F382498

General Info

Members Datasets Scaffolds Average Seq Length
278 203 556 209

Family's Representative Sequence

Representative Sequence 3300035089|Ga0373944_0001938|Ga0373944_0001938_4494_5153
Length 219
Sequence MDTIRDMIAAQRAELAEVLAGLPAPSWDEPTLCAGWRVREVVAHITMPFRFSGRRFALELAKSRGRFNEMADRVARRDAAAMSPADLTGAVRSNTGHPWKPPGGGYSGALAHDVIHGLDITVPLGLDGPVPEDRLRLVLPESLSDRSVKFFGVDLDGIELRAQDMDWALGSGAPLTGTAADLLLVLCGRTLPPGRLAGEPSSRFSLPAYGLVRDKTSGA

Samples

Sample ID Description Type Environment
1 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
59 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
104 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
105 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
106 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
107 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
108 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
113 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
114 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
115 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
120 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
121 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
133 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
149 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
190 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
193 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
194 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
195 2643221670 Streptomyces sp. Root431 Isolate Unclassified
196 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
197 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
198 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
199 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
200 2891562705 Microbispora tritici MT50 Isolate Unclassified
201 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
202 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
203 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.96
Metatranscriptomes 0.36
Isolates 4.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.16
Nodule 0
Rhizoplane 2.88
Rhizosphere 86.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373944_0001938 3300035089 Bacteria 5240
2 rootL2_10358617 3300003322 Bacteria 2086
3 rootH1_10188449 3300003323 Bacteria 2067
4 JGI25160J50197_1013383 3300003354 Bacteria 2799
5 JGI25160J50197_1013728 3300003354 Bacteria 2745
6 Ga0070683_100204903 3300005329 Bacteria 1873
7 Ga0070666_10026600 3300005335 Bacteria 3782
8 Ga0070682_100052766 3300005337 Bacteria 2545
9 Ga0068868_100146293 3300005338 Bacteria 1943
10 Ga0068868_100217480 3300005338 Bacteria 1598
11 Ga0070689_100472953 3300005340 Bacteria 1069
12 Ga0070661_100087327 3300005344 Bacteria 2307
13 Ga0070668_100732532 3300005347 Bacteria 874
14 Ga0070659_100320548 3300005366 Bacteria 1295
15 Ga0070714_100000408 3300005435 Bacteria 31629
16 Ga0070714_100102854 3300005435 Bacteria 2519
17 Ga0070714_100155116 3300005435 Bacteria 2066
18 Ga0070714_100163335 3300005435 Bacteria 2016
19 Ga0070714_101110966 3300005435 Bacteria 770
20 Ga0070713_100091517 3300005436 Bacteria 2617
21 Ga0070713_100254988 3300005436 Bacteria 1601
22 Ga0070713_100262937 3300005436 Bacteria 1577
23 Ga0070713_100300988 3300005436 Bacteria 1476
24 Ga0070713_101245221 3300005436 Bacteria 720
25 Ga0070710_10000082 3300005437 Bacteria 43464
26 Ga0070710_10066333 3300005437 Bacteria 2069
27 Ga0070711_100050526 3300005439 Bacteria 2852
28 Ga0070711_100205171 3300005439 Bacteria 1523
29 Ga0070705_100295899 3300005440 Bacteria 1157
30 Ga0070700_100041349 3300005441 Bacteria 2826
31 Ga0070662_100071078 3300005457 Bacteria 2565
32 Ga0070681_10827127 3300005458 Bacteria 843
33 Ga0070685_10230905 3300005466 Bacteria 1217
34 Ga0070706_100139124 3300005467 Bacteria 2266
35 Ga0070707_100227949 3300005468 Bacteria 1814
36 Ga0070698_100068483 3300005471 Bacteria 3566
37 Ga0070698_100098717 3300005471 Bacteria 2894
38 Ga0070698_100437681 3300005471 Bacteria 1243
39 Ga0070697_100002529 3300005536 Bacteria 14074
40 Ga0068853_100084022 3300005539 Bacteria 2789
41 Ga0070672_100053961 3300005543 Bacteria 3145
42 Ga0070686_100102613 3300005544 Bacteria 1935
43 Ga0070695_100286480 3300005545 Bacteria 1212
44 Ga0070693_100042382 3300005547 Bacteria 2564
45 Ga0070704_100177514 3300005549 Bacteria 1700
46 Ga0068855_100356459 3300005563 Bacteria 1610
47 Ga0068854_100046923 3300005578 Bacteria 3077
48 Ga0070702_100069117 3300005615 Bacteria 2080
49 Ga0068852_100263954 3300005616 Bacteria 1654
50 Ga0068859_100313460 3300005617 Bacteria 1662
51 Ga0068864_100252003 3300005618 Bacteria 1639
52 Ga0068861_100081511 3300005719 Bacteria 2533
53 Ga0068863_100877423 3300005841 Bacteria 897
54 Ga0068860_100058692 3300005843 Bacteria 3658
55 Ga0070717_10106481 3300006028 Bacteria 2388
56 Ga0070717_10318762 3300006028 Bacteria 1385
57 Ga0070717_10407162 3300006028 Bacteria 1223
58 Ga0070716_100383248 3300006173 Bacteria 1005
59 Ga0070712_100018218 3300006175 Bacteria 4558
60 Ga0097621_100166757 3300006237 Bacteria 1896
61 Ga0075370_10322685 3300006353 Bacteria 920
62 Ga0075433_10801976 3300006852 Bacteria 823
63 Ga0068865_101004951 3300006881 Bacteria 730
64 Ga0097620_100313454 3300006931 Bacteria 1662
65 Ga0099795_10022539 3300007788 Bacteria 2080
66 Ga0105240_10345052 3300009093 Bacteria 1690
67 Ga0105245_10376528 3300009098 Bacteria 1413
68 Ga0105243_10293019 3300009148 Bacteria 1471
69 Ga0105241_10066390 3300009174 Bacteria 2790
70 Ga0105242_10276925 3300009176 Bacteria 1522
71 Ga0105248_10075327 3300009177 Bacteria 3793
72 Ga0105238_10101323 3300009551 Bacteria 2862
73 Ga0105238_10120821 3300009551 Bacteria 2599
74 Ga0105246_10178932 3300011119 Bacteria 1631
75 Ga0157337_1000631 3300012483 Bacteria 1661
76 Ga0157343_1001025 3300012488 Bacteria 1279
77 Ga0157371_10336750 3300013102 Bacteria 1097
78 Ga0157369_11285462 3300013105 Bacteria 746
79 Ga0157374_10095400 3300013296 Bacteria 2844
80 Ga0163162_10547186 3300013306 Bacteria 1286
81 Ga0163163_10651310 3300014325 Bacteria 1117
82 Ga0157377_10072678 3300014745 Bacteria 1991
83 Ga0206354_10480404 3300020081 Bacteria 2197
84 Ga0213875_10010268 3300021388 Bacteria 4695
85 Ga0207426_1002005 3300025302 Bacteria 14374
86 Ga0207426_1002085 3300025302 Bacteria 13819
87 Ga0207653_10008360 3300025885 Bacteria 3224
88 Ga0207692_10000087 3300025898 Bacteria 27051
89 Ga0207692_10024132 3300025898 Bacteria 2822
90 Ga0207688_10290198 3300025901 Bacteria 998
91 Ga0207680_10122642 3300025903 Bacteria 1702
92 Ga0207699_10012829 3300025906 Bacteria 4269
93 Ga0207699_10033951 3300025906 Bacteria 2888
94 Ga0207643_10011292 3300025908 Bacteria 4824
95 Ga0207705_10137070 3300025909 Bacteria 1825
96 Ga0207684_10146215 3300025910 Bacteria 2033
97 Ga0207684_10258917 3300025910 Bacteria 1501
98 Ga0207671_10080226 3300025914 Bacteria 2446
99 Ga0207693_10050765 3300025915 Bacteria 3256
100 Ga0207663_10038753 3300025916 Bacteria 2883
101 Ga0207663_10771992 3300025916 Bacteria 764
102 Ga0207657_10007230 3300025919 Bacteria 11403
103 Ga0207646_10024292 3300025922 Bacteria 5554
104 Ga0207646_10082818 3300025922 Bacteria 2869
105 Ga0207694_10063462 3300025924 Bacteria 2878
106 Ga0207659_10115730 3300025926 Bacteria 2046
107 Ga0207700_10002845 3300025928 Bacteria 9956
108 Ga0207700_10056233 3300025928 Bacteria 2961
109 Ga0207700_10121975 3300025928 Bacteria 2115
110 Ga0207700_10248352 3300025928 Bacteria 1519
111 Ga0207700_10862019 3300025928 Bacteria 810
112 Ga0207700_11057128 3300025928 Bacteria 726
113 Ga0207700_11256261 3300025928 Bacteria 660
114 Ga0207664_10022729 3300025929 Bacteria 4687
115 Ga0207664_10042074 3300025929 Bacteria 3564
116 Ga0207664_10044886 3300025929 Bacteria 3463
117 Ga0207664_10053539 3300025929 Bacteria 3195
118 Ga0207664_10065279 3300025929 Bacteria 2914
119 Ga0207644_10105786 3300025931 Bacteria 2120
120 Ga0207706_10011109 3300025933 Bacteria 8207
121 Ga0207691_10043077 3300025940 Bacteria 4161
122 Ga0207689_10026163 3300025942 Bacteria 4886
123 Ga0207667_10402158 3300025949 Bacteria 1394
124 Ga0207658_10083384 3300025986 Bacteria 2457
125 Ga0207678_10055553 3300026067 Bacteria 3411
126 Ga0207708_10110963 3300026075 Bacteria 2129
127 Ga0207702_10104654 3300026078 Bacteria 2505
128 Ga0207641_10095901 3300026088 Bacteria 2604
129 Ga0207674_10032173 3300026116 Bacteria 5502
130 Ga0207675_100062440 3300026118 Bacteria 3479
131 Ga0207683_10003095 3300026121 Bacteria 14532
132 Ga0207698_10114216 3300026142 Bacteria 2271
133 Ga0316177_1143116 3300030731 Bacteria 1477
134 Ga0307513_10004539 3300031456 Bacteria 18520
135 Ga0307509_10041241 3300031507 Bacteria 5010
136 Ga0307509_10392139 3300031507 Bacteria 1098
137 Ga0307508_10017631 3300031616 Bacteria 6492
138 Ga0307508_10077552 3300031616 Bacteria 2902
139 Ga0307518_10010912 3300031838 Bacteria 6493
140 Ga0307518_10096025 3300031838 Bacteria 2127
141 Ga0373930_0060243 3300034816 Bacteria 845
142 Ga0373934_0010723 3300035086 Bacteria 3440
143 Ga0373940_0075067 3300035088 Bacteria 991
144 Ga0373951_0007580 3300035091 Bacteria 2464
145 Ga0373923_0032487 3300035111 Bacteria 2108
146 Ga0373936_0029803 3300035113 Bacteria 2149
147 Ga0373945_0007162 3300035116 Bacteria 3609
148 Ga0373953_0030591 3300035117 Bacteria 2088
149 Ga0373956_0001796 3300035119 Bacteria 8846
150 Ga0373957_0001115 3300035120 Bacteria 7127
151 Ga0373957_0053401 3300035120 Bacteria 1550
152 Ga0373960_0111606 3300035121 Bacteria 898
153 Ga0373943_0010649 3300035170 Bacteria 4126
154 Ga0373946_0000670 3300035171 Bacteria 11465
155 Ga0373955_0015533 3300035172 Bacteria 3729
156 Ga0373955_0062882 3300035172 Bacteria 2054
157 Ga0373942_0072053 3300035207 Bacteria 1011
158 Ga0373962_0119180 3300035242 Bacteria 840
159 Ga0373924_0009464 3300035410 Bacteria 3570
160 Ga0373924_0166556 3300035410 Bacteria 967
161 Ga0373931_0416244 3300035691 Bacteria 853
162 Ga0373935_0106071 3300035692 Bacteria 1859
163 Ga0373927_0006106 3300035695 Bacteria 8251
164 Ga0373927_0470332 3300035695 Bacteria 830
165 Ga0373933_0017932 3300035724 Bacteria 3975
166 Ga0373933_0032625 3300035724 Bacteria 3027
167 Ga0373947_0009000 3300035725 Bacteria 5740
168 Ga0373937_0024987 3300036401 Bacteria 5391
169 Ga0373925_0029190 3300037068 Bacteria 4045
170 Ga0373925_0041988 3300037068 Bacteria 3392
171 Ga0436364_0333308 3300037853 Bacteria 5341
172 Ga0436364_0502553 3300037853 Bacteria 8872
173 Ga0436364_1466884 3300037853 Bacteria 6466
174 Ga0436365_1389595 3300039437 Bacteria 845
175 Ga0451853_3331672 3300041512 Bacteria 2517
176 Ga0439449_0014039 3300042007 Bacteria 3012
177 Ga0466972_0098165 3300044658 Bacteria 1387
178 Ga0466965_0001556 3300044683 Bacteria 9340
179 Ga0466965_0051502 3300044683 Bacteria 2042
180 Ga0466968_0065846 3300044735 Bacteria 1569
181 Ga0466960_0042790 3300044901 Bacteria 2151
182 Ga0495592_0183685 3300046454 Bacteria 1422
183 Ga0495629_0002335 3300046459 Bacteria 14614
184 Ga0495629_0222470 3300046459 Bacteria 1302
185 Ga0495641_0004213 3300046461 Bacteria 10309
186 Ga0495651_0013862 3300046462 Bacteria 6235
187 Ga0495651_0024342 3300046462 Bacteria 4711
188 Ga0495651_0126036 3300046462 Bacteria 1875
189 Ga0495653_0014842 3300046463 Bacteria 6355
190 Ga0495653_0085425 3300046463 Bacteria 2321
191 Ga0495582_0043605 3300046473 Bacteria 2470
192 Ga0495639_0001039 3300046475 Bacteria 12523
193 Ga0495662_0008294 3300046476 Bacteria 5113
194 Ga0495664_0324939 3300046477 Bacteria 928
195 Ga0495618_0003224 3300046514 Bacteria 10222
196 Ga0495618_0037082 3300046514 Bacteria 3060
197 Ga0495618_0175403 3300046514 Bacteria 1363
198 Ga0495628_0383779 3300046516 Bacteria 1028
199 Ga0495632_0240319 3300046519 Bacteria 815
200 Ga0495666_0001656 3300046526 Bacteria 10990
201 Ga0495652_0039256 3300046529 Bacteria 4093
202 Ga0495652_0052269 3300046529 Bacteria 3485
203 Ga0495652_0192152 3300046529 Bacteria 1557
204 Ga0495665_0000359 3300046531 Bacteria 23097
205 Ga0495640_0005481 3300046533 Bacteria 10092
206 Ga0495587_0030639 3300046536 Bacteria 3261
207 Ga0495587_0263612 3300046536 Bacteria 967
208 Ga0495645_0206849 3300046543 Bacteria 1327
209 Ga0495622_0073209 3300046557 Bacteria 1581
210 Ga0495667_0024100 3300046559 Bacteria 4098
211 Ga0495667_0102132 3300046559 Bacteria 1854
212 Ga0495634_0003711 3300046642 Bacteria 12170
213 Ga0495635_0018424 3300046663 Bacteria 4871
214 Ga0495657_0019261 3300046675 Bacteria 4925
215 Ga0495657_0025610 3300046675 Bacteria 4187
216 Ga0495657_0036008 3300046675 Bacteria 3425
217 Ga0495657_0054403 3300046675 Bacteria 2674
218 Ga0495599_0022959 3300046678 Bacteria 3897
219 Ga0495599_0036565 3300046678 Bacteria 3084
220 Ga0495599_0067293 3300046678 Bacteria 2237
221 Ga0495599_0324906 3300046678 Bacteria 925
222 Ga0495623_0014251 3300046679 Bacteria 5149
223 Ga0495623_0391029 3300046679 Bacteria 750
224 Ga0495646_0016035 3300046680 Bacteria 4755
225 Ga0495647_0010166 3300046681 Bacteria 3200
226 Ga0495658_0003440 3300046683 Bacteria 7830
227 Ga0495613_0004164 3300046689 Bacteria 10824
228 Ga0495624_0008723 3300046690 Bacteria 7059
229 Ga0495600_0030884 3300046809 Bacteria 3469
230 Ga0495581_0001401 3300047315 Bacteria 13342
231 Ga0495604_0014540 3300047317 Bacteria 6277
232 Ga0495604_0162804 3300047317 Bacteria 1575
233 Ga0495604_0279254 3300047317 Bacteria 1129
234 Ga0495674_0036860 3300047319 Bacteria 4397
235 Ga0495674_0054080 3300047319 Bacteria 3527
236 Ga0495674_0593528 3300047319 Bacteria 878
237 Ga0495680_0005879 3300047322 Bacteria 11478
238 Ga0495680_0026753 3300047322 Bacteria 4750
239 Ga0495680_0027215 3300047322 Bacteria 4701
240 Ga0495680_0041092 3300047322 Bacteria 3678
241 Ga0495675_0013038 3300047444 Bacteria 5241
242 Ga0495684_0051193 3300047471 Bacteria 3152
243 Ga0495684_0147139 3300047471 Bacteria 1763
244 Ga0495593_0014516 3300047673 Bacteria 4476
245 Ga0495602_0033939 3300048088 Bacteria 4780
246 Ga0495602_0047113 3300048088 Bacteria 3887
247 Ga0495614_0330715 3300048089 Bacteria 708
248 Ga0496104_0150360 3300048907 Bacteria 2235
249 Ga0496105_0056124 3300048908 Bacteria 3251
250 Ga0496107_0617510 3300048910 Bacteria 800
251 Ga0496108_0000201 3300048911 Bacteria 55200
252 Ga0496108_0053482 3300048911 Bacteria 3386
253 Ga0496109_0412209 3300048912 Bacteria 1276
254 Ga0496112_0098066 3300048915 Bacteria 2900
255 Ga0496114_0684694 3300048917 Bacteria 900
256 nmdc:mga07m45_176976_c1 3300050496 Bacteria 1240
257 nmdc:mga0n895_493037_c1 3300050512 Bacteria 1235
258 nmdc:mga0rr50_507071_c1 3300050513 Bacteria 1026
259 nmdc:mga08x19_295870_c1 3300050514 Bacteria 1124
260 Ga0495601_0008581 3300053077 Bacteria 6037
261 Ga0495612_0024497 3300053078 Bacteria 2422
262 Ga0495595_0007153 3300053084 Bacteria 4560
263 Ga0495595_0057974 3300053084 Bacteria 1807
264 Ga0495619_0006673 3300053085 Bacteria 7301
265 Ga0495619_0316808 3300053085 Bacteria 1080
266 2552112953 2551306166 Bacteria 9731570
267 2552112955 2551306166 Bacteria 9731570
268 2554260358 2554235005 Bacteria 6457341
269 2643948188 2643221587 Bacteria 7586415
270 2644385299 2643221670 Bacteria 6497041
271 2644429661 2643221677 Bacteria 7584031
272 2753266663 2751185782 Bacteria 11227053
273 2891401353 2891395885 Bacteria 9251614
274 2891558317 2891554331 Bacteria 8812224
275 2891566732 2891562705 Bacteria 8039471
276 2899367751 2899359706 Bacteria 10940472
277 2997606476 2997600082 Bacteria 9896405
278 8054164023 8054160619 Bacteria 7783213
279 Ga0373944_0001938
280 rootL2_10358617
281 rootH1_10188449
282 JGI25160J50197_1013383
283 JGI25160J50197_1013728
284 Ga0070683_100204903
285 Ga0070666_10026600
286 Ga0070682_100052766
287 Ga0068868_100146293
288 Ga0068868_100217480
289 Ga0070689_100472953
290 Ga0070661_100087327
291 Ga0070668_100732532
292 Ga0070659_100320548
293 Ga0070714_100000408
294 Ga0070714_100102854
295 Ga0070714_100155116
296 Ga0070714_100163335
297 Ga0070714_101110966
298 Ga0070713_100091517
299 Ga0070713_100254988
300 Ga0070713_100262937
301 Ga0070713_100300988
302 Ga0070713_101245221
303 Ga0070710_10000082
304 Ga0070710_10066333
305 Ga0070711_100050526
306 Ga0070711_100205171
307 Ga0070705_100295899
308 Ga0070700_100041349
309 Ga0070662_100071078
310 Ga0070681_10827127
311 Ga0070685_10230905
312 Ga0070706_100139124
313 Ga0070707_100227949
314 Ga0070698_100068483
315 Ga0070698_100098717
316 Ga0070698_100437681
317 Ga0070697_100002529
318 Ga0068853_100084022
319 Ga0070672_100053961
320 Ga0070686_100102613
321 Ga0070695_100286480
322 Ga0070693_100042382
323 Ga0070704_100177514
324 Ga0068855_100356459
325 Ga0068854_100046923
326 Ga0070702_100069117
327 Ga0068852_100263954
328 Ga0068859_100313460
329 Ga0068864_100252003
330 Ga0068861_100081511
331 Ga0068863_100877423
332 Ga0068860_100058692
333 Ga0070717_10106481
334 Ga0070717_10318762
335 Ga0070717_10407162
336 Ga0070716_100383248
337 Ga0070712_100018218
338 Ga0097621_100166757
339 Ga0075370_10322685
340 Ga0075433_10801976
341 Ga0068865_101004951
342 Ga0097620_100313454
343 Ga0099795_10022539
344 Ga0105240_10345052
345 Ga0105245_10376528
346 Ga0105243_10293019
347 Ga0105241_10066390
348 Ga0105242_10276925
349 Ga0105248_10075327
350 Ga0105238_10101323
351 Ga0105238_10120821
352 Ga0105246_10178932
353 Ga0157337_1000631
354 Ga0157343_1001025
355 Ga0157371_10336750
356 Ga0157369_11285462
357 Ga0157374_10095400
358 Ga0163162_10547186
359 Ga0163163_10651310
360 Ga0157377_10072678
361 Ga0206354_10480404
362 Ga0213875_10010268
363 Ga0207426_1002005
364 Ga0207426_1002085
365 Ga0207653_10008360
366 Ga0207692_10000087
367 Ga0207692_10024132
368 Ga0207688_10290198
369 Ga0207680_10122642
370 Ga0207699_10012829
371 Ga0207699_10033951
372 Ga0207643_10011292
373 Ga0207705_10137070
374 Ga0207684_10146215
375 Ga0207684_10258917
376 Ga0207671_10080226
377 Ga0207693_10050765
378 Ga0207663_10038753
379 Ga0207663_10771992
380 Ga0207657_10007230
381 Ga0207646_10024292
382 Ga0207646_10082818
383 Ga0207694_10063462
384 Ga0207659_10115730
385 Ga0207700_10002845
386 Ga0207700_10056233
387 Ga0207700_10121975
388 Ga0207700_10248352
389 Ga0207700_10862019
390 Ga0207700_11057128
391 Ga0207700_11256261
392 Ga0207664_10022729
393 Ga0207664_10042074
394 Ga0207664_10044886
395 Ga0207664_10053539
396 Ga0207664_10065279
397 Ga0207644_10105786
398 Ga0207706_10011109
399 Ga0207691_10043077
400 Ga0207689_10026163
401 Ga0207667_10402158
402 Ga0207658_10083384
403 Ga0207678_10055553
404 Ga0207708_10110963
405 Ga0207702_10104654
406 Ga0207641_10095901
407 Ga0207674_10032173
408 Ga0207675_100062440
409 Ga0207683_10003095
410 Ga0207698_10114216
411 Ga0316177_1143116
412 Ga0307513_10004539
413 Ga0307509_10041241
414 Ga0307509_10392139
415 Ga0307508_10017631
416 Ga0307508_10077552
417 Ga0307518_10010912
418 Ga0307518_10096025
419 Ga0373930_0060243
420 Ga0373934_0010723
421 Ga0373940_0075067
422 Ga0373951_0007580
423 Ga0373923_0032487
424 Ga0373936_0029803
425 Ga0373945_0007162
426 Ga0373953_0030591
427 Ga0373956_0001796
428 Ga0373957_0001115
429 Ga0373957_0053401
430 Ga0373960_0111606
431 Ga0373943_0010649
432 Ga0373946_0000670
433 Ga0373955_0015533
434 Ga0373955_0062882
435 Ga0373942_0072053
436 Ga0373962_0119180
437 Ga0373924_0009464
438 Ga0373924_0166556
439 Ga0373931_0416244
440 Ga0373935_0106071
441 Ga0373927_0006106
442 Ga0373927_0470332
443 Ga0373933_0017932
444 Ga0373933_0032625
445 Ga0373947_0009000
446 Ga0373937_0024987
447 Ga0373925_0029190
448 Ga0373925_0041988
449 Ga0436364_0333308
450 Ga0436364_0502553
451 Ga0436364_1466884
452 Ga0436365_1389595
453 Ga0451853_3331672
454 Ga0439449_0014039
455 Ga0466972_0098165
456 Ga0466965_0001556
457 Ga0466965_0051502
458 Ga0466968_0065846
459 Ga0466960_0042790
460 Ga0495592_0183685
461 Ga0495629_0002335
462 Ga0495629_0222470
463 Ga0495641_0004213
464 Ga0495651_0013862
465 Ga0495651_0024342
466 Ga0495651_0126036
467 Ga0495653_0014842
468 Ga0495653_0085425
469 Ga0495582_0043605
470 Ga0495639_0001039
471 Ga0495662_0008294
472 Ga0495664_0324939
473 Ga0495618_0003224
474 Ga0495618_0037082
475 Ga0495618_0175403
476 Ga0495628_0383779
477 Ga0495632_0240319
478 Ga0495666_0001656
479 Ga0495652_0039256
480 Ga0495652_0052269
481 Ga0495652_0192152
482 Ga0495665_0000359
483 Ga0495640_0005481
484 Ga0495587_0030639
485 Ga0495587_0263612
486 Ga0495645_0206849
487 Ga0495622_0073209
488 Ga0495667_0024100
489 Ga0495667_0102132
490 Ga0495634_0003711
491 Ga0495635_0018424
492 Ga0495657_0019261
493 Ga0495657_0025610
494 Ga0495657_0036008
495 Ga0495657_0054403
496 Ga0495599_0022959
497 Ga0495599_0036565
498 Ga0495599_0067293
499 Ga0495599_0324906
500 Ga0495623_0014251
501 Ga0495623_0391029
502 Ga0495646_0016035
503 Ga0495647_0010166
504 Ga0495658_0003440
505 Ga0495613_0004164
506 Ga0495624_0008723
507 Ga0495600_0030884
508 Ga0495581_0001401
509 Ga0495604_0014540
510 Ga0495604_0162804
511 Ga0495604_0279254
512 Ga0495674_0036860
513 Ga0495674_0054080
514 Ga0495674_0593528
515 Ga0495680_0005879
516 Ga0495680_0026753
517 Ga0495680_0027215
518 Ga0495680_0041092
519 Ga0495675_0013038
520 Ga0495684_0051193
521 Ga0495684_0147139
522 Ga0495593_0014516
523 Ga0495602_0033939
524 Ga0495602_0047113
525 Ga0495614_0330715
526 Ga0496104_0150360
527 Ga0496105_0056124
528 Ga0496107_0617510
529 Ga0496108_0000201
530 Ga0496108_0053482
531 Ga0496109_0412209
532 Ga0496112_0098066
533 Ga0496114_0684694
534 nmdc:mga07m45_176976_c1
535 nmdc:mga0n895_493037_c1
536 nmdc:mga0rr50_507071_c1
537 nmdc:mga08x19_295870_c1
538 Ga0495601_0008581
539 Ga0495612_0024497
540 Ga0495595_0007153
541 Ga0495595_0057974
542 Ga0495619_0006673
543 Ga0495619_0316808
544 2552112953
545 2552112955
546 2554260358
547 2643948188
548 2644385299
549 2644429661
550 2753266663
551 2891401353
552 2891558317
553 2891566732
554 2899367751
555 2997606476
556 8054164023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11716

MDMPI_N

Mycothiol maleylpyruvate isomerase N-terminal domain

8

97

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nsf-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase 0.6231 8 200
5com-assembly2.cif.gz_B crystal structure of uncharacterized protein q187f5 from clostridium difficile 630 0.6211 1 99
2nsf-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase 0.6027 8 200
2nsg-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase h52a mutant 0.5991 8 193
5cog-assembly1.cif.gz_A crystal structure of yeast irc4 0.5989 1 99
ID Description Score Start End Superfamily
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7597 9 127 1.20.120.450
af_P95285_1_214_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6941 11 187 1.20.120.450
af_O05777_10_164_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6796 5 128 1.20.120.450
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6412 9 127 1.20.120.450
af_P95285_1_214_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6231 11 187 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A7S7YBY4-F1-model_v4 Maleyl pyruvate isomerase family myco-thiol dependent enzyme 0.9934 23 196 GO:0016853
GO:0046872
AF-A0A656THU8-F1-model_v4 deleted 0.9905 7 147
AF-A0A1K1PHM3-F1-model_v4 TIGR03083 family protein 0.9871 7 197 GO:0046872
AF-A0A318K6B9-F1-model_v4 Uncharacterized protein (TIGR03083 family) 0.9861 8 197 GO:0046872
AF-A0A7C9W7F4-F1-model_v4 Maleylpyruvate isomerase family mycothiol-dependent enzyme 0.9855 7 197 GO:0016853
GO:0046872

Map