F382610

General Info

Members Datasets Scaffolds Average Seq Length
278 226 556 143

Family's Representative Sequence

Representative Sequence 3300046810|Ga0495660_0225914|Ga0495660_0225914_280_792
Length 170
Sequence MSKRKVTIIIVKGGVYMHFHSPSSLLSAAPSNWFMNSIAFWTFLLLGCMCIGGYFMFRKFLKVLPKADGKSKLDWQNYWVERSRPLWSDEMKAFLDQLVQPVPGPFRDIAKHSIAAEIGRIAVESNAPEVTREHCIKGYIIATPRRDNRFLVTFLEKNGIDYTPYKHLVK

Samples

Sample ID Description Type Environment
1 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
14 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
15 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
16 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
17 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
18 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
19 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
22 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
23 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
24 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
26 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
27 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
28 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
34 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
35 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
36 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
37 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
38 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
39 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
40 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
41 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
42 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
43 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
44 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
45 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
46 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
47 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
48 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
49 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
50 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
51 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
52 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
53 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
54 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
55 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
56 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
57 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
58 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
59 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
60 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
61 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
62 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
63 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
64 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
65 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
66 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
67 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
68 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
69 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
70 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
71 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
72 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
73 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
74 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
75 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
77 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
78 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
79 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
80 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
81 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
82 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
83 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
84 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
85 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
86 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
87 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
88 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
89 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
90 2554235283 Bacillus safensis VK Isolate Rhizosphere
91 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
92 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
93 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
94 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
95 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
96 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
97 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
98 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
99 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
100 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
101 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
102 2643221729 Bacillus sp. Root11 Isolate Unclassified
103 2643221730 Bacillus sp. Root131 Isolate Unclassified
104 2643221732 Bacillus sp. Root239 Isolate Unclassified
105 2643221735 Bacillus sp. Root920 Isolate Unclassified
106 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
107 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
108 2684622632 Bacillus cereus 905 Isolate Unclassified
109 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
110 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
111 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
112 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
113 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
114 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
115 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
116 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
117 2738541295 Bacillus sp. OK085 Isolate Unclassified
118 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
119 2738541358 Bacillus sp. OV752 Isolate Unclassified
120 2738543006 Bacillus sp. OK077 Isolate Unclassified
121 2738543017 Bacillus sp. OV186 Isolate Unclassified
122 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
123 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
124 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
125 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
126 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
127 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
128 2811994870 Bacillus sp. JB4 Isolate Unclassified
129 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
130 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
131 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
132 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
133 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
134 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
135 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
136 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
137 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
138 2842882022 Bacillus sp. R-71893 Isolate Unclassified
139 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
140 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
141 2857472729 Cohnella sp. R-74144 Isolate Unclassified
142 2857586860 Bacillus sp. R-71935 Isolate Unclassified
143 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
144 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
145 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
146 2860837431 Bacillus sp. WR11 Isolate Unclassified
147 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
148 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
149 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
150 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
151 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
152 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
153 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
154 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
155 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
156 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
157 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
158 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
159 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
160 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
161 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
162 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
163 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
164 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
165 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
166 2919720352 Priestia megaterium 4340 Isolate Unclassified
167 2919726948 Bacillus pumilus 4489 Isolate Unclassified
168 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
169 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
170 2929004312 Priestia megaterium 1104 Isolate Unclassified
171 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
172 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
173 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
174 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
175 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
176 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
177 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
178 2938917290 Bacillus sp. CR71 Isolate Unclassified
179 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
180 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
181 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
182 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
183 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
184 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
185 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
186 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
187 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
188 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
189 2969141011 Bacillus velezensis MH25 Isolate Unclassified
190 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
191 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
192 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
193 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
194 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
195 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
196 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
197 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
198 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
199 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
200 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
201 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
202 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
203 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
204 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
205 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
206 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
207 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
208 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
209 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
210 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
211 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
212 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
213 8022653035 Bacillus sp. Rc4 Isolate Unclassified
214 8022792930 Bacillus sp. Xin Isolate Rhizosphere
215 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
216 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
217 8023438354 Bacillus sp. BH2 Isolate Unclassified
218 8023444577 Bacillus sp. BH32 Isolate Unclassified
219 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
220 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
221 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
222 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
223 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
224 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
225 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
226 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 46.4
Metatranscriptomes 1.44
Isolates 52.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.75
Nodule 0.36
Rhizoplane 6.47
Rhizosphere 45.32
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495660_0225914 3300046810 Bacteria 880
2 JGI25151J46595_10031402 3300003187 Bacteria 2075
3 JGI25151J46595_10031865 3300003187 Bacteria 2052
4 JGI25151J46595_10051815 3300003187 Bacteria 1386
5 JGI25151J46595_10098308 3300003187 Bacteria 795
6 rootH1_10019560 3300003316 Bacteria 9616
7 rootH2_10123082 3300003320 Bacteria 5052
8 rootL2_10038944 3300003322 Bacteria 12732
9 Ga0006562J51391_1000136 3300003578 Bacteria 13430
10 Ga0006562J51391_1000140 3300003578 Bacteria 780
11 Ga0006562J51391_1007512 3300003578 Bacteria 530
12 Ga0055538_1000147 3300003751 Bacteria 49150
13 Ga0055538_1000310 3300003751 Bacteria 23455
14 Ga0055536_1001761 3300003781 Bacteria 12757
15 Ga0055536_1043260 3300003781 Bacteria 1047
16 Ga0055536_1063108 3300003781 Bacteria 759
17 Ga0055541_1003677 3300003841 Bacteria 2858
18 Ga0070671_100106669 3300005355 Bacteria 2352
19 Ga0070711_100531844 3300005439 Bacteria 973
20 Ga0070672_100378541 3300005543 Bacteria 1210
21 Ga0105244_10028381 3300009036 Bacteria 3003
22 Ga0105244_10193743 3300009036 Bacteria 960
23 Ga0105243_10010071 3300009148 Bacteria 7188
24 Ga0105242_10075930 3300009176 Bacteria 2800
25 Ga0105246_10005687 3300011119 Bacteria 7606
26 Ga0105246_10032378 3300011119 Bacteria 3467
27 Ga0105246_10054808 3300011119 Bacteria 2749
28 Ga0157378_10022596 3300013297 Bacteria 5534
29 Ga0157379_11464522 3300014968 Bacteria 663
30 Ga0209784_100100 3300025224 Bacteria 101657
31 Ga0209784_102228 3300025224 Bacteria 2049
32 Ga0209566_100113 3300025225 Bacteria 109893
33 Ga0209566_101752 3300025225 Bacteria 5169
34 Ga0209147_100068 3300025229 Bacteria 230150
35 Ga0209147_100118 3300025229 Bacteria 143578
36 Ga0209147_100245 3300025229 Bacteria 52865
37 Ga0209147_101621 3300025229 Bacteria 7518
38 Ga0209673_1002220 3300025273 Bacteria 14130
39 Ga0209130_1002439 3300025284 Bacteria 9312
40 Ga0209676_1000874 3300025292 Bacteria 38585
41 Ga0209676_1001916 3300025292 Bacteria 16851
42 Ga0209025_1000001 3300025294 Bacteria 1888151
43 Ga0209025_1000101 3300025294 Bacteria 228507
44 Ga0209025_1000127 3300025294 Bacteria 200766
45 Ga0209025_1003412 3300025294 Bacteria 15070
46 Ga0209025_1004137 3300025294 Bacteria 12881
47 Ga0209025_1004177 3300025294 Bacteria 12766
48 Ga0209025_1007112 3300025294 Bacteria 8463
49 Ga0209025_1008302 3300025294 Bacteria 7493
50 Ga0209025_1008533 3300025294 Bacteria 7357
51 Ga0209025_1015262 3300025294 Bacteria 4647
52 Ga0209025_1024754 3300025294 Bacteria 3087
53 Ga0209025_1031025 3300025294 Bacteria 2540
54 Ga0209025_1034001 3300025294 Bacteria 2341
55 Ga0209025_1039006 3300025294 Bacteria 2079
56 Ga0209025_1041299 3300025294 Bacteria 1978
57 Ga0209025_1047544 3300025294 Bacteria 1750
58 Ga0209025_1105138 3300025294 Bacteria 882
59 Ga0209564_1069314 3300025295 Bacteria 742
60 Ga0207426_1115616 3300025302 Bacteria 670
61 Ga0207696_1032125 3300025711 Bacteria 1583
62 Ga0207696_1069862 3300025711 Bacteria 978
63 Ga0207696_1069866 3300025711 Bacteria 978
64 Ga0207655_1041579 3300025728 Bacteria 1968
65 Ga0207655_1088392 3300025728 Bacteria 1097
66 Ga0207655_1119153 3300025728 Bacteria 878
67 Ga0207713_1007746 3300025735 Bacteria 6273
68 Ga0207713_1034947 3300025735 Bacteria 2175
69 Ga0207710_10730881 3300025900 Bacteria 520
70 Ga0207709_11271303 3300025935 Bacteria 608
71 Ga0237817_10222 3300030083 Bacteria 14523
72 Ga0307408_100132654 3300031548 Bacteria 1945
73 Ga0307410_11258707 3300031852 Bacteria 646
74 Ga0307407_10638086 3300031903 Bacteria 797
75 Ga0307412_10223460 3300031911 Bacteria 1445
76 Ga0307409_100101011 3300031995 Bacteria 2392
77 Ga0307416_100191499 3300032002 Bacteria 1929
78 Ga0395901_1703382 3300038443 Bacteria 582
79 Ga0466967_1186374 3300045976 Bacteria 761
80 Ga0495627_068379 3300046453 Bacteria 1041
81 Ga0495603_0020814 3300046455 Bacteria 3971
82 Ga0495591_040104 3300046458 Bacteria 1337
83 Ga0495584_0378413 3300046491 Bacteria 719
84 Ga0495585_0031529 3300046492 Bacteria 3008
85 Ga0495637_0138179 3300046520 Bacteria 926
86 Ga0495597_0116807 3300046542 Bacteria 1115
87 Ga0495668_0517921 3300046616 Bacteria 658
88 Ga0495660_0023556 3300046810 Bacteria 3511
89 Ga0495681_0148090 3300047470 Bacteria 987
90 Ga0496100_0003596 3300048903 Bacteria 8098
91 Ga0496100_0196753 3300048903 Bacteria 1467
92 Ga0496101_0000956 3300048904 Bacteria 17074
93 Ga0496102_0050970 3300048905 Bacteria 3770
94 Ga0496103_0005316 3300048906 Bacteria 7716
95 Ga0496104_0043520 3300048907 Bacteria 4217
96 Ga0496105_0000223 3300048908 Bacteria 38096
97 Ga0496106_0000732 3300048909 Bacteria 23648
98 Ga0496107_0001470 3300048910 Bacteria 14574
99 Ga0496108_0000827 3300048911 Bacteria 24087
100 Ga0496109_0000329 3300048912 Bacteria 44242
101 Ga0496110_0004369 3300048913 Bacteria 10941
102 Ga0496111_0000428 3300048914 Bacteria 21261
103 Ga0496112_0002262 3300048915 Bacteria 15390
104 Ga0496112_0988736 3300048915 Bacteria 761
105 Ga0496113_0012360 3300048916 Bacteria 5736
106 Ga0496114_1102059 3300048917 Bacteria 679
107 Ga0496116_0013775 3300048919 Bacteria 6499
108 Ga0496116_0021657 3300048919 Bacteria 4839
109 Ga0496116_0022308 3300048919 Bacteria 4747
110 Ga0496116_0037376 3300048919 Bacteria 3387
111 Ga0496116_0061312 3300048919 Bacteria 2435
112 Ga0496116_0343696 3300048919 Bacteria 687
113 Ga0496117_0356666 3300048920 Bacteria 753
114 Ga0496118_0500905 3300048921 Bacteria 604
115 Ga0496119_0001865 3300048922 Bacteria 24350
116 Ga0496119_0124968 3300048922 Bacteria 1409
117 Ga0496121_0049821 3300048924 Bacteria 3546
118 Ga0496121_0306754 3300048924 Bacteria 1075
119 Ga0496121_0465671 3300048924 Bacteria 811
120 Ga0496122_0014797 3300048925 Bacteria 7516
121 Ga0496122_0101349 3300048925 Bacteria 1923
122 Ga0496123_0177559 3300048926 Bacteria 1116
123 Ga0496123_0305336 3300048926 Bacteria 758
124 Ga0496124_0084874 3300048927 Bacteria 2596
125 Ga0496124_0136859 3300048927 Bacteria 1938
126 Ga0496125_0039715 3300048928 Bacteria 4047
127 Ga0501312_093954 3300049528 Bacteria 556
128 Ga0501071_0271047 3300049587 Bacteria 1283
129 Ga0501072_1255489 3300049588 Bacteria 575
130 Ga0501075_0728522 3300049591 Bacteria 755
131 Ga0501217_190411 3300049661 Bacteria 634
132 Ga0501251_111688 3300049681 Bacteria 510
133 Ga0501082_1342082 3300060353 Bacteria 625
134 2511179772 2510917027 Bacteria 5287437
135 2511699681 2511231119 Bacteria 4019861
136 2512639117 2512564013 Bacteria 6286191
137 2524191594 2524023129 Bacteria 6762600
138 2540606921 2540341094 Bacteria 4061186
139 2545555865 2545555800 Bacteria 4222588
140 2550900639 2548877040 Bacteria 7507281
141 2553395751 2551306519 Bacteria 5465154
142 2555470280 2554235283 Bacteria 3683090
143 2563928132 2563366752 Bacteria 4961801
144 2571529117 2571042143 Bacteria 6986194
145 2573037280 2571042588 Bacteria 5045676
146 2578335723 2576861424 Bacteria 5270569
147 2578929286 2576861599 Bacteria 4217202
148 2580932433 2579778775 Bacteria 5360914
149 2595088654 2593339131 Bacteria 5116855
150 2601639691 2600255286 Bacteria 5390125
151 2621273958 2619619294 Bacteria 5575484
152 2631983076 2630968484 Bacteria 3876276
153 2643739574 2643221543 Bacteria 6628015
154 2644705499 2643221729 Bacteria 6621700
155 2644710194 2643221730 Bacteria 6523787
156 2644723892 2643221732 Bacteria 5756404
157 2644740094 2643221735 Bacteria 3676263
158 2651533103 2648501850 Bacteria 3975476
159 2674419468 2671180844 Bacteria 4164150
160 2685151625 2684622632 Bacteria 5380049
161 2686996963 2684623153 Bacteria 3878815
162 2687498268 2687453109 Bacteria 3860091
163 2695627643 2695420354 Bacteria 3922431
164 2698321596 2695420987 Bacteria 6152737
165 2705995516 2703719227 Bacteria 5631989
166 2717916562 2716884898 Bacteria 3928789
167 2721506785 2718218445 Bacteria 5113413
168 2728532242 2728368933 Bacteria 7044283
169 2738814860 2738541295 Bacteria 5730091
170 2738841027 2738541299 Bacteria 4020721
171 2739155222 2738541358 Bacteria 5932299
172 2739207457 2738543006 Bacteria 5904091
173 2739268269 2738543017 Bacteria 4271950
174 2745168193 2744054657 Bacteria 5016802
175 2777763780 2775507177 Bacteria 4384303
176 2777839711 2775507192 Bacteria 4622234
177 2791212975 2788500588 Bacteria 4584915
178 2808868676 2808606364 Bacteria 4465927
179 2809056933 2808606399 Bacteria 4021018
180 2812316157 2811994870 Bacteria 3776934
181 2817480113 2816332295 Bacteria 4352468
182 2817617873 2816332336 Bacteria 5207640
183 2819580795 2818991443 Bacteria 6598732
184 2819625334 2818991451 Bacteria 4697364
185 2819709707 2818991465 Bacteria 5388835
186 2819724893 2818991468 Bacteria 3723169
187 2821115865 2821111986 Bacteria 6894338
188 2823528117 2823526263 Bacteria 3765752
189 2831906427 2831905167 Bacteria 3319172
190 2842884033 2842882022 Bacteria 6158489
191 2857462004 2857460504 Bacteria 5194327
192 2857470155 2857465823 Bacteria 6772595
193 2857475597 2857472729 Bacteria 6568124
194 2857588339 2857586860 Bacteria 4354574
195 2857591528 2857591370 Bacteria 6569758
196 2857608366 2857604169 Bacteria 5111450
197 2857611407 2857609550 Bacteria 3753890
198 2860839380 2860837431 Bacteria 4202080
199 2864738958 2864733723 Bacteria 6770668
200 2877770482 2877768649 Bacteria 3957164
201 2880171470 2880169592 Bacteria 3900066
202 2881640671 2881636855 Bacteria 5205297
203 2881647321 2881644220 Bacteria 5302661
204 2889043973 2889042446 Bacteria 7618936
205 2897111500 2897109615 Bacteria 4009619
206 2898910046 2898907183 Bacteria 4067722
207 2904524937 2904524088 Bacteria 5887454
208 2904561205 2904560550 Bacteria 4029838
209 2904607307 2904606771 Bacteria 4684500
210 2908665610 2908665501 Bacteria 3678115
211 2915600855 2915597211 Bacteria 6475886
212 2916974469 2916971899 Bacteria 4250608
213 2919094284 2919093281 Bacteria 3660974
214 2919146474 2919143609 Bacteria 6219228
215 2919165825 2919160200 Bacteria 6929020
216 2919414421 2919414237 Bacteria 5429133
217 2919518390 2919517244 Bacteria 5858162
218 2919722752 2919720352 Bacteria 5986006
219 2919730570 2919726948 Bacteria 3696050
220 2928096687 2928093941 Bacteria 5965005
221 2928512582 2928510474 Bacteria 4815308
222 2929005908 2929004312 Bacteria 5678476
223 2929185993 2929183550 Bacteria 6377511
224 2929207575 2929206907 Bacteria 5918291
225 2929237313 2929233124 Bacteria 5948380
226 2931387436 2931384279 Bacteria 7299545
227 2936343295 2936340661 Bacteria 5139038
228 2936365504 2936361878 Bacteria 5632809
229 2938655247 2938649242 Bacteria 7118381
230 2938921497 2938917290 Bacteria 5914775
231 2939594645 2939593269 Bacteria 4798695
232 2939683668 2939679117 Bacteria 6921672
233 2945993978 2945991243 Bacteria 7008369
234 2946056740 2946053406 Bacteria 6978655
235 2960320377 2960319331 Bacteria 5502575
236 2960379642 2960375949 Bacteria 5361395
237 2962292826 2962290636 Bacteria 4072939
238 2964378636 2964375228 Bacteria 4909004
239 2968561136 2968558590 Bacteria 6956864
240 2969138769 2969136845 Bacteria 3923176
241 2969142937 2969141011 Bacteria 4118468
242 2969766818 2969765954 Bacteria 4216713
243 2969772565 2969770375 Bacteria 4271280
244 2971406393 2971403814 Bacteria 7370929
245 2971514848 2971511577 Bacteria 5404012
246 2971895250 2971893375 Bacteria 3929648
247 2980180954 2980176882 Bacteria 5397533
248 2980494571 2980492589 Bacteria 4072961
249 2988228840 2988225383 Bacteria 7221625
250 2990279224 2990275345 Bacteria 4887158
251 2996635039 2996632988 Bacteria 6921523
252 3001267731 3001267043 Bacteria 4823521
253 3001273206 3001272096 Bacteria 4729684
254 3001893353 3001892409 Bacteria 6328293
255 3006827932 3006826541 Bacteria 4678913
256 3006860458 3006858327 Bacteria 4317835
257 3006881080 3006879489 Bacteria 4064221
258 3006970434 3006969106 Bacteria 4739423
259 3006974947 3006973921 Bacteria 4423788
260 3006979350 3006978542 Bacteria 5328100
261 3006985212 3006984091 Bacteria 4207523
262 3006989501 3006988479 Bacteria 4767936
263 8022623517 8022621104 Bacteria 5241040
264 8022631094 8022630665 Bacteria 3886130
265 8022656530 8022653035 Bacteria 4035078
266 8022798484 8022792930 Bacteria 5693794
267 8022916883 8022914991 Bacteria 5584517
268 8022949262 8022948649 Bacteria 5366783
269 8023440399 8023438354 Bacteria 5779374
270 8023447309 8023444577 Bacteria 5661597
271 8051952566 8051952484 Bacteria 3926774
272 8052174880 8052174270 Bacteria 3881265
273 8054281777 8054280661 Bacteria 4232245
274 8054466627 8054465665 Bacteria 7323556
275 8055533846 8055531788 Bacteria 5249694
276 8057475721 8057473075 Bacteria 5892720
277 8057586078 8057582654 Bacteria 5218944
278 8057634303 8057632132 Bacteria 4726859
279 Ga0495660_0225914
280 JGI25151J46595_10031402
281 JGI25151J46595_10031865
282 JGI25151J46595_10051815
283 JGI25151J46595_10098308
284 rootH1_10019560
285 rootH2_10123082
286 rootL2_10038944
287 Ga0006562J51391_1000136
288 Ga0006562J51391_1000140
289 Ga0006562J51391_1007512
290 Ga0055538_1000147
291 Ga0055538_1000310
292 Ga0055536_1001761
293 Ga0055536_1043260
294 Ga0055536_1063108
295 Ga0055541_1003677
296 Ga0070671_100106669
297 Ga0070711_100531844
298 Ga0070672_100378541
299 Ga0105244_10028381
300 Ga0105244_10193743
301 Ga0105243_10010071
302 Ga0105242_10075930
303 Ga0105246_10005687
304 Ga0105246_10032378
305 Ga0105246_10054808
306 Ga0157378_10022596
307 Ga0157379_11464522
308 Ga0209784_100100
309 Ga0209784_102228
310 Ga0209566_100113
311 Ga0209566_101752
312 Ga0209147_100068
313 Ga0209147_100118
314 Ga0209147_100245
315 Ga0209147_101621
316 Ga0209673_1002220
317 Ga0209130_1002439
318 Ga0209676_1000874
319 Ga0209676_1001916
320 Ga0209025_1000001
321 Ga0209025_1000101
322 Ga0209025_1000127
323 Ga0209025_1003412
324 Ga0209025_1004137
325 Ga0209025_1004177
326 Ga0209025_1007112
327 Ga0209025_1008302
328 Ga0209025_1008533
329 Ga0209025_1015262
330 Ga0209025_1024754
331 Ga0209025_1031025
332 Ga0209025_1034001
333 Ga0209025_1039006
334 Ga0209025_1041299
335 Ga0209025_1047544
336 Ga0209025_1105138
337 Ga0209564_1069314
338 Ga0207426_1115616
339 Ga0207696_1032125
340 Ga0207696_1069862
341 Ga0207696_1069866
342 Ga0207655_1041579
343 Ga0207655_1088392
344 Ga0207655_1119153
345 Ga0207713_1007746
346 Ga0207713_1034947
347 Ga0207710_10730881
348 Ga0207709_11271303
349 Ga0237817_10222
350 Ga0307408_100132654
351 Ga0307410_11258707
352 Ga0307407_10638086
353 Ga0307412_10223460
354 Ga0307409_100101011
355 Ga0307416_100191499
356 Ga0395901_1703382
357 Ga0466967_1186374
358 Ga0495627_068379
359 Ga0495603_0020814
360 Ga0495591_040104
361 Ga0495584_0378413
362 Ga0495585_0031529
363 Ga0495637_0138179
364 Ga0495597_0116807
365 Ga0495668_0517921
366 Ga0495660_0023556
367 Ga0495681_0148090
368 Ga0496100_0003596
369 Ga0496100_0196753
370 Ga0496101_0000956
371 Ga0496102_0050970
372 Ga0496103_0005316
373 Ga0496104_0043520
374 Ga0496105_0000223
375 Ga0496106_0000732
376 Ga0496107_0001470
377 Ga0496108_0000827
378 Ga0496109_0000329
379 Ga0496110_0004369
380 Ga0496111_0000428
381 Ga0496112_0002262
382 Ga0496112_0988736
383 Ga0496113_0012360
384 Ga0496114_1102059
385 Ga0496116_0013775
386 Ga0496116_0021657
387 Ga0496116_0022308
388 Ga0496116_0037376
389 Ga0496116_0061312
390 Ga0496116_0343696
391 Ga0496117_0356666
392 Ga0496118_0500905
393 Ga0496119_0001865
394 Ga0496119_0124968
395 Ga0496121_0049821
396 Ga0496121_0306754
397 Ga0496121_0465671
398 Ga0496122_0014797
399 Ga0496122_0101349
400 Ga0496123_0177559
401 Ga0496123_0305336
402 Ga0496124_0084874
403 Ga0496124_0136859
404 Ga0496125_0039715
405 Ga0501312_093954
406 Ga0501071_0271047
407 Ga0501072_1255489
408 Ga0501075_0728522
409 Ga0501217_190411
410 Ga0501251_111688
411 Ga0501082_1342082
412 2511179772
413 2511699681
414 2512639117
415 2524191594
416 2540606921
417 2545555865
418 2550900639
419 2553395751
420 2555470280
421 2563928132
422 2571529117
423 2573037280
424 2578335723
425 2578929286
426 2580932433
427 2595088654
428 2601639691
429 2621273958
430 2631983076
431 2643739574
432 2644705499
433 2644710194
434 2644723892
435 2644740094
436 2651533103
437 2674419468
438 2685151625
439 2686996963
440 2687498268
441 2695627643
442 2698321596
443 2705995516
444 2717916562
445 2721506785
446 2728532242
447 2738814860
448 2738841027
449 2739155222
450 2739207457
451 2739268269
452 2745168193
453 2777763780
454 2777839711
455 2791212975
456 2808868676
457 2809056933
458 2812316157
459 2817480113
460 2817617873
461 2819580795
462 2819625334
463 2819709707
464 2819724893
465 2821115865
466 2823528117
467 2831906427
468 2842884033
469 2857462004
470 2857470155
471 2857475597
472 2857588339
473 2857591528
474 2857608366
475 2857611407
476 2860839380
477 2864738958
478 2877770482
479 2880171470
480 2881640671
481 2881647321
482 2889043973
483 2897111500
484 2898910046
485 2904524937
486 2904561205
487 2904607307
488 2908665610
489 2915600855
490 2916974469
491 2919094284
492 2919146474
493 2919165825
494 2919414421
495 2919518390
496 2919722752
497 2919730570
498 2928096687
499 2928512582
500 2929005908
501 2929185993
502 2929207575
503 2929237313
504 2931387436
505 2936343295
506 2936365504
507 2938655247
508 2938921497
509 2939594645
510 2939683668
511 2945993978
512 2946056740
513 2960320377
514 2960379642
515 2962292826
516 2964378636
517 2968561136
518 2969138769
519 2969142937
520 2969766818
521 2969772565
522 2971406393
523 2971514848
524 2971895250
525 2980180954
526 2980494571
527 2988228840
528 2990279224
529 2996635039
530 3001267731
531 3001273206
532 3001893353
533 3006827932
534 3006860458
535 3006881080
536 3006970434
537 3006974947
538 3006979350
539 3006985212
540 3006989501
541 8022623517
542 8022631094
543 8022656530
544 8022798484
545 8022916883
546 8022949262
547 8023440399
548 8023447309
549 8051952566
550 8052174880
551 8054281777
552 8054466627
553 8055533846
554 8057475721
555 8057586078
556 8057634303

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11084

DUF2621

Protein of unknown function (DUF2621)

31

169

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ux9-assembly1.cif.gz_C arabidopsis ddm1 bound to nucleosome (h2a.w, h2b, h3.3, h4, with 147 bp dna) 0.8676 78 130
6se0-assembly1.cif.gz_H class 1 : cenp-a nucleosome 0.865 78 131
7zi4-assembly1.cif.gz_P cryo-em structure of the human ino80 complex bound to a wt nucleosome 0.8627 78 130
5vhn-assembly1.cif.gz_C conformational landscape of the p28-bound human proteasome regulatory particle 0.8624 83 114
6mse-assembly1.cif.gz_B cryo-em structures and dynamics of substrate-engaged human 26s proteasome 0.8622 81 114
ID Description Score Start End Superfamily
af_P54813_417_488_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8747 81 114 1.10.8.60
4ld9D00 Mainly Alpha;Orthogonal Bundle;Histone, subunit A;Histone, subunit A 0.8514 78 130 1.10.20.10
5cpkD00 Mainly Alpha;Orthogonal Bundle;Histone, subunit A;Histone, subunit A 0.8486 78 130 1.10.20.10
3w96H00 Mainly Alpha;Orthogonal Bundle;Histone, subunit A;Histone, subunit A 0.8462 78 130 1.10.20.10
af_A0A1D6Q2Q4_341_434_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.838 83 116 1.10.8.60
ID Description Score Start End GO Terms
AF-A0A061NHA6-F1-model_v4 YoxJ protein 0.9618 1 141 GO:0016020
AF-J9LII0-F1-model_v4 deleted 0.9436 36 142
AF-A0A061NHA6-F1-model_v4 YoxJ protein 0.9424 1 141 GO:0016020
AF-A0A7W5SBM5-F1-model_v4 Light-independent protochlorophyllide reductase subunit B-like C-terminal domain-containing protein 0.9374 59 114 GO:0015979
GO:0015995
GO:0016491
AF-A0A7C3IL70-F1-model_v4 Flavodoxin family protein 0.9276 59 117 GO:0016491
GO:0051539

Map