F382693

General Info

Members Datasets Scaffolds Average Seq Length
278 173 556 257

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_11_c1|nmdc:mga08x19_11_c1_255478_256326
Length 282
Sequence LPQKSIAGNASMIKVLRLKMAARAIWKGKLEFDSTKVPVNLYSAVVDKSVHFHILEERTKTRVKQHMVNPETNEEVPNDEIQKGYQVEPGVFVILSEDELEKLQPKPSREIEITRFVAPERISSQWYDRPYYLGPDGDEKVYFALAEALANQQKEGIARWVMRGKEYVGALRSQDDYLMLVTLRHAEEVVSAKDLPEPGGRDLDKKEINMAKQLVELLEGEFEPAQFRDEYSERVMEFIEKKAKGSKPRLHVVHSKRGTSSVDKVLSKSIASLKKQKEKKAA

Samples

Sample ID Description Type Environment
1 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
134 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
135 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
136 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
151 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
152 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
153 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
154 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
155 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
156 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
157 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
158 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
163 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
164 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 2.88
Rhizosphere 96.76
Stem 0
Stem Tuber 0
Unclassified 25.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08x19_11_c1 3300050514 Bacteria 403007
2 Ga0065712_10001866 3300005290 Bacteria 7476
3 Ga0065715_10116865 3300005293 Unclassified 2366
4 Ga0065715_10271411 3300005293 Unclassified 1110
5 Ga0065707_10245645 3300005295 Unclassified 1141
6 Ga0070690_100008217 3300005330 Bacteria 6004
7 Ga0070670_100004786 3300005331 Bacteria 11369
8 Ga0070670_100279382 3300005331 Bacteria 1458
9 Ga0070666_10003159 3300005335 Bacteria 10007
10 Ga0070680_100112401 3300005336 Bacteria 2268
11 Ga0070680_100385454 3300005336 Bacteria 1194
12 Ga0070682_100162920 3300005337 Unclassified 1542
13 Ga0068868_100000353 3300005338 Bacteria 31108
14 Ga0070689_100002283 3300005340 Bacteria 12477
15 Ga0070687_100180027 3300005343 Bacteria 1265
16 Ga0070692_10016018 3300005345 Bacteria 3559
17 Ga0070669_100003399 3300005353 Bacteria 11455
18 Ga0070675_100747383 3300005354 Bacteria 892
19 Ga0070671_100001176 3300005355 Bacteria 19551
20 Ga0070673_100314859 3300005364 Unclassified 1381
21 Ga0070667_100057281 3300005367 Bacteria 3293
22 Ga0070703_10000045 3300005406 Bacteria 60137
23 Ga0070703_10024357 3300005406 Unclassified 1788
24 Ga0070709_10000002 3300005434 Bacteria 322903
25 Ga0070701_10009526 3300005438 Bacteria 4258
26 Ga0070711_100000062 3300005439 Bacteria 64492
27 Ga0070705_100000317 3300005440 Bacteria 28562
28 Ga0070705_100017296 3300005440 Bacteria 3762
29 Ga0070705_100358339 3300005440 Bacteria 1066
30 Ga0070700_100014141 3300005441 Bacteria 4503
31 Ga0070694_100497740 3300005444 Bacteria 969
32 Ga0070708_100024573 3300005445 Bacteria 5143
33 Ga0070708_100168290 3300005445 Bacteria 2045
34 Ga0070662_100039762 3300005457 Bacteria 3346
35 Ga0070681_10414911 3300005458 Unclassified 1258
36 Ga0070685_10141002 3300005466 Unclassified 1517
37 Ga0070706_100000166 3300005467 Bacteria 83921
38 Ga0070707_100112022 3300005468 Bacteria 2647
39 Ga0070707_100361723 3300005468 Bacteria 1410
40 Ga0070698_100057204 3300005471 Bacteria 3947
41 Ga0070698_100503886 3300005471 Bacteria 1148
42 Ga0070698_100536980 3300005471 Bacteria 1108
43 Ga0070699_100000122 3300005518 Bacteria 71533
44 Ga0070699_100041249 3300005518 Bacteria 3995
45 Ga0070699_100606188 3300005518 Unclassified 999
46 Ga0070697_100000240 3300005536 Bacteria 44334
47 Ga0070697_100053039 3300005536 Bacteria 3296
48 Ga0070672_100164395 3300005543 Unclassified 1843
49 Ga0070686_100061401 3300005544 Unclassified 2429
50 Ga0070695_100080353 3300005545 Bacteria 2155
51 Ga0070695_100089098 3300005545 Bacteria 2056
52 Ga0070695_100268328 3300005545 Bacteria 1249
53 Ga0070696_100000006 3300005546 Bacteria 109170
54 Ga0070696_100027225 3300005546 Bacteria 3893
55 Ga0070696_100126778 3300005546 Bacteria 1853
56 Ga0070696_100162992 3300005546 Unclassified 1644
57 Ga0070696_100297940 3300005546 Bacteria 1234
58 Ga0070693_100012791 3300005547 Unclassified 4257
59 Ga0070665_100051338 3300005548 Unclassified 4136
60 Ga0070665_100372896 3300005548 Unclassified 1434
61 Ga0070665_100499156 3300005548 Bacteria 1228
62 Ga0070704_100030541 3300005549 Bacteria 3611
63 Ga0070704_100030653 3300005549 Bacteria 3606
64 Ga0070704_100053777 3300005549 Bacteria 2847
65 Ga0070704_100085155 3300005549 Bacteria 2339
66 Ga0070704_100127068 3300005549 Bacteria 1969
67 Ga0070664_100006013 3300005564 Bacteria 9811
68 Ga0068857_100353217 3300005577 Bacteria 1361
69 Ga0068857_100434689 3300005577 Unclassified 1225
70 Ga0070702_100036581 3300005615 Bacteria 2721
71 Ga0068852_100052833 3300005616 Bacteria 3495
72 Ga0068859_100009121 3300005617 Bacteria 10016
73 Ga0068859_100014837 3300005617 Bacteria 7823
74 Ga0068859_100028447 3300005617 Bacteria 5603
75 Ga0068859_100039137 3300005617 Bacteria 4756
76 Ga0068859_100158088 3300005617 Bacteria 2345
77 Ga0068864_100006831 3300005618 Bacteria 9346
78 Ga0068864_100275377 3300005618 Bacteria 1569
79 Ga0068864_100322044 3300005618 Unclassified 1452
80 Ga0068861_100007908 3300005719 Bacteria 7315
81 Ga0068861_100054030 3300005719 Unclassified 3059
82 Ga0068870_10100261 3300005840 Unclassified 1635
83 Ga0068863_100005107 3300005841 Bacteria 12945
84 Ga0068863_100246629 3300005841 Bacteria 1724
85 Ga0068863_100319575 3300005841 Bacteria 1508
86 Ga0068863_100353565 3300005841 Bacteria 1431
87 Ga0068858_100004787 3300005842 Bacteria 13256
88 Ga0068858_100702263 3300005842 Bacteria 984
89 Ga0068860_100005867 3300005843 Bacteria 12359
90 Ga0068862_100071500 3300005844 Unclassified 2995
91 Ga0068862_100087655 3300005844 Bacteria 2707
92 Ga0068862_100099326 3300005844 Bacteria 2544
93 Ga0068862_100201317 3300005844 Bacteria 1795
94 Ga0068862_100374011 3300005844 Bacteria 1327
95 Ga0097621_100101865 3300006237 Unclassified 2417
96 Ga0068871_100006955 3300006358 Bacteria 8059
97 Ga0075428_100009924 3300006844 Bacteria 10576
98 Ga0075428_100012027 3300006844 Bacteria 9626
99 Ga0075430_100049152 3300006846 Bacteria 3560
100 Ga0075430_100311248 3300006846 Unclassified 1302
101 Ga0075431_100015714 3300006847 Bacteria 7675
102 Ga0075433_10336498 3300006852 Bacteria 1334
103 Ga0075429_100018873 3300006880 Bacteria 5975
104 Ga0075429_100033725 3300006880 Bacteria 4448
105 Ga0068865_100052854 3300006881 Unclassified 2817
106 Ga0075436_100000045 3300006914 Bacteria 76352
107 Ga0075436_100001041 3300006914 Bacteria 18693
108 Ga0075436_100080925 3300006914 Unclassified 2251
109 Ga0097620_100009121 3300006931 Bacteria 10016
110 Ga0097620_100014838 3300006931 Bacteria 7823
111 Ga0097620_100028446 3300006931 Bacteria 5603
112 Ga0097620_100039136 3300006931 Bacteria 4756
113 Ga0097620_100158087 3300006931 Bacteria 2345
114 Ga0075435_100009364 3300007076 Bacteria 7086
115 Ga0105240_10227288 3300009093 Bacteria 2171
116 Ga0111539_10033788 3300009094 Bacteria 6208
117 Ga0111539_10208859 3300009094 Unclassified 2275
118 Ga0111539_10261876 3300009094 Bacteria 2013
119 Ga0105245_10004296 3300009098 Bacteria 12622
120 Ga0105247_10008442 3300009101 Bacteria 6275
121 Ga0114129_10009315 3300009147 Bacteria 14009
122 Ga0114129_10097063 3300009147 Bacteria 4079
123 Ga0114129_10178711 3300009147 Bacteria 2889
124 Ga0114129_10306571 3300009147 Bacteria 2115
125 Ga0114129_10472145 3300009147 Bacteria 1642
126 Ga0114129_10479601 3300009147 Bacteria 1627
127 Ga0114129_10907763 3300009147 Bacteria 1116
128 Ga0105242_10230943 3300009176 Bacteria 1658
129 Ga0105248_10011956 3300009177 Bacteria 9572
130 Ga0105248_10018844 3300009177 Bacteria 7634
131 Ga0105248_10086475 3300009177 Unclassified 3528
132 Ga0105238_10010928 3300009551 Bacteria 9128
133 Ga0105249_10006769 3300009553 Bacteria 9988
134 Ga0105249_10285371 3300009553 Unclassified 1650
135 Ga0105239_10035556 3300010375 Bacteria 5470
136 Ga0105246_10004668 3300011119 Bacteria 8340
137 Ga0105246_10203659 3300011119 Bacteria 1540
138 Ga0157374_10004290 3300013296 Bacteria 11985
139 Ga0157378_10100976 3300013297 Bacteria 2635
140 Ga0157378_10157757 3300013297 Bacteria 2119
141 Ga0163162_10011838 3300013306 Bacteria 8509
142 Ga0157375_10003265 3300013308 Bacteria 14070
143 Ga0157375_10054268 3300013308 Bacteria 3947
144 Ga0163163_10001438 3300014325 Bacteria 20128
145 Ga0163163_10170064 3300014325 Unclassified 2226
146 Ga0163163_10417293 3300014325 Bacteria 1401
147 Ga0157380_10017453 3300014326 Bacteria 5311
148 Ga0157380_10081665 3300014326 Bacteria 2645
149 Ga0157380_10167416 3300014326 Unclassified 1916
150 Ga0157380_10454761 3300014326 Bacteria 1231
151 Ga0157379_10036495 3300014968 Bacteria 4382
152 Ga0157376_10016404 3300014969 Bacteria 5623
153 Ga0157376_10190823 3300014969 Bacteria 1879
154 Ga0163161_10402929 3300017792 Archaea 1097
155 Ga0207653_10000061 3300025885 Bacteria 83838
156 Ga0207653_10022116 3300025885 Unclassified 2019
157 Ga0207710_10099054 3300025900 Unclassified 1373
158 Ga0207699_10000001 3300025906 Bacteria 695560
159 Ga0207645_10049797 3300025907 Unclassified 2675
160 Ga0207684_10000073 3300025910 Bacteria 185361
161 Ga0207663_10000104 3300025916 Bacteria 40548
162 Ga0207681_10004742 3300025923 Bacteria 8366
163 Ga0207681_10302401 3300025923 Unclassified 1266
164 Ga0207650_10001945 3300025925 Bacteria 14535
165 Ga0207650_10137183 3300025925 Unclassified 1920
166 Ga0207650_10232565 3300025925 Bacteria 1487
167 Ga0207650_10318867 3300025925 Unclassified 1273
168 Ga0207659_10068027 3300025926 Bacteria 2590
169 Ga0207659_10108122 3300025926 Unclassified 2109
170 Ga0207687_10041735 3300025927 Bacteria 3152
171 Ga0207644_10009591 3300025931 Bacteria 6357
172 Ga0207706_10066931 3300025933 Bacteria 3161
173 Ga0207709_10351263 3300025935 Bacteria 1113
174 Ga0207670_10027739 3300025936 Bacteria 3585
175 Ga0207670_10097715 3300025936 Unclassified 2091
176 Ga0207704_10029409 3300025938 Bacteria 3064
177 Ga0207665_10064600 3300025939 Unclassified 2487
178 Ga0207711_10013270 3300025941 Bacteria 6846
179 Ga0207711_10122245 3300025941 Bacteria 2325
180 Ga0207661_10110508 3300025944 Unclassified 2324
181 Ga0207712_10044252 3300025961 Bacteria 3076
182 Ga0207677_10566435 3300026023 Bacteria 992
183 Ga0207703_10008437 3300026035 Bacteria 8142
184 Ga0207703_10215010 3300026035 Bacteria 1716
185 Ga0207708_10097317 3300026075 Bacteria 2274
186 Ga0207702_10291249 3300026078 Unclassified 1547
187 Ga0207641_10027312 3300026088 Bacteria 4713
188 Ga0207641_10213147 3300026088 Bacteria 1787
189 Ga0207648_10039460 3300026089 Bacteria 4152
190 Ga0207648_10464274 3300026089 Bacteria 1154
191 Ga0207674_10017796 3300026116 Bacteria 7747
192 Ga0207675_100018250 3300026118 Bacteria 6541
193 Ga0207675_100018589 3300026118 Bacteria 6485
194 Ga0207675_100173498 3300026118 Bacteria 2062
195 Ga0207675_100361551 3300026118 Bacteria 1424
196 Ga0207675_100702957 3300026118 Unclassified 1020
197 Ga0209970_1015853 3300027614 Bacteria 1255
198 Ga0207428_10024030 3300027907 Bacteria 5117
199 Ga0268266_10054135 3300028379 Unclassified 3448
200 Ga0268266_10363681 3300028379 Unclassified 1362
201 Ga0268265_10050474 3300028380 Bacteria 3135
202 Ga0268265_10065663 3300028380 Unclassified 2801
203 Ga0268264_10117149 3300028381 Bacteria 2342
204 Ga0307408_100093222 3300031548 Bacteria 2278
205 Ga0307408_100489250 3300031548 Unclassified 1075
206 Ga0307407_10112156 3300031903 Unclassified 1714
207 Ga0307412_10053519 3300031911 Bacteria 2676
208 Ga0307409_100334876 3300031995 Unclassified 1422
209 Ga0307416_100631077 3300032002 Unclassified 1154
210 Ga0307415_100109211 3300032126 Unclassified 2048
211 Ga0466959_0011287 3300045049 Bacteria 6413
212 Ga0495603_0443258 3300046455 Bacteria 744
213 Ga0495629_0133398 3300046459 Bacteria 1730
214 Ga0495598_0286775 3300046537 Unclassified 619
215 Ga0496101_0284041 3300048904 Bacteria 1294
216 Ga0496108_0026325 3300048911 Bacteria 4797
217 Ga0496109_0143730 3300048912 Unclassified 2231
218 Ga0496109_0602414 3300048912 Bacteria 1035
219 Ga0496112_0013922 3300048915 Bacteria 7441
220 Ga0496112_0189244 3300048915 Bacteria 2021
221 Ga0496113_0013406 3300048916 Bacteria 5553
222 Ga0496114_0000618 3300048917 Bacteria 26296
223 Ga0501291_004750 3300049514 Unclassified 1744
224 Ga0501292_007939 3300049515 Unclassified 1542
225 Ga0501298_001973 3300049521 Bacteria 3067
226 Ga0501298_042768 3300049521 Unclassified 922
227 Ga0501299_012033 3300049522 Unclassified 1471
228 Ga0501036_0025332 3300049572 Bacteria 5005
229 Ga0501036_0343455 3300049572 Unclassified 1247
230 Ga0501038_0001802 3300049574 Bacteria 19834
231 Ga0501039_0060476 3300049575 Bacteria 2934
232 Ga0501041_0035556 3300049577 Bacteria 3018
233 Ga0501042_0071346 3300049578 Unclassified 2485
234 Ga0501042_0230945 3300049578 Bacteria 1335
235 Ga0501043_0098759 3300049579 Unclassified 2295
236 Ga0501046_0090677 3300049580 Unclassified 2352
237 Ga0501048_0098506 3300049582 Bacteria 2062
238 Ga0501048_0133016 3300049582 Bacteria 1758
239 Ga0501071_0108621 3300049587 Bacteria 2049
240 Ga0501071_0264377 3300049587 Bacteria 1300
241 Ga0501072_0007046 3300049588 Bacteria 8534
242 Ga0501072_0214458 3300049588 Unclassified 1534
243 Ga0501073_0153390 3300049589 Bacteria 1597
244 Ga0501075_0011375 3300049591 Bacteria 6299
245 Ga0501076_0000332 3300049592 Bacteria 29226
246 Ga0501198_003906 3300049649 Bacteria 2057
247 Ga0501198_043967 3300049649 Unclassified 780
248 Ga0501199_003902 3300049650 Unclassified 1450
249 Ga0501230_058949 3300049667 Bacteria 774
250 Ga0501233_005554 3300049668 Bacteria 2344
251 Ga0501235_001704 3300049669 Bacteria 4715
252 Ga0501236_005849 3300049670 Bacteria 1497
253 Ga0501249_035430 3300049679 Unclassified 1122
254 Ga0501257_047908 3300049686 Unclassified 1061
255 Ga0501225_0011339 3300049705 Bacteria 2509
256 Ga0501079_0047402 3300049741 Unclassified 3315
257 Ga0501080_0031347 3300049742 Bacteria 4954
258 Ga0501081_0001524 3300049743 Bacteria 14217
259 Ga0501268_005710 3300049765 Unclassified 1798
260 Ga0501273_001142 3300049770 Bacteria 2439
261 Ga0501279_006211 3300049775 Unclassified 1577
262 Ga0501045_0010456 3300049824 Bacteria 6498
263 nmdc:mga05p37_100775_c1 3300050507 Unclassified 3557
264 nmdc:mga05p37_203303_c1 3300050507 Bacteria 2397
265 nmdc:mga05p37_576310_c1 3300050507 Bacteria 1275
266 nmdc:mga05p37_77088_c1 3300050507 Bacteria 4104
267 nmdc:mga09592_109872_c1 3300050508 Bacteria 2365
268 nmdc:mga09592_388607_c1 3300050508 Bacteria 1206
269 nmdc:mga09592_94288_c1 3300050508 Bacteria 2560
270 nmdc:mga08y16_182872_c1 3300050511 Unclassified 2176
271 nmdc:mga08y16_32781_c1 3300050511 Bacteria 5462
272 nmdc:mga08x19_8_c1 3300050514 Bacteria 427794
273 nmdc:mga0a205_32036_c1 3300050515 Bacteria 5039
274 nmdc:mga0a205_432626_c1 3300050515 Bacteria 1177
275 Ga0500641_0041548 3300053096 Bacteria 1861
276 Ga0501084_0660417 3300054114 Unclassified 883
277 Ga0501082_0027010 3300060353 Bacteria 4946
278 Ga0530510_0001411 3300061734 Bacteria 16097
279 nmdc:mga08x19_11_c1
280 Ga0065712_10001866
281 Ga0065715_10116865
282 Ga0065715_10271411
283 Ga0065707_10245645
284 Ga0070690_100008217
285 Ga0070670_100004786
286 Ga0070670_100279382
287 Ga0070666_10003159
288 Ga0070680_100112401
289 Ga0070680_100385454
290 Ga0070682_100162920
291 Ga0068868_100000353
292 Ga0070689_100002283
293 Ga0070687_100180027
294 Ga0070692_10016018
295 Ga0070669_100003399
296 Ga0070675_100747383
297 Ga0070671_100001176
298 Ga0070673_100314859
299 Ga0070667_100057281
300 Ga0070703_10000045
301 Ga0070703_10024357
302 Ga0070709_10000002
303 Ga0070701_10009526
304 Ga0070711_100000062
305 Ga0070705_100000317
306 Ga0070705_100017296
307 Ga0070705_100358339
308 Ga0070700_100014141
309 Ga0070694_100497740
310 Ga0070708_100024573
311 Ga0070708_100168290
312 Ga0070662_100039762
313 Ga0070681_10414911
314 Ga0070685_10141002
315 Ga0070706_100000166
316 Ga0070707_100112022
317 Ga0070707_100361723
318 Ga0070698_100057204
319 Ga0070698_100503886
320 Ga0070698_100536980
321 Ga0070699_100000122
322 Ga0070699_100041249
323 Ga0070699_100606188
324 Ga0070697_100000240
325 Ga0070697_100053039
326 Ga0070672_100164395
327 Ga0070686_100061401
328 Ga0070695_100080353
329 Ga0070695_100089098
330 Ga0070695_100268328
331 Ga0070696_100000006
332 Ga0070696_100027225
333 Ga0070696_100126778
334 Ga0070696_100162992
335 Ga0070696_100297940
336 Ga0070693_100012791
337 Ga0070665_100051338
338 Ga0070665_100372896
339 Ga0070665_100499156
340 Ga0070704_100030541
341 Ga0070704_100030653
342 Ga0070704_100053777
343 Ga0070704_100085155
344 Ga0070704_100127068
345 Ga0070664_100006013
346 Ga0068857_100353217
347 Ga0068857_100434689
348 Ga0070702_100036581
349 Ga0068852_100052833
350 Ga0068859_100009121
351 Ga0068859_100014837
352 Ga0068859_100028447
353 Ga0068859_100039137
354 Ga0068859_100158088
355 Ga0068864_100006831
356 Ga0068864_100275377
357 Ga0068864_100322044
358 Ga0068861_100007908
359 Ga0068861_100054030
360 Ga0068870_10100261
361 Ga0068863_100005107
362 Ga0068863_100246629
363 Ga0068863_100319575
364 Ga0068863_100353565
365 Ga0068858_100004787
366 Ga0068858_100702263
367 Ga0068860_100005867
368 Ga0068862_100071500
369 Ga0068862_100087655
370 Ga0068862_100099326
371 Ga0068862_100201317
372 Ga0068862_100374011
373 Ga0097621_100101865
374 Ga0068871_100006955
375 Ga0075428_100009924
376 Ga0075428_100012027
377 Ga0075430_100049152
378 Ga0075430_100311248
379 Ga0075431_100015714
380 Ga0075433_10336498
381 Ga0075429_100018873
382 Ga0075429_100033725
383 Ga0068865_100052854
384 Ga0075436_100000045
385 Ga0075436_100001041
386 Ga0075436_100080925
387 Ga0097620_100009121
388 Ga0097620_100014838
389 Ga0097620_100028446
390 Ga0097620_100039136
391 Ga0097620_100158087
392 Ga0075435_100009364
393 Ga0105240_10227288
394 Ga0111539_10033788
395 Ga0111539_10208859
396 Ga0111539_10261876
397 Ga0105245_10004296
398 Ga0105247_10008442
399 Ga0114129_10009315
400 Ga0114129_10097063
401 Ga0114129_10178711
402 Ga0114129_10306571
403 Ga0114129_10472145
404 Ga0114129_10479601
405 Ga0114129_10907763
406 Ga0105242_10230943
407 Ga0105248_10011956
408 Ga0105248_10018844
409 Ga0105248_10086475
410 Ga0105238_10010928
411 Ga0105249_10006769
412 Ga0105249_10285371
413 Ga0105239_10035556
414 Ga0105246_10004668
415 Ga0105246_10203659
416 Ga0157374_10004290
417 Ga0157378_10100976
418 Ga0157378_10157757
419 Ga0163162_10011838
420 Ga0157375_10003265
421 Ga0157375_10054268
422 Ga0163163_10001438
423 Ga0163163_10170064
424 Ga0163163_10417293
425 Ga0157380_10017453
426 Ga0157380_10081665
427 Ga0157380_10167416
428 Ga0157380_10454761
429 Ga0157379_10036495
430 Ga0157376_10016404
431 Ga0157376_10190823
432 Ga0163161_10402929
433 Ga0207653_10000061
434 Ga0207653_10022116
435 Ga0207710_10099054
436 Ga0207699_10000001
437 Ga0207645_10049797
438 Ga0207684_10000073
439 Ga0207663_10000104
440 Ga0207681_10004742
441 Ga0207681_10302401
442 Ga0207650_10001945
443 Ga0207650_10137183
444 Ga0207650_10232565
445 Ga0207650_10318867
446 Ga0207659_10068027
447 Ga0207659_10108122
448 Ga0207687_10041735
449 Ga0207644_10009591
450 Ga0207706_10066931
451 Ga0207709_10351263
452 Ga0207670_10027739
453 Ga0207670_10097715
454 Ga0207704_10029409
455 Ga0207665_10064600
456 Ga0207711_10013270
457 Ga0207711_10122245
458 Ga0207661_10110508
459 Ga0207712_10044252
460 Ga0207677_10566435
461 Ga0207703_10008437
462 Ga0207703_10215010
463 Ga0207708_10097317
464 Ga0207702_10291249
465 Ga0207641_10027312
466 Ga0207641_10213147
467 Ga0207648_10039460
468 Ga0207648_10464274
469 Ga0207674_10017796
470 Ga0207675_100018250
471 Ga0207675_100018589
472 Ga0207675_100173498
473 Ga0207675_100361551
474 Ga0207675_100702957
475 Ga0209970_1015853
476 Ga0207428_10024030
477 Ga0268266_10054135
478 Ga0268266_10363681
479 Ga0268265_10050474
480 Ga0268265_10065663
481 Ga0268264_10117149
482 Ga0307408_100093222
483 Ga0307408_100489250
484 Ga0307407_10112156
485 Ga0307412_10053519
486 Ga0307409_100334876
487 Ga0307416_100631077
488 Ga0307415_100109211
489 Ga0466959_0011287
490 Ga0495603_0443258
491 Ga0495629_0133398
492 Ga0495598_0286775
493 Ga0496101_0284041
494 Ga0496108_0026325
495 Ga0496109_0143730
496 Ga0496109_0602414
497 Ga0496112_0013922
498 Ga0496112_0189244
499 Ga0496113_0013406
500 Ga0496114_0000618
501 Ga0501291_004750
502 Ga0501292_007939
503 Ga0501298_001973
504 Ga0501298_042768
505 Ga0501299_012033
506 Ga0501036_0025332
507 Ga0501036_0343455
508 Ga0501038_0001802
509 Ga0501039_0060476
510 Ga0501041_0035556
511 Ga0501042_0071346
512 Ga0501042_0230945
513 Ga0501043_0098759
514 Ga0501046_0090677
515 Ga0501048_0098506
516 Ga0501048_0133016
517 Ga0501071_0108621
518 Ga0501071_0264377
519 Ga0501072_0007046
520 Ga0501072_0214458
521 Ga0501073_0153390
522 Ga0501075_0011375
523 Ga0501076_0000332
524 Ga0501198_003906
525 Ga0501198_043967
526 Ga0501199_003902
527 Ga0501230_058949
528 Ga0501233_005554
529 Ga0501235_001704
530 Ga0501236_005849
531 Ga0501249_035430
532 Ga0501257_047908
533 Ga0501225_0011339
534 Ga0501079_0047402
535 Ga0501080_0031347
536 Ga0501081_0001524
537 Ga0501268_005710
538 Ga0501273_001142
539 Ga0501279_006211
540 Ga0501045_0010456
541 nmdc:mga05p37_100775_c1
542 nmdc:mga05p37_203303_c1
543 nmdc:mga05p37_576310_c1
544 nmdc:mga05p37_77088_c1
545 nmdc:mga09592_109872_c1
546 nmdc:mga09592_388607_c1
547 nmdc:mga09592_94288_c1
548 nmdc:mga08y16_182872_c1
549 nmdc:mga08y16_32781_c1
550 nmdc:mga08x19_8_c1
551 nmdc:mga0a205_32036_c1
552 nmdc:mga0a205_432626_c1
553 Ga0500641_0041548
554 Ga0501084_0660417
555 Ga0501082_0027010
556 Ga0530510_0001411

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02735

Ku

Ku70/Ku80 beta-barrel domain

31

213

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8avx-assembly1.cif.gz_A cryo-em structure of drbphp in pfr state 0.6609 139 166
3x37-assembly1.cif.gz_B crystal structure of the n-terminal domain of sld7 in complex with sld3 0.654 91 167
8bot-assembly1.cif.gz_U cryo-em structure of nhej supercomplex(trimer) 0.6398 7 214
7nfe-assembly1.cif.gz_C cryo-em structure of nhej super-complex (monomer) 0.6286 1 232
5y58-assembly2.cif.gz_D crystal structure of ku70/80 and tlc1 0.6203 1 212
ID Description Score Start End Superfamily
af_Q8TC57_257_413_2.40.290.10 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.8292 92 176 2.40.290.10
af_P32807_339_451_2.40.290.10 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.7633 74 169 2.40.290.10
af_Q4DHP5_233_418_2.40.290.10 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.7427 8 186 2.40.290.10
af_Q75IP6_213_415_2.40.290.10 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.7347 4 184 2.40.290.10
6erfA02 Mainly Beta;Beta Barrel;Ku70; Chain: A; Domain 2; 0.7327 1 169 2.40.290.10
ID Description Score Start End GO Terms
AF-A0A7X7PLB5-F1-model_v4 Ku protein 0.8396 1 179 GO:0003690
GO:0006303
AF-A0A7X7PLB5-F1-model_v4 Ku protein 0.8354 1 179 GO:0003690
GO:0006303
AF-A0A2V6FSA4-F1-model_v4 Ku protein 0.8179 4 181 GO:0003690
GO:0006303
AF-A0A5S9M9T1-F1-model_v4 Ku domain-containing protein 0.8163 92 191 GO:0003690
GO:0006303
AF-A0A2V6FSA4-F1-model_v4 Ku protein 0.8099 4 181 GO:0003690
GO:0006303

Map