F382628

General Info

Members Datasets Scaffolds Average Seq Length
278 200 556 201

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0067046|Ga0496116_0067046_765_1487
Length 240
Sequence LKILQGVCAVIDALSFSPVGRSTGKKENAYSHKERGRTAVDHYYTSKPVSGRDTFRFQAELRGRNWTFLSDAGVFSKNGIDFGSTLLIETMEIPPEARVLDAGCGYGPIGLSAAVLAERGSVTMLDVNNRALELAKENAALNGVSNVRILESDTLSAVAGETFDCILTNPPIRAGKEVVHRIFTQAYDALAADGTLWVVIQKKQGSPSAWARLEELFGEGQVEEITKDKGYRIFRAMKKV

Samples

Sample ID Description Type Environment
1 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
12 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
13 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
14 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
15 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
16 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
17 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
18 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
19 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
22 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
24 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
25 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
27 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
33 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
34 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
35 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
36 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
37 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
38 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
39 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
40 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
41 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
42 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
43 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
44 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
45 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
46 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
47 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
48 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
49 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
50 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
51 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
52 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
53 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
54 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
55 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
56 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
57 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
58 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
59 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
60 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
61 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
62 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
63 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
85 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
86 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
87 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
88 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
89 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
90 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
91 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
92 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
93 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
94 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
95 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
96 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
97 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
98 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
99 2643221729 Bacillus sp. Root11 Isolate Unclassified
100 2643221730 Bacillus sp. Root131 Isolate Unclassified
101 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
102 2671180694 Paenibacillus sp. A3 Isolate Unclassified
103 2684622632 Bacillus cereus 905 Isolate Unclassified
104 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
105 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
106 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
107 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
108 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
109 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
110 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
111 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
112 2738541358 Bacillus sp. OV752 Isolate Unclassified
113 2738543006 Bacillus sp. OK077 Isolate Unclassified
114 2738543017 Bacillus sp. OV186 Isolate Unclassified
115 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
116 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
117 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
118 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
119 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
120 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
121 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
122 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
123 2802429420 Priestia filamentosa HL2HP6 Isolate Unclassified
124 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
125 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
126 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
127 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
128 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
129 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
130 2842682962 Bacillus sp. R-72492 Isolate Unclassified
131 2849139964 Bacillus sp. R-71875 Isolate Unclassified
132 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
133 2857581216 Bacillus sp. R-71922 Isolate Unclassified
134 2857586860 Bacillus sp. R-71935 Isolate Unclassified
135 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
136 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
137 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
138 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
139 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
140 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
141 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
142 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
143 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
144 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
145 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
146 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
147 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
148 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
149 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
150 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
151 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
152 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
153 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
154 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
155 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
156 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
157 2919720352 Priestia megaterium 4340 Isolate Unclassified
158 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
159 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
160 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
161 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
162 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
163 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
164 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
165 2938917290 Bacillus sp. CR71 Isolate Unclassified
166 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
167 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
168 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
169 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
170 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
171 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
172 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
173 2965761152 Bacillus sp. COPE52 Isolate Unclassified
174 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
175 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
176 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
177 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
178 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
179 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
180 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
181 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
182 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
183 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
184 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
185 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
186 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
187 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
188 8022792930 Bacillus sp. Xin Isolate Rhizosphere
189 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
190 8023438354 Bacillus sp. BH2 Isolate Unclassified
191 8023444577 Bacillus sp. BH32 Isolate Unclassified
192 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
193 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
194 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
195 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
196 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
197 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
198 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
199 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
200 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 50
Metatranscriptomes 7.91
Isolates 42.09

Biome Distribution

Category Percentage (%)
Aerial Root 0.72
Bulb 0
Endosphere 17.63
Nodule 0.72
Rhizoplane 2.52
Rhizosphere 42.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496116_0067046 3300048919 Bacteria 2294
2 JGI25159J45721_1030630 3300002987 Bacteria 872
3 JGI25151J46595_10004976 3300003187 Bacteria 6926
4 JGI25151J46595_10015464 3300003187 Bacteria 3361
5 JGI25151J46595_10019954 3300003187 Bacteria 2834
6 JGI25151J46595_10072818 3300003187 Bacteria 1032
7 JGI25151J46595_10074875 3300003187 Bacteria 1007
8 JGI25151J46595_10090603 3300003187 Bacteria 853
9 JGI25151J46595_10091937 3300003187 Bacteria 842
10 JGI25151J46595_10091967 3300003187 Bacteria 842
11 JGI25151J46595_10120821 3300003187 Bacteria 668
12 Ga0006562J51391_1000361 3300003578 Bacteria 31803
13 Ga0055538_1000081 3300003751 Bacteria 85159
14 Ga0055532_1000356 3300003758 Bacteria 24219
15 Ga0055532_1000639 3300003758 Bacteria 13542
16 Ga0055532_1011081 3300003758 Bacteria 1068
17 Ga0055536_1020848 3300003781 Bacteria 2009
18 Ga0055541_1000148 3300003841 Bacteria 34526
19 Ga0070676_10006452 3300005328 Bacteria 6271
20 Ga0070669_100087001 3300005353 Bacteria 2336
21 Ga0105251_10025620 3300009011 Bacteria 3013
22 Ga0105251_10091572 3300009011 Bacteria 1396
23 Ga0105251_10143098 3300009011 Bacteria 1082
24 Ga0105251_10143380 3300009011 Bacteria 1080
25 Ga0105244_10079371 3300009036 Bacteria 1627
26 Ga0105244_10151822 3300009036 Bacteria 1109
27 Ga0105244_10265211 3300009036 Bacteria 799
28 Ga0105244_10289860 3300009036 Bacteria 758
29 Ga0105250_10081124 3300009092 Bacteria 1315
30 Ga0105250_10099877 3300009092 Bacteria 1184
31 Ga0105250_10192222 3300009092 Bacteria 859
32 Ga0105243_10240378 3300009148 Bacteria 1611
33 Ga0105243_10432015 3300009148 Bacteria 1231
34 Ga0105249_10155455 3300009553 Bacteria 2205
35 Ga0105246_10025917 3300011119 Bacteria 3824
36 Ga0105246_10069223 3300011119 Bacteria 2478
37 Ga0157371_10005050 3300013102 Bacteria 11283
38 Ga0209784_100044 3300025224 Bacteria 206858
39 Ga0209784_100141 3300025224 Bacteria 67045
40 Ga0209784_101794 3300025224 Bacteria 2518
41 Ga0209566_100531 3300025225 Bacteria 25949
42 Ga0209147_100198 3300025229 Bacteria 67714
43 Ga0209147_100210 3300025229 Bacteria 62804
44 Ga0209147_100385 3300025229 Bacteria 30752
45 Ga0209437_100331 3300025233 Bacteria 58796
46 Ga0209258_101597 3300025242 Bacteria 7466
47 Ga0209130_1010542 3300025284 Bacteria 2539
48 Ga0209130_1022318 3300025284 Bacteria 1414
49 Ga0209130_1023522 3300025284 Bacteria 1358
50 Ga0209130_1047385 3300025284 Bacteria 798
51 Ga0209675_1009083 3300025291 Bacteria 3553
52 Ga0209675_1064446 3300025291 Bacteria 714
53 Ga0209676_1002029 3300025292 Bacteria 15879
54 Ga0209676_1019743 3300025292 Bacteria 2309
55 Ga0209676_1031207 3300025292 Bacteria 1619
56 Ga0209025_1000976 3300025294 Bacteria 42839
57 Ga0209025_1001468 3300025294 Bacteria 30750
58 Ga0209025_1005659 3300025294 Bacteria 10066
59 Ga0209025_1010002 3300025294 Bacteria 6499
60 Ga0209025_1012291 3300025294 Bacteria 5511
61 Ga0209025_1016387 3300025294 Bacteria 4378
62 Ga0209025_1021451 3300025294 Bacteria 3478
63 Ga0209025_1022832 3300025294 Bacteria 3299
64 Ga0209025_1081841 3300025294 Bacteria 1093
65 Ga0209025_1088873 3300025294 Bacteria 1017
66 Ga0209025_1098246 3300025294 Bacteria 935
67 Ga0209025_1102412 3300025294 Bacteria 902
68 Ga0209025_1105679 3300025294 Bacteria 878
69 Ga0209025_1120280 3300025294 Bacteria 785
70 Ga0209025_1124168 3300025294 Bacteria 764
71 Ga0207696_1012373 3300025711 Bacteria 3019
72 Ga0207696_1045848 3300025711 Bacteria 1263
73 Ga0207655_1002102 3300025728 Bacteria 16693
74 Ga0207655_1022346 3300025728 Bacteria 3174
75 Ga0207713_1030881 3300025735 Bacteria 2379
76 Ga0207713_1098291 3300025735 Bacteria 1015
77 Ga0207713_1107941 3300025735 Bacteria 951
78 Ga0207681_10273408 3300025923 Bacteria 1327
79 Ga0207709_10036548 3300025935 Bacteria 2911
80 Ga0209984_1002402 3300027424 Bacteria 2090
81 Ga0209970_1002684 3300027614 Bacteria 3012
82 Ga0237817_10339 3300030083 Bacteria 8841
83 Ga0395899_0227440 3300037312 Bacteria 1289
84 Ga0395899_0314032 3300037312 Bacteria 1057
85 Ga0237819_01772 3300038705 Bacteria 5057
86 Ga0439439_0000067 3300041406 Bacteria 13420
87 Ga0439433_0001691 3300041999 Bacteria 4600
88 Ga0439449_0001598 3300042007 Bacteria 8885
89 Ga0439457_012240 3300042014 Bacteria 1935
90 Ga0439462_0000024 3300042015 Bacteria 23158
91 Ga0466961_0054088 3300044693 Bacteria 2561
92 Ga0466959_0007769 3300045049 Bacteria 7544
93 Ga0466967_0016145 3300045976 Bacteria 5879
94 Ga0495627_121519 3300046453 Bacteria 737
95 Ga0495605_0219504 3300046474 Bacteria 822
96 Ga0495661_0214217 3300046665 Bacteria 1001
97 Ga0495681_0013192 3300047470 Bacteria 4810
98 Ga0495626_0005967 3300048091 Bacteria 7008
99 Ga0496102_0004480 3300048905 Bacteria 11790
100 Ga0496102_0088719 3300048905 Bacteria 2860
101 Ga0496102_0716217 3300048905 Bacteria 924
102 Ga0496109_0328935 3300048912 Bacteria 1443
103 Ga0496110_0017564 3300048913 Bacteria 5983
104 Ga0496116_0013794 3300048919 Bacteria 6489
105 Ga0496116_0036570 3300048919 Bacteria 3433
106 Ga0496116_0053471 3300048919 Bacteria 2666
107 Ga0496116_0057355 3300048919 Bacteria 2547
108 Ga0496116_0077492 3300048919 Bacteria 2076
109 Ga0496116_0126369 3300048919 Bacteria 1468
110 Ga0496116_0223632 3300048919 Bacteria 962
111 Ga0496117_0006150 3300048920 Bacteria 12269
112 Ga0496117_0098364 3300048920 Bacteria 1860
113 Ga0496118_0092929 3300048921 Bacteria 2068
114 Ga0496119_0000469 3300048922 Bacteria 54992
115 Ga0496120_0003209 3300048923 Bacteria 15193
116 Ga0496120_0022491 3300048923 Bacteria 3965
117 Ga0496120_0055412 3300048923 Bacteria 2242
118 Ga0496121_0102972 3300048924 Bacteria 2198
119 Ga0496121_0114770 3300048924 Bacteria 2046
120 Ga0496121_0213861 3300048924 Bacteria 1363
121 Ga0496121_0489654 3300048924 Bacteria 783
122 Ga0496122_0039963 3300048925 Bacteria 3735
123 Ga0496122_0040959 3300048925 Bacteria 3671
124 Ga0496122_0061228 3300048925 Bacteria 2764
125 Ga0496122_0112236 3300048925 Bacteria 1785
126 Ga0496122_0229323 3300048925 Bacteria 1057
127 Ga0496123_0004884 3300048926 Bacteria 13780
128 Ga0496123_0070593 3300048926 Bacteria 2185
129 Ga0496123_0157889 3300048926 Bacteria 1213
130 Ga0496124_0000697 3300048927 Bacteria 55040
131 Ga0496124_0001155 3300048927 Bacteria 41411
132 Ga0496124_0087228 3300048927 Bacteria 2552
133 Ga0496124_0410257 3300048927 Bacteria 937
134 Ga0496125_0001389 3300048928 Bacteria 35441
135 Ga0496125_0008374 3300048928 Bacteria 10841
136 Ga0496125_0010954 3300048928 Bacteria 9110
137 Ga0496125_0233981 3300048928 Bacteria 1172
138 Ga0496126_0006535 3300048929 Bacteria 12978
139 Ga0496126_0015018 3300048929 Bacteria 7806
140 Ga0496126_0055930 3300048929 Bacteria 3567
141 Ga0501343_000789 3300049132 Bacteria 1985
142 Ga0501305_000036 3300049161 Bacteria 7597
143 Ga0501311_000004 3300049527 Bacteria 9566
144 Ga0501312_000006 3300049528 Bacteria 10477
145 Ga0501313_000080 3300049529 Bacteria 4457
146 Ga0501316_000029 3300049532 Bacteria 5933
147 Ga0501317_000015 3300049533 Bacteria 8499
148 Ga0501318_000024 3300049534 Bacteria 6225
149 Ga0501319_000019 3300049535 Bacteria 5995
150 Ga0501320_000614 3300049536 Bacteria 2187
151 Ga0501321_000032 3300049537 Bacteria 6962
152 Ga0501322_000093 3300049538 Bacteria 3419
153 Ga0501323_000031 3300049539 Bacteria 6387
154 Ga0501326_00617 3300049542 Bacteria 1464
155 Ga0501327_00584 3300049543 Bacteria 1526
156 Ga0501330_000008 3300049546 Bacteria 6041
157 Ga0501332_00020 3300049548 Bacteria 4348
158 Ga0501334_00027 3300049550 Bacteria 4527
159 Ga0501335_000302 3300049551 Bacteria 2914
160 Ga0501337_001523 3300049553 Bacteria 1333
161 Ga0501338_01082 3300049554 Bacteria 1390
162 2511180921 2510917027 Bacteria 5287437
163 2512635727 2512564013 Bacteria 6286191
164 2512736539 2512564039 Bacteria 8739048
165 2524189986 2524023129 Bacteria 6762600
166 2550903203 2548877040 Bacteria 7507281
167 2553395063 2551306519 Bacteria 5465154
168 2556065807 2554235469 Bacteria 3590176
169 2571530823 2571042143 Bacteria 6986194
170 2578338899 2576861424 Bacteria 5270569
171 2580934711 2579778775 Bacteria 5360914
172 2595092259 2593339131 Bacteria 5116855
173 2595320885 2593339198 Bacteria 7267884
174 2601641739 2600255286 Bacteria 5390125
175 2621273310 2619619294 Bacteria 5575484
176 2643738829 2643221543 Bacteria 6628015
177 2644705743 2643221729 Bacteria 6621700
178 2644713264 2643221730 Bacteria 6523787
179 2672333576 2671180330 Bacteria 5521719
180 2673821709 2671180694 Bacteria 7506943
181 2685148220 2684622632 Bacteria 5380049
182 2698319646 2695420987 Bacteria 6152737
183 2705991995 2703719227 Bacteria 5631989
184 2712198855 2711768088 Bacteria 3195027
185 2721503423 2718218445 Bacteria 5113413
186 2723606207 2721755693 Bacteria 6126117
187 2728529876 2728368933 Bacteria 7044283
188 2730136830 2728369359 Bacteria 5621728
189 2738838982 2738541299 Bacteria 4020721
190 2739160152 2738541358 Bacteria 5932299
191 2739212626 2738543006 Bacteria 5904091
192 2739271680 2738543017 Bacteria 4271950
193 2745170160 2744054657 Bacteria 5016802
194 2753813093 2751185905 Bacteria 6142767
195 2757568894 2757320391 Bacteria 4746095
196 2777764221 2775507177 Bacteria 4384303
197 2777837296 2775507192 Bacteria 4622234
198 2791215894 2788500588 Bacteria 4584915
199 2793182087 2791355222 Bacteria 5898266
200 2802440711 2802428803 Bacteria 5806948
201 2805348318 2802429420 Bacteria 845479
202 2816866391 2816332186 Bacteria 5331395
203 2817616442 2816332336 Bacteria 5207640
204 2819585024 2818991443 Bacteria 6598732
205 2819627564 2818991451 Bacteria 4697364
206 2821118308 2821111986 Bacteria 6894338
207 2831907797 2831905167 Bacteria 3319172
208 2842688263 2842682962 Bacteria 5589973
209 2849144957 2849139964 Bacteria 5613304
210 2857472339 2857465823 Bacteria 6772595
211 2857586495 2857581216 Bacteria 5522813
212 2857590968 2857586860 Bacteria 4354574
213 2857597795 2857591370 Bacteria 6569758
214 2857608881 2857604169 Bacteria 5111450
215 2857613408 2857609550 Bacteria 3753890
216 2864738884 2864733723 Bacteria 6770668
217 2865002010 2864997549 Bacteria 5139696
218 2865007628 2865002811 Bacteria 6333767
219 2881639856 2881636855 Bacteria 5205297
220 2881646622 2881644220 Bacteria 5302661
221 2885529928 2885526491 Bacteria 7164189
222 2888584474 2888578766 Bacteria 6743310
223 2889048022 2889042446 Bacteria 7618936
224 2889053079 2889049205 Bacteria 7524325
225 2889276760 2889276214 Bacteria 5979355
226 2904168141 2904162308 Bacteria 7086713
227 2904496962 2904490793 Bacteria 7046938
228 2904600767 2904595352 Bacteria 6124848
229 2904610114 2904606771 Bacteria 4684500
230 2907208213 2907202186 Bacteria 6632024
231 2915598691 2915597211 Bacteria 6475886
232 2915609985 2915606848 Bacteria 6032732
233 2916972065 2916971899 Bacteria 4250608
234 2919166235 2919160200 Bacteria 6929020
235 2919726425 2919720352 Bacteria 5986006
236 2925332825 2925326138 Bacteria 9652120
237 2929183837 2929183550 Bacteria 6377511
238 2929211895 2929206907 Bacteria 5918291
239 2929233250 2929233124 Bacteria 5948380
240 2931385128 2931384279 Bacteria 7299545
241 2936343047 2936340661 Bacteria 5139038
242 2938653403 2938649242 Bacteria 7118381
243 2938917420 2938917290 Bacteria 5914775
244 2939596158 2939593269 Bacteria 4798695
245 2939685110 2939679117 Bacteria 6921672
246 2939707590 2939702853 Bacteria 5139229
247 2945996249 2945991243 Bacteria 7008369
248 2946058939 2946053406 Bacteria 6978655
249 2947426718 2947426588 Bacteria 5357194
250 2956900786 2956897341 Bacteria 5447711
251 2965761278 2965761152 Bacteria 5806513
252 2968562380 2968558590 Bacteria 6956864
253 2971406739 2971403814 Bacteria 7370929
254 2971513775 2971511577 Bacteria 5404012
255 2979083728 2979083700 Bacteria 5894929
256 2980128562 2980125574 Bacteria 5567337
257 2980179428 2980176882 Bacteria 5397533
258 2984531174 2984527788 Bacteria 5288478
259 2984537283 2984532647 Bacteria 5288506
260 2988229887 2988225383 Bacteria 7221625
261 2996636926 2996632988 Bacteria 6921523
262 2996707498 2996706504 Bacteria 5757485
263 3006828898 3006826541 Bacteria 4678913
264 648172201 648028048 Bacteria 5394884
265 8022621203 8022621104 Bacteria 5241040
266 8022799043 8022792930 Bacteria 5693794
267 8022950783 8022948649 Bacteria 5366783
268 8023439799 8023438354 Bacteria 5779374
269 8023447378 8023444577 Bacteria 5661597
270 8054471327 8054465665 Bacteria 7323556
271 8054802008 8054795415 Bacteria 9785225
272 8055537112 8055531788 Bacteria 5249694
273 8055634032 8055632911 Bacteria 5283357
274 8056535622 8056533031 Bacteria 8964429
275 8057473396 8057473075 Bacteria 5892720
276 8057582785 8057582654 Bacteria 5218944
277 8057735155 8057733483 Bacteria 6578323
278 8057979859 8057977335 Bacteria 5694872
279 Ga0496116_0067046
280 JGI25159J45721_1030630
281 JGI25151J46595_10004976
282 JGI25151J46595_10015464
283 JGI25151J46595_10019954
284 JGI25151J46595_10072818
285 JGI25151J46595_10074875
286 JGI25151J46595_10090603
287 JGI25151J46595_10091937
288 JGI25151J46595_10091967
289 JGI25151J46595_10120821
290 Ga0006562J51391_1000361
291 Ga0055538_1000081
292 Ga0055532_1000356
293 Ga0055532_1000639
294 Ga0055532_1011081
295 Ga0055536_1020848
296 Ga0055541_1000148
297 Ga0070676_10006452
298 Ga0070669_100087001
299 Ga0105251_10025620
300 Ga0105251_10091572
301 Ga0105251_10143098
302 Ga0105251_10143380
303 Ga0105244_10079371
304 Ga0105244_10151822
305 Ga0105244_10265211
306 Ga0105244_10289860
307 Ga0105250_10081124
308 Ga0105250_10099877
309 Ga0105250_10192222
310 Ga0105243_10240378
311 Ga0105243_10432015
312 Ga0105249_10155455
313 Ga0105246_10025917
314 Ga0105246_10069223
315 Ga0157371_10005050
316 Ga0209784_100044
317 Ga0209784_100141
318 Ga0209784_101794
319 Ga0209566_100531
320 Ga0209147_100198
321 Ga0209147_100210
322 Ga0209147_100385
323 Ga0209437_100331
324 Ga0209258_101597
325 Ga0209130_1010542
326 Ga0209130_1022318
327 Ga0209130_1023522
328 Ga0209130_1047385
329 Ga0209675_1009083
330 Ga0209675_1064446
331 Ga0209676_1002029
332 Ga0209676_1019743
333 Ga0209676_1031207
334 Ga0209025_1000976
335 Ga0209025_1001468
336 Ga0209025_1005659
337 Ga0209025_1010002
338 Ga0209025_1012291
339 Ga0209025_1016387
340 Ga0209025_1021451
341 Ga0209025_1022832
342 Ga0209025_1081841
343 Ga0209025_1088873
344 Ga0209025_1098246
345 Ga0209025_1102412
346 Ga0209025_1105679
347 Ga0209025_1120280
348 Ga0209025_1124168
349 Ga0207696_1012373
350 Ga0207696_1045848
351 Ga0207655_1002102
352 Ga0207655_1022346
353 Ga0207713_1030881
354 Ga0207713_1098291
355 Ga0207713_1107941
356 Ga0207681_10273408
357 Ga0207709_10036548
358 Ga0209984_1002402
359 Ga0209970_1002684
360 Ga0237817_10339
361 Ga0395899_0227440
362 Ga0395899_0314032
363 Ga0237819_01772
364 Ga0439439_0000067
365 Ga0439433_0001691
366 Ga0439449_0001598
367 Ga0439457_012240
368 Ga0439462_0000024
369 Ga0466961_0054088
370 Ga0466959_0007769
371 Ga0466967_0016145
372 Ga0495627_121519
373 Ga0495605_0219504
374 Ga0495661_0214217
375 Ga0495681_0013192
376 Ga0495626_0005967
377 Ga0496102_0004480
378 Ga0496102_0088719
379 Ga0496102_0716217
380 Ga0496109_0328935
381 Ga0496110_0017564
382 Ga0496116_0013794
383 Ga0496116_0036570
384 Ga0496116_0053471
385 Ga0496116_0057355
386 Ga0496116_0077492
387 Ga0496116_0126369
388 Ga0496116_0223632
389 Ga0496117_0006150
390 Ga0496117_0098364
391 Ga0496118_0092929
392 Ga0496119_0000469
393 Ga0496120_0003209
394 Ga0496120_0022491
395 Ga0496120_0055412
396 Ga0496121_0102972
397 Ga0496121_0114770
398 Ga0496121_0213861
399 Ga0496121_0489654
400 Ga0496122_0039963
401 Ga0496122_0040959
402 Ga0496122_0061228
403 Ga0496122_0112236
404 Ga0496122_0229323
405 Ga0496123_0004884
406 Ga0496123_0070593
407 Ga0496123_0157889
408 Ga0496124_0000697
409 Ga0496124_0001155
410 Ga0496124_0087228
411 Ga0496124_0410257
412 Ga0496125_0001389
413 Ga0496125_0008374
414 Ga0496125_0010954
415 Ga0496125_0233981
416 Ga0496126_0006535
417 Ga0496126_0015018
418 Ga0496126_0055930
419 Ga0501343_000789
420 Ga0501305_000036
421 Ga0501311_000004
422 Ga0501312_000006
423 Ga0501313_000080
424 Ga0501316_000029
425 Ga0501317_000015
426 Ga0501318_000024
427 Ga0501319_000019
428 Ga0501320_000614
429 Ga0501321_000032
430 Ga0501322_000093
431 Ga0501323_000031
432 Ga0501326_00617
433 Ga0501327_00584
434 Ga0501330_000008
435 Ga0501332_00020
436 Ga0501334_00027
437 Ga0501335_000302
438 Ga0501337_001523
439 Ga0501338_01082
440 2511180921
441 2512635727
442 2512736539
443 2524189986
444 2550903203
445 2553395063
446 2556065807
447 2571530823
448 2578338899
449 2580934711
450 2595092259
451 2595320885
452 2601641739
453 2621273310
454 2643738829
455 2644705743
456 2644713264
457 2672333576
458 2673821709
459 2685148220
460 2698319646
461 2705991995
462 2712198855
463 2721503423
464 2723606207
465 2728529876
466 2730136830
467 2738838982
468 2739160152
469 2739212626
470 2739271680
471 2745170160
472 2753813093
473 2757568894
474 2777764221
475 2777837296
476 2791215894
477 2793182087
478 2802440711
479 2805348318
480 2816866391
481 2817616442
482 2819585024
483 2819627564
484 2821118308
485 2831907797
486 2842688263
487 2849144957
488 2857472339
489 2857586495
490 2857590968
491 2857597795
492 2857608881
493 2857613408
494 2864738884
495 2865002010
496 2865007628
497 2881639856
498 2881646622
499 2885529928
500 2888584474
501 2889048022
502 2889053079
503 2889276760
504 2904168141
505 2904496962
506 2904600767
507 2904610114
508 2907208213
509 2915598691
510 2915609985
511 2916972065
512 2919166235
513 2919726425
514 2925332825
515 2929183837
516 2929211895
517 2929233250
518 2931385128
519 2936343047
520 2938653403
521 2938917420
522 2939596158
523 2939685110
524 2939707590
525 2945996249
526 2946058939
527 2947426718
528 2956900786
529 2965761278
530 2968562380
531 2971406739
532 2971513775
533 2979083728
534 2980128562
535 2980179428
536 2984531174
537 2984537283
538 2988229887
539 2996636926
540 2996707498
541 3006828898
542 648172201
543 8022621203
544 8022799043
545 8022950783
546 8023439799
547 8023447378
548 8054471327
549 8054802008
550 8055537112
551 8055634032
552 8056535622
553 8057473396
554 8057582785
555 8057735155
556 8057979859

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05175

MTS

Methyltransferase small domain

65

235

0.98

PF13649

Methyltransf_25

Methyltransferase domain

99

194

0.9

PF02475

Met_10

Met-10+ like-protein

87

196

0.85

PF08241

Methyltransf_11

Methyltransferase domain

100

198

0.83

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

84

226

0.81

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

83

209

0.79

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

87

223

0.77

PF13847

Methyltransf_31

Methyltransferase domain

93

237

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dus-assembly1.cif.gz_A mj0882-a hypothetical protein from m. jannaschii 0.9005 20 213
6h1e-assembly1.cif.gz_A crystal structure of c21orf127-trmt112 in complex with sah and h4 peptide 0.8995 74 212
1dus-assembly1.cif.gz_A mj0882-a hypothetical protein from m. jannaschii 0.896 20 213
4dcm-assembly1.cif.gz_A crystal structure of methyltransferase rlmg modifying g1835 of 23s rrna in escherichia coli 0.8849 32 213
1t43-assembly1.cif.gz_A crystal structure analysis of e.coli protein (n5)-glutamine methyltransferase (hemk) 0.8703 62 213
ID Description Score Start End Superfamily
af_Q2G0N7_5_202_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9522 20 213 3.40.50.150
af_Q4E3J0_145_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9399 74 126 3.40.50.150
af_Q2G0N7_5_202_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9289 20 213 3.40.50.150
af_Q8I3G1_737_866_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9033 73 145 3.40.50.150
1dusA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8976 20 213 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A0R1QLX0-F1-model_v4 deleted 0.9813 91 213
AF-A0A656Z2K1-F1-model_v4 deleted 0.9747 87 213
AF-A0A143Z6M0-F1-model_v4 S-adenosyl-l-methionine-dependent methyltransferase 0.9726 15 213 GO:0008757
GO:0032259
AF-E2YWC6-F1-model_v4 deleted 0.9684 115 213
AF-A0A3A1QUH0-F1-model_v4 Class I SAM-dependent methyltransferase 0.9678 15 212 GO:0008757
GO:0032259

Map