
82 Ga0099795_10279302 3300007788 Bacteria 728
83 Ga0105240_10258092 3300009093 Unclassified 2012
84 Ga0105243_11494700 3300009148 Unclassified 699
85 Ga0105241_10749766 3300009174 Bacteria 895
86 Ga0105242_10335637 3300009176 Bacteria 1391
87 Ga0105248_10040055 3300009177 Bacteria 5251
88 Ga0105248_10580999 3300009177 Unclassified 1264
89 Ga0105248_10868266 3300009177 Unclassified 1018
90 Ga0105248_11025163 3300009177 Unclassified 932
91 Ga0105246_10270796 3300011119 Bacteria 1357
92 Ga0157369_10453401 3300013105 Unclassified 1328
93 Ga0157374_10476479 3300013296 Unclassified 1251
94 Ga0163162_10534702 3300013306 Unclassified 1301
95 Ga0157372_10017290 3300013307 Bacteria 7742
96 Ga0157372_10243500 3300013307 Unclassified 2087
97 Ga0157375_11180210 3300013308 Unclassified 898
98 Ga0163163_10790388 3300014325 Bacteria 1012
99 Ga0157379_10488558 3300014968 Unclassified 1140
100 Ga0157376_10386662 3300014969 Bacteria 1349
101 Ga0157376_10483877 3300014969 Unclassified 1213
102 Ga0157376_10726288 3300014969 Unclassified 1000
103 Ga0157376_10935733 3300014969 Bacteria 886
104 Ga0182007_10118862 3300015262 Unclassified 883
105 Ga0182005_1077192 3300015265 Unclassified 918
106 Ga0206356_11475613 3300020070 Unclassified 747
107 Ga0206352_10269300 3300020078 Unclassified 774
108 Ga0206352_10843737 3300020078 Unclassified 763
109 Ga0206350_10341510 3300020080 Bacteria 555
110 Ga0206354_10225987 3300020081 Unclassified 627
111 Ga0224712_10561377 3300022467 Unclassified 555
112 Ga0207656_10153135 3300025321 Bacteria 1093
113 Ga0207692_10014200 3300025898 Bacteria 3475
114 Ga0207692_10124447 3300025898 Bacteria 1448
115 Ga0207692_10437253 3300025898 Bacteria 821
116 Ga0207685_10277012 3300025905 Bacteria 822
117 Ga0207699_10030632 3300025906 Bacteria 3013
118 Ga0207699_10081237 3300025906 Bacteria 2010
119 Ga0207699_10402629 3300025906 Unclassified 975
120 Ga0207699_10441262 3300025906 Bacteria 932
121 Ga0207684_10000217 3300025910 Bacteria 88691
122 Ga0207684_10051067 3300025910 Bacteria 3508
123 Ga0207684_10128174 3300025910 Bacteria 2178
124 Ga0207707_10025022 3300025912 Bacteria 5223
125 Ga0207693_10000293 3300025915 Bacteria 46425
126 Ga0207693_10000518 3300025915 Bacteria 34795
127 Ga0207693_10044320 3300025915 Bacteria 3497
128 Ga0207693_10434194 3300025915 Bacteria 1027
129 Ga0207663_10009538 3300025916 Bacteria 5132
130 Ga0207663_10491624 3300025916 Bacteria 952
131 Ga0207663_11115351 3300025916 Unclassified 634
132 Ga0207646_10002663 3300025922 Bacteria 20942
133 Ga0207646_10239876 3300025922 Bacteria 1638
134 Ga0207646_11025354 3300025922 Bacteria 728
135 Ga0207700_10001797 3300025928 Bacteria 12185
136 Ga0207700_10026590 3300025928 Bacteria 4037
137 Ga0207700_10063812 3300025928 Bacteria 2803
138 Ga0207700_10376824 3300025928 Bacteria 1240
139 Ga0207700_10927567 3300025928 Unclassified 779
140 Ga0207700_11168404 3300025928 Bacteria 687
141 Ga0207664_10070923 3300025929 Bacteria 2805
142 Ga0207664_10090148 3300025929 Unclassified 2512
143 Ga0207644_10454846 3300025931 Unclassified 1052
144 Ga0207690_10266614 3300025932 Bacteria 1329
145 Ga0207686_10441765 3300025934 Bacteria 999
146 Ga0207670_10260444 3300025936 Bacteria 1344
147 Ga0207669_10315653 3300025937 Bacteria 1194
148 Ga0207665_10004163 3300025939 Bacteria 9626
149 Ga0207665_10012372 3300025939 Bacteria 5607
150 Ga0207665_10041335 3300025939 Bacteria 3078
151 Ga0207665_10225727 3300025939 Unclassified 1375
152 Ga0207665_10756603 3300025939 Bacteria 766
153 Ga0207711_10024493 3300025941 Bacteria 5059
154 Ga0207711_10311233 3300025941 Unclassified 1454
155 Ga0207667_11142894 3300025949 Bacteria 760
156 Ga0207651_10694963 3300025960 Unclassified 896
157 Ga0207640_10807205 3300025981 Unclassified 813
158 Ga0207677_11259560 3300026023 Unclassified 678
159 Ga0207703_10695639 3300026035 Unclassified 966
160 Ga0207702_10026982 3300026078 Bacteria 4769
161 Ga0207702_10106581 3300026078 Bacteria 2483
162 Ga0207641_10027106 3300026088 Bacteria 4732
163 Ga0207683_10009848 3300026121 Bacteria 8153
164 Ga0207683_11307303 3300026121 Bacteria 671
165 Ga0268266_10113196 3300028379 Bacteria 2406
166 Ga0268264_10116058 3300028381 Unclassified 2353
167 Ga0265338_10002988 3300028800 Bacteria 24499
168 Ga0265338_10077005 3300028800 Unclassified 2821
169 Ga0265762_1003423 3300030760 Bacteria 2842
170 Ga0265320_10013734 3300031240 Bacteria 4645
171 Ga0265325_10045501 3300031241 Unclassified 2280
172 Ga0265339_10039371 3300031249 Bacteria 2631
173 Ga0265316_10044874 3300031344 Bacteria 3513
174 Ga0307409_100745405 3300031995 Bacteria 983
175 Ga0307415_101340084 3300032126 Bacteria 679
176 Ga0316214_1006301 3300033545 Unclassified 1566
177 Ga0373926_0095778 3300035083 Bacteria 1107
178 Ga0373936_0026956 3300035113 Bacteria 2253
179 Ga0373956_0443389 3300035119 Unclassified 620
180 Ga0373943_0061818 3300035170 Bacteria 1873
181 Ga0373946_0415105 3300035171 Bacteria 681
182 Ga0373935_0044304 3300035692 Bacteria 2803
183 Ga0373935_0823330 3300035692 Bacteria 686
184 Ga0373927_0334609 3300035695 Bacteria 997
185 Ga0373947_0015398 3300035725 Bacteria 4389
186 Ga0373937_0726583 3300036401 Unclassified 940
187 Ga0373925_0015349 3300037068 Bacteria 5541
188 Ga0373925_0017554 3300037068 Bacteria 5189
189 Ga0373925_0324060 3300037068 Bacteria 1247
190 Ga0395905_1218579 3300037471 Unclassified 656
191 Ga0451577_1368416 3300042876 Bacteria 628
192 Ga0466967_0177745 3300045976 Unclassified 2006
193 Ga0495629_0484007 3300046459 Bacteria 836
194 Ga0495580_0000031 3300046472 Bacteria 76248
195 Ga0495580_0091684 3300046472 Bacteria 2115
196 Ga0495639_0449395 3300046475 Bacteria 654
197 Ga0495594_0513906 3300046499 Unclassified 680
198 Ga0495628_0288770 3300046516 Bacteria 1216
199 Ga0495665_0426404 3300046531 Bacteria 671
200 Ga0495598_0048695 3300046537 Bacteria 1268
201 Ga0495645_0177998 3300046543 Bacteria 1459
202 Ga0495645_0261943 3300046543 Bacteria 1144
203 Ga0495667_0273111 3300046559 Bacteria 1074
204 Ga0495658_0026201 3300046683 Bacteria 3123
205 Ga0495604_0355940 3300047317 Bacteria 972
206 Ga0495636_0032705 3300047318 Bacteria 2134
207 Ga0495674_0303852 3300047319 Bacteria 1303
208 Ga0495674_0430989 3300047319 Archaea 1061
209 Ga0495684_0339927 3300047471 Bacteria 1068
210 Ga0496102_0000349 3300048905 Bacteria 55942
211 Ga0496104_0387299 3300048907 Bacteria 1310
212 Ga0496115_0151313 3300048918 Bacteria 1916
213 Ga0501031_0480456 3300049568 Bacteria 802
214 Ga0501032_0002365 3300049569 Bacteria 14771
215 Ga0501034_0000046 3300049571 Bacteria 224049
216 Ga0501036_0305540 3300049572 Bacteria 1330
217 Ga0501037_0004086 3300049573 Bacteria 10578
218 Ga0501038_0005305 3300049574 Bacteria 11972
219 Ga0501039_0001779 3300049575 Bacteria 15929
220 Ga0501039_0220335 3300049575 Bacteria 1492
221 Ga0501040_0016619 3300049576 Bacteria 4876
222 Ga0501040_0053904 3300049576 Unclassified 2756
223 Ga0501041_0053864 3300049577 Bacteria 2454
224 Ga0501041_0079537 3300049577 Bacteria 2018
225 Ga0501042_0019189 3300049578 Bacteria 4745
226 Ga0501043_0063507 3300049579 Bacteria 2900
227 Ga0501043_0377237 3300049579 Bacteria 1074
228 Ga0501046_0000858 3300049580 Bacteria 29578
229 Ga0501046_0188440 3300049580 Bacteria 1539
230 Ga0501047_0000172 3300049581 Bacteria 79334
231 Ga0501048_0213254 3300049582 Bacteria 1369
232 Ga0501048_0394857 3300049582 Unclassified 988
233 Ga0501048_0520843 3300049582 Bacteria 853
234 Ga0501067_0000662 3300049583 Bacteria 18505
235 Ga0501068_0242662 3300049584 Bacteria 1147
236 Ga0501070_0097363 3300049586 Bacteria 2434
237 Ga0501071_0010144 3300049587 Bacteria 6303
238 Ga0501071_0056921 3300049587 Bacteria 2825
239 Ga0501072_0054150 3300049588 Bacteria 3160
240 Ga0501072_0990230 3300049588 Bacteria 655
241 Ga0501073_0262580 3300049589 Bacteria 1191
242 Ga0501073_0744515 3300049589 Bacteria 676
243 Ga0501074_0080958 3300049590 Bacteria 2329
244 Ga0501075_0021390 3300049591 Bacteria 4715
245 Ga0501075_0073525 3300049591 Bacteria 2585
246 Ga0501076_0019643 3300049592 Bacteria 5166
247 Ga0501076_0084596 3300049592 Unclassified 2548
248 Ga0501077_0065834 3300049593 Bacteria 2298
249 Ga0501077_0083478 3300049593 Unclassified 2024
250 Ga0501079_0018925 3300049741 Bacteria 5262
251 Ga0501079_0044586 3300049741 Bacteria 3422
252 Ga0501080_0000032 3300049742 Bacteria 86373
253 Ga0501080_0101676 3300049742 Bacteria 2667
254 Ga0501081_0001033 3300049743 Bacteria 16654
255 Ga0501081_0045083 3300049743 Unclassified 3028
256 Ga0501035_0004796 3300049822 Bacteria 12820
257 Ga0501035_0903241 3300049822 Bacteria 699
258 Ga0501044_0006856 3300049823 Bacteria 12554
259 Ga0501045_0077311 3300049824 Unclassified 2452
260 nmdc:mga0n895_3628_c1 3300050512 Bacteria 12475
261 nmdc:mga0rr50_18587_c1 3300050513 Bacteria 4672
262 nmdc:mga08x19_876468_c1 3300050514 Bacteria 638
263 Ga0495601_0054353 3300053077 Bacteria 2533
264 Ga0501084_0059073 3300054114 Bacteria 3209
265 Ga0587066_060197 3300059490 Unclassified 773
266 Ga0587070_115764 3300059491 Unclassified 635
267 Ga0587073_0246184 3300059492 Unclassified 558
268 Ga0587077_096599 3300059493 Unclassified 703
269 Ga0587082_105165 3300059504 Unclassified 620
270 Ga0587083_0171968 3300059505 Unclassified 600
271 Ga0587086_089480 3300059507 Unclassified 554
272 Ga0587089_059675 3300059509 Unclassified 628
273 Ga0587091_094506 3300059511 Unclassified 692
274 Ga0587067_107675 3300059640 Unclassified 654
275 Ga0587079_045341 3300059647 Unclassified 904
276 Ga0587060_023079 3300060243 Unclassified 603
277 Ga0501082_0128412 3300060353 Bacteria 2199
278 Ga0501082_0949709 3300060353 Unclassified 752
279 Ga0587107_040388
280 Ga0065707_10838190
281 Ga0070683_100682128
282 Ga0070666_10123802
283 Ga0068868_100866835
284 Ga0070689_100186088
285 Ga0070671_100210931
286 Ga0070674_100213792
287 Ga0070709_10002384
288 Ga0070709_10345375
289 Ga0070709_10593314
290 Ga0070714_100003287
291 Ga0070714_100182314
292 Ga0070713_100001535
293 Ga0070713_100015124
294 Ga0070713_100108622
295 Ga0070713_100357319
296 Ga0070710_10237536
297 Ga0070711_100000528
298 Ga0070711_100106627
299 Ga0070711_100158622
300 Ga0070711_100306308
301 Ga0070711_100450710
302 Ga0070711_101052869
303 Ga0070694_100000366
304 Ga0070708_100006197
305 Ga0070708_100087275
306 Ga0070708_100368996
307 Ga0070678_100007760
308 Ga0070706_100011903
309 Ga0070706_100060802
310 Ga0070707_100004065
311 Ga0070707_100200285
312 Ga0070707_100777102
313 Ga0070698_100003910
314 Ga0070699_100001386
315 Ga0070679_100066092
316 Ga0070697_100004806
317 Ga0068853_100188385
318 Ga0070665_100010116
319 Ga0068855_100189763
320 Ga0068855_102165453
321 Ga0070664_100693894
322 Ga0070664_101941943
323 Ga0068857_101240062
324 Ga0068856_100065372
325 Ga0068856_100111519
326 Ga0068856_100345978
327 Ga0068859_100337994
328 Ga0068864_100280496
329 Ga0068863_100050992
330 Ga0068860_100141234
331 Ga0070717_10013000
332 Ga0070717_10017304
333 Ga0070717_10026549
334 Ga0070717_10045564
335 Ga0070717_10058195
336 Ga0070717_10097204
337 Ga0070717_10138900
338 Ga0070717_10684899
339 Ga0070717_10777616
340 Ga0070717_11293112
341 Ga0070717_11406823
342 Ga0070715_10001467
343 Ga0070716_100005805
344 Ga0070716_100015421
345 Ga0070716_100168717
346 Ga0070716_100175871
347 Ga0070716_100193474
348 Ga0070712_100000329
349 Ga0070712_100000870
350 Ga0070712_100007185
351 Ga0070712_100384555
352 Ga0070712_100407787
353 Ga0070712_100822585
354 Ga0068871_100152274
355 Ga0068871_101051851
356 Ga0075434_100000708
357 Ga0097620_100337962
358 Ga0075435_100031730
359 Ga0099795_10189171
360 Ga0099795_10279302
361 Ga0105240_10258092
362 Ga0105243_11494700
363 Ga0105241_10749766
364 Ga0105242_10335637
365 Ga0105248_10040055
366 Ga0105248_10580999
367 Ga0105248_10868266
368 Ga0105248_11025163
369 Ga0105246_10270796
370 Ga0157369_10453401
371 Ga0157374_10476479
372 Ga0163162_10534702
373 Ga0157372_10017290
374 Ga0157372_10243500
375 Ga0157375_11180210
376 Ga0163163_10790388
377 Ga0157379_10488558
378 Ga0157376_10386662
379 Ga0157376_10483877
380 Ga0157376_10726288
381 Ga0157376_10935733
382 Ga0182007_10118862
383 Ga0182005_1077192
384 Ga0206356_11475613
385 Ga0206352_10269300
386 Ga0206352_10843737
387 Ga0206350_10341510
388 Ga0206354_10225987
389 Ga0224712_10561377
390 Ga0207656_10153135
391 Ga0207692_10014200
392 Ga0207692_10124447
393 Ga0207692_10437253
394 Ga0207685_10277012
395 Ga0207699_10030632
396 Ga0207699_10081237
397 Ga0207699_10402629
398 Ga0207699_10441262
399 Ga0207684_10000217
400 Ga0207684_10051067
401 Ga0207684_10128174
402 Ga0207707_10025022
403 Ga0207693_10000293
404 Ga0207693_10000518
405 Ga0207693_10044320
406 Ga0207693_10434194
407 Ga0207663_10009538
408 Ga0207663_10491624
409 Ga0207663_11115351
410 Ga0207646_10002663
411 Ga0207646_10239876
412 Ga0207646_11025354
413 Ga0207700_10001797
414 Ga0207700_10026590
415 Ga0207700_10063812
416 Ga0207700_10376824
417 Ga0207700_10927567
418 Ga0207700_11168404
419 Ga0207664_10070923
420 Ga0207664_10090148
421 Ga0207644_10454846
422 Ga0207690_10266614
423 Ga0207686_10441765
424 Ga0207670_10260444
425 Ga0207669_10315653
426 Ga0207665_10004163
427 Ga0207665_10012372
428 Ga0207665_10041335
429 Ga0207665_10225727
430 Ga0207665_10756603
431 Ga0207711_10024493
432 Ga0207711_10311233
433 Ga0207667_11142894
434 Ga0207651_10694963
435 Ga0207640_10807205
436 Ga0207677_11259560
437 Ga0207703_10695639
438 Ga0207702_10026982
439 Ga0207702_10106581
440 Ga0207641_10027106
441 Ga0207683_10009848
442 Ga0207683_11307303
443 Ga0268266_10113196
444 Ga0268264_10116058
445 Ga0265338_10002988
446 Ga0265338_10077005
447 Ga0265762_1003423
448 Ga0265320_10013734
449 Ga0265325_10045501
450 Ga0265339_10039371
451 Ga0265316_10044874
452 Ga0307409_100745405
453 Ga0307415_101340084
454 Ga0316214_1006301
455 Ga0373926_0095778
456 Ga0373936_0026956
457 Ga0373956_0443389
458 Ga0373943_0061818
459 Ga0373946_0415105
460 Ga0373935_0044304
461 Ga0373935_0823330
462 Ga0373927_0334609
463 Ga0373947_0015398
464 Ga0373937_0726583
465 Ga0373925_0015349
466 Ga0373925_0017554
467 Ga0373925_0324060
468 Ga0395905_1218579
469 Ga0451577_1368416
470 Ga0466967_0177745
471 Ga0495629_0484007
472 Ga0495580_0000031
473 Ga0495580_0091684
474 Ga0495639_0449395
475 Ga0495594_0513906
476 Ga0495628_0288770
477 Ga0495665_0426404
478 Ga0495598_0048695
479 Ga0495645_0177998
480 Ga0495645_0261943
481 Ga0495667_0273111
482 Ga0495658_0026201
483 Ga0495604_0355940
484 Ga0495636_0032705
485 Ga0495674_0303852
486 Ga0495674_0430989
487 Ga0495684_0339927
488 Ga0496102_0000349
489 Ga0496104_0387299
490 Ga0496115_0151313
491 Ga0501031_0480456
492 Ga0501032_0002365
493 Ga0501034_0000046
494 Ga0501036_0305540
495 Ga0501037_0004086
496 Ga0501038_0005305
497 Ga0501039_0001779
498 Ga0501039_0220335
499 Ga0501040_0016619
500 Ga0501040_0053904
501 Ga0501041_0053864
502 Ga0501041_0079537
503 Ga0501042_0019189
504 Ga0501043_0063507
505 Ga0501043_0377237
506 Ga0501046_0000858
507 Ga0501046_0188440
508 Ga0501047_0000172
509 Ga0501048_0213254
510 Ga0501048_0394857
511 Ga0501048_0520843
512 Ga0501067_0000662
513 Ga0501068_0242662
514 Ga0501070_0097363
515 Ga0501071_0010144
516 Ga0501071_0056921
517 Ga0501072_0054150
518 Ga0501072_0990230
519 Ga0501073_0262580
520 Ga0501073_0744515
521 Ga0501074_0080958
522 Ga0501075_0021390
523 Ga0501075_0073525
524 Ga0501076_0019643
525 Ga0501076_0084596
526 Ga0501077_0065834
527 Ga0501077_0083478
528 Ga0501079_0018925
529 Ga0501079_0044586
530 Ga0501080_0000032
531 Ga0501080_0101676
532 Ga0501081_0001033
533 Ga0501081_0045083
534 Ga0501035_0004796
535 Ga0501035_0903241
536 Ga0501044_0006856
537 Ga0501045_0077311
538 nmdc:mga0n895_3628_c1
539 nmdc:mga0rr50_18587_c1
540 nmdc:mga08x19_876468_c1
541 Ga0495601_0054353
542 Ga0501084_0059073
543 Ga0587066_060197
544 Ga0587070_115764
545 Ga0587073_0246184
546 Ga0587077_096599
547 Ga0587082_105165
548 Ga0587083_0171968
549 Ga0587086_089480
550 Ga0587089_059675
551 Ga0587091_094506
552 Ga0587067_107675
553 Ga0587079_045341
554 Ga0587060_023079
555 Ga0501082_0128412
556 Ga0501082_0949709

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

10

131

0.94

PF18029

Glyoxalase_6

Glyoxalase-like domain

15

132

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.8336 12 134
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.8204 12 135
1xy7-assembly1.cif.gz_B x-ray structure of gene product from arabidopsis thaliana at5g48480 0.8059 11 133
2p7q-assembly4.cif.gz_B crystal structure of e126q mutant of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and 1s,2s-dihydroxypropylphosphonic acid 0.8025 12 143
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.802 12 135
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9784 82 146 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.923 82 146 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8765 81 135 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8716 83 132 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8492 81 135 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A2T4VRD4-F1-model_v4 Glyoxalase 0.994 2 152
AF-B1N1Z5-F1-model_v4 deleted 0.9923 14 146
AF-A0A3M1P423-F1-model_v4 VOC family protein 0.992 4 152
AF-A0A5B8SXQ4-F1-model_v4 VOC family protein 0.9919 1 154
AF-A0A5C6BDK7-F1-model_v4 VOC domain-containing protein 0.9917 4 147

Map