F382449

General Info

Members Datasets Scaffolds Average Seq Length
278 172 556 96

Family's Representative Sequence

Representative Sequence 3300026035|Ga0207703_11057535|Ga0207703_110575351
Length 104
Sequence MIQQPAPKIQLMNTPEYRENYANSVQVRVNLWDFFLLFGRISQTTPDSVTIHNFEGIYVSPQQAKALLNVLQQNVTQYESAFGEIRLEPQTPGAGGTTPVTPRG

Samples

Sample ID Description Type Environment
1 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
91 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
94 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
107 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
122 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
135 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.72
Rhizosphere 96.76
Stem 0
Stem Tuber 0
Unclassified 44.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207703_11057535 3300026035 Archaea 779
2 Ga0070683_100000032 3300005329 Bacteria 148421
3 Ga0070683_100172983 3300005329 Bacteria 2050
4 Ga0070683_100390952 3300005329 Unclassified 1326
5 Ga0070666_10470341 3300005335 Unclassified 909
6 Ga0068868_100181326 3300005338 Bacteria 1747
7 Ga0070687_100238234 3300005343 Bacteria 1123
8 Ga0070669_100068806 3300005353 Bacteria 2614
9 Ga0070675_100329903 3300005354 Bacteria 1349
10 Ga0070671_100637987 3300005355 Unclassified 922
11 Ga0070673_100864399 3300005364 Unclassified 837
12 Ga0070673_101990895 3300005364 Unclassified 551
13 Ga0070667_100772528 3300005367 Bacteria 891
14 Ga0070667_101180794 3300005367 Bacteria 716
15 Ga0070709_10629812 3300005434 Unclassified 828
16 Ga0070713_101189099 3300005436 Bacteria 738
17 Ga0070710_10988255 3300005437 Bacteria 612
18 Ga0070711_100471076 3300005439 Bacteria 1031
19 Ga0070711_100693294 3300005439 Bacteria 857
20 Ga0070708_100040086 3300005445 Unclassified 4101
21 Ga0070708_101629127 3300005445 Unclassified 600
22 Ga0070681_10666680 3300005458 Unclassified 955
23 Ga0070681_10979510 3300005458 Bacteria 765
24 Ga0070681_11180875 3300005458 Bacteria 687
25 Ga0068867_102375058 3300005459 Unclassified 504
26 Ga0070685_10375303 3300005466 Bacteria 978
27 Ga0070707_100951216 3300005468 Unclassified 824
28 Ga0070699_100208289 3300005518 Unclassified 1740
29 Ga0070684_100000046 3300005535 Bacteria 83793
30 Ga0070684_100222181 3300005535 Unclassified 1723
31 Ga0070684_100389039 3300005535 Bacteria 1285
32 Ga0070684_100767991 3300005535 Unclassified 900
33 Ga0068853_101285851 3300005539 Unclassified 707
34 Ga0070686_101475382 3300005544 Unclassified 572
35 Ga0068855_100293011 3300005563 Bacteria 1804
36 Ga0070664_100793259 3300005564 Unclassified 885
37 Ga0068856_100344766 3300005614 Bacteria 1508
38 Ga0068852_100300895 3300005616 Bacteria 1552
39 Ga0068859_100722116 3300005617 Bacteria 1086
40 Ga0068859_101687300 3300005617 Unclassified 700
41 Ga0068870_10929033 3300005840 Bacteria 616
42 Ga0068858_101706985 3300005842 Bacteria 622
43 Ga0068858_102055901 3300005842 Unclassified 565
44 Ga0068858_102516143 3300005842 Unclassified 508
45 Ga0068860_101148504 3300005843 Unclassified 796
46 Ga0068860_102053853 3300005843 Unclassified 593
47 Ga0068862_102645300 3300005844 Bacteria 513
48 Ga0070717_10009011 3300006028 Bacteria 7488
49 Ga0070712_101068161 3300006175 Bacteria 700
50 Ga0068871_100846440 3300006358 Unclassified 845
51 Ga0068871_101950988 3300006358 Unclassified 558
52 Ga0075433_10211953 3300006852 Bacteria 1721
53 Ga0075433_10243114 3300006852 Bacteria 1598
54 Ga0075434_100604160 3300006871 Unclassified 1116
55 Ga0075436_101237264 3300006914 Unclassified 564
56 Ga0097620_101687419 3300006931 Unclassified 700
57 Ga0075435_101089844 3300007076 Bacteria 698
58 Ga0105240_10010976 3300009093 Bacteria 12687
59 Ga0105240_10026501 3300009093 Bacteria 7606
60 Ga0105240_10195606 3300009093 Bacteria 2375
61 Ga0105245_12803703 3300009098 Bacteria 540
62 Ga0114129_10984353 3300009147 Unclassified 1063
63 Ga0105241_10651093 3300009174 Unclassified 957
64 Ga0105242_11249462 3300009176 Unclassified 764
65 Ga0105248_10076106 3300009177 Bacteria 3772
66 Ga0105248_10582481 3300009177 Bacteria 1262
67 Ga0105248_10840750 3300009177 Bacteria 1036
68 Ga0105237_10014769 3300009545 Bacteria 8150
69 Ga0105237_11130381 3300009545 Unclassified 790
70 Ga0105238_10319538 3300009551 Bacteria 1538
71 Ga0105249_12624489 3300009553 Archaea 576
72 Ga0105239_10057320 3300010375 Bacteria 4273
73 Ga0157373_10507373 3300013100 Bacteria 872
74 Ga0157369_10060400 3300013105 Bacteria 4088
75 Ga0157378_10442305 3300013297 Bacteria 1289
76 Ga0157378_11047624 3300013297 Unclassified 851
77 Ga0157378_12544037 3300013297 Unclassified 564
78 Ga0157372_10205730 3300013307 Unclassified 2281
79 Ga0157372_10658189 3300013307 Bacteria 1220
80 Ga0157375_10412477 3300013308 Bacteria 1517
81 Ga0157375_10648713 3300013308 Bacteria 1212
82 Ga0157375_10834055 3300013308 Bacteria 1069
83 Ga0157375_11106339 3300013308 Unclassified 928
84 Ga0157375_11353339 3300013308 Unclassified 838
85 Ga0163163_10224596 3300014325 Bacteria 1927
86 Ga0163163_11060919 3300014325 Unclassified 873
87 Ga0157380_10863665 3300014326 Unclassified 928
88 Ga0157377_11113584 3300014745 Unclassified 606
89 Ga0157379_10695795 3300014968 Bacteria 954
90 Ga0157379_12085674 3300014968 Bacteria 562
91 Ga0157376_10098803 3300014969 Bacteria 2545
92 Ga0157376_10842516 3300014969 Unclassified 932
93 Ga0157376_10952741 3300014969 Unclassified 879
94 Ga0157376_11807181 3300014969 Unclassified 647
95 Ga0213876_10207278 3300021384 Unclassified 1042
96 Ga0213875_10233740 3300021388 Bacteria 866
97 Ga0207699_10525630 3300025906 Unclassified 856
98 Ga0207684_11310835 3300025910 Unclassified 596
99 Ga0207695_10007463 3300025913 Bacteria 13893
100 Ga0207695_10210203 3300025913 Bacteria 1857
101 Ga0207671_10009179 3300025914 Bacteria 8296
102 Ga0207662_10364995 3300025918 Bacteria 972
103 Ga0207646_11343738 3300025922 Unclassified 623
104 Ga0207681_10088827 3300025923 Bacteria 2202
105 Ga0207694_10504305 3300025924 Bacteria 1013
106 Ga0207694_10692607 3300025924 Bacteria 859
107 Ga0207659_10357524 3300025926 Bacteria 1213
108 Ga0207700_11824909 3300025928 Bacteria 534
109 Ga0207644_10365893 3300025931 Unclassified 1174
110 Ga0207686_11295384 3300025934 Unclassified 598
111 Ga0207670_10368753 3300025936 Bacteria 1141
112 Ga0207711_10056585 3300025941 Bacteria 3370
113 Ga0207661_10000020 3300025944 Bacteria 216011
114 Ga0207661_10167020 3300025944 Bacteria 1913
115 Ga0207661_10470858 3300025944 Unclassified 1146
116 Ga0207679_10536495 3300025945 Unclassified 1048
117 Ga0207712_11673127 3300025961 Archaea 570
118 Ga0207658_10430661 3300025986 Bacteria 1165
119 Ga0207677_10965118 3300026023 Unclassified 771
120 Ga0207639_11390619 3300026041 Bacteria 659
121 Ga0207648_10577044 3300026089 Unclassified 1035
122 Ga0207648_10912823 3300026089 Unclassified 821
123 Ga0207648_12169399 3300026089 Unclassified 516
124 Ga0207676_10418852 3300026095 Unclassified 1256
125 Ga0207674_11221898 3300026116 Unclassified 721
126 Ga0207674_11715071 3300026116 Unclassified 596
127 Ga0207675_100849788 3300026118 Bacteria 928
128 Ga0207675_101920608 3300026118 Unclassified 610
129 Ga0207698_10364340 3300026142 Unclassified 1370
130 Ga0265334_10263021 3300028573 Bacteria 593
131 Ga0265318_10087408 3300028577 Bacteria 1149
132 Ga0265323_10003126 3300028653 Bacteria 7371
133 Ga0265323_10126950 3300028653 Bacteria 828
134 Ga0265323_10147428 3300028653 Unclassified 755
135 Ga0265336_10055420 3300028666 Bacteria 1192
136 Ga0265338_10009908 3300028800 Bacteria 11270
137 Ga0265324_10020874 3300029957 Unclassified 2352
138 Ga0265330_10058060 3300031235 Unclassified 1687
139 Ga0265332_10015082 3300031238 Bacteria 3414
140 Ga0265328_10203162 3300031239 Bacteria 752
141 Ga0265320_10000436 3300031240 Bacteria 32831
142 Ga0265325_10070093 3300031241 Bacteria 1762
143 Ga0265329_10013385 3300031242 Bacteria 2925
144 Ga0265340_10025208 3300031247 Bacteria 3014
145 Ga0265339_10009894 3300031249 Bacteria 5956
146 Ga0265331_10006306 3300031250 Bacteria 7022
147 Ga0265316_10000723 3300031344 Bacteria 36403
148 Ga0265316_10005757 3300031344 Bacteria 11965
149 Ga0265316_10016005 3300031344 Bacteria 6526
150 Ga0265316_10081046 3300031344 Bacteria 2488
151 Ga0265316_10085565 3300031344 Bacteria 2412
152 Ga0265316_10107186 3300031344 Bacteria 2119
153 Ga0265316_10486033 3300031344 Unclassified 883
154 Ga0265316_11020262 3300031344 Bacteria 575
155 Ga0265314_10034729 3300031711 Bacteria 3680
156 Ga0265314_10049662 3300031711 Bacteria 2935
157 Ga0265342_10067900 3300031712 Unclassified 2085
158 Ga0373934_0044988 3300035086 Bacteria 1745
159 Ga0373934_0109480 3300035086 Unclassified 1120
160 Ga0373923_0434038 3300035111 Unclassified 635
161 Ga0373923_0553712 3300035111 Bacteria 564
162 Ga0373954_0110789 3300035118 Bacteria 1328
163 Ga0373954_0120574 3300035118 Unclassified 1273
164 Ga0373924_0305905 3300035410 Unclassified 706
165 Ga0373935_0333413 3300035692 Unclassified 1079
166 Ga0373935_1159736 3300035692 Unclassified 576
167 Ga0373927_0029485 3300035695 Bacteria 3577
168 Ga0373933_0021575 3300035724 Unclassified 3660
169 Ga0373933_0449130 3300035724 Bacteria 843
170 Ga0373947_0326775 3300035725 Bacteria 1026
171 Ga0373947_0473393 3300035725 Unclassified 850
172 Ga0373947_0678364 3300035725 Unclassified 703
173 Ga0373937_0021262 3300036401 Bacteria 5823
174 Ga0373937_0138295 3300036401 Unclassified 2278
175 Ga0373937_0318788 3300036401 Unclassified 1471
176 Ga0373937_0486816 3300036401 Bacteria 1172
177 Ga0373937_0513189 3300036401 Bacteria 1139
178 Ga0373937_0660442 3300036401 Unclassified 991
179 Ga0265778_028703 3300036457 Unclassified 713
180 Ga0373925_0202489 3300037068 Bacteria 1579
181 Ga0373925_0238548 3300037068 Bacteria 1456
182 Ga0373925_0946733 3300037068 Bacteria 710
183 Ga0373925_1309030 3300037068 Unclassified 594
184 Ga0436364_0102867 3300037853 Unclassified 1020
185 Ga0436364_0824221 3300037853 Bacteria 698
186 Ga0436364_1198481 3300037853 Bacteria 893
187 Ga0436365_0077127 3300039437 Bacteria 4895
188 Ga0436361_1197162 3300039447 Unclassified 571
189 Ga0436362_0725328 3300039453 Unclassified 510
190 Ga0451800_0335964 3300041459 Unclassified 537
191 Ga0451839_0221721 3300041496 Bacteria 678
192 Ga0451577_0695527 3300042876 Unclassified 921
193 Ga0451577_1247601 3300042876 Bacteria 662
194 Ga0453683_0487152 3300044673 Bacteria 800
195 Ga0453683_0571655 3300044673 Bacteria 736
196 Ga0453683_0634541 3300044673 Unclassified 698
197 Ga0466963_0444148 3300044694 Bacteria 915
198 Ga0451576_0232843 3300045051 Bacteria 1924
199 Ga0451576_0414825 3300045051 Bacteria 1412
200 Ga0451576_1256049 3300045051 Unclassified 773
201 Ga0451576_2219383 3300045051 Bacteria 563
202 Ga0451576_2690319 3300045051 Unclassified 506
203 Ga0466967_2070243 3300045976 Bacteria 566
204 Ga0495592_0116095 3300046454 Unclassified 1889
205 Ga0495629_0601543 3300046459 Bacteria 735
206 Ga0495651_0055738 3300046462 Bacteria 3036
207 Ga0495651_0057915 3300046462 Bacteria 2974
208 Ga0495653_0123447 3300046463 Unclassified 1842
209 Ga0495653_0288604 3300046463 Bacteria 1074
210 Ga0495580_0000506 3300046472 Bacteria 32778
211 Ga0495580_0022945 3300046472 Unclassified 4588
212 Ga0495580_0127896 3300046472 Bacteria 1763
213 Ga0495582_0407448 3300046473 Bacteria 784
214 Ga0495639_0419210 3300046475 Bacteria 678
215 Ga0495639_0594307 3300046475 Unclassified 569
216 Ga0495662_0075701 3300046476 Unclassified 1633
217 Ga0495664_0155493 3300046477 Unclassified 1387
218 Ga0495608_0213784 3300046511 Unclassified 1211
219 Ga0495608_0587034 3300046511 Bacteria 669
220 Ga0495618_0268580 3300046514 Unclassified 1066
221 Ga0495628_0047311 3300046516 Bacteria 3413
222 Ga0495628_0759111 3300046516 Bacteria 681
223 Ga0495630_0071009 3300046517 Unclassified 2620
224 Ga0495666_0373090 3300046526 Unclassified 642
225 Ga0495652_0247314 3300046529 Unclassified 1323
226 Ga0495652_0958955 3300046529 Unclassified 561
227 Ga0495665_0039689 3300046531 Bacteria 2507
228 Ga0495665_0256965 3300046531 Bacteria 899
229 Ga0495665_0294338 3300046531 Bacteria 832
230 Ga0495586_0552816 3300046535 Bacteria 665
231 Ga0495586_0641737 3300046535 Unclassified 613
232 Ga0495587_0104645 3300046536 Bacteria 1629
233 Ga0495587_0157063 3300046536 Unclassified 1295
234 Ga0495645_0041806 3300046543 Bacteria 3342
235 Ga0495645_0133483 3300046543 Bacteria 1738
236 Ga0495667_0010653 3300046559 Bacteria 6216
237 Ga0495667_0147289 3300046559 Unclassified 1516
238 Ga0495667_0644011 3300046559 Unclassified 659
239 Ga0495634_0172843 3300046642 Bacteria 1357
240 Ga0495635_0140638 3300046663 Unclassified 1644
241 Ga0495635_0941229 3300046663 Unclassified 552
242 Ga0495588_0598959 3300046674 Unclassified 577
243 Ga0495599_0087859 3300046678 Unclassified 1940
244 Ga0495623_0079252 3300046679 Bacteria 2035
245 Ga0495623_0118116 3300046679 Unclassified 1600
246 Ga0495623_0390817 3300046679 Unclassified 750
247 Ga0495647_0179449 3300046681 Unclassified 921
248 Ga0495613_0139752 3300046689 Bacteria 1731
249 Ga0495613_0514196 3300046689 Bacteria 805
250 Ga0495600_0349153 3300046809 Unclassified 927
251 Ga0495600_0872347 3300046809 Unclassified 532
252 Ga0495604_0025990 3300047317 Bacteria 4663
253 Ga0495674_0111957 3300047319 Bacteria 2313
254 Ga0495674_0180249 3300047319 Unclassified 1759
255 Ga0495674_1278078 3300047319 Unclassified 552
256 Ga0495680_0096402 3300047322 Unclassified 2209
257 Ga0495680_0176392 3300047322 Unclassified 1545
258 Ga0495675_0300837 3300047444 Unclassified 953
259 Ga0495675_0430940 3300047444 Bacteria 765
260 Ga0495675_0464487 3300047444 Bacteria 731
261 Ga0495684_0036818 3300047471 Bacteria 3751
262 Ga0495684_0395828 3300047471 Bacteria 971
263 Ga0495602_0162914 3300048088 Unclassified 1739
264 Ga0495602_0164072 3300048088 Unclassified 1731
265 Ga0496100_1378137 3300048903 Unclassified 557
266 Ga0501041_0561145 3300049577 Unclassified 728
267 nmdc:mga05p37_1211100_c1 3300050507 Bacteria 779
268 nmdc:mga0qj67_661335_c1 3300050509 Bacteria 833
269 nmdc:mga06r32_1378568_c1 3300050510 Unclassified 647
270 nmdc:mga06r32_1537707_c1 3300050510 Unclassified 605
271 nmdc:mga0n895_198357_c1 3300050512 Bacteria 2038
272 nmdc:mga0n895_802082_c1 3300050512 Bacteria 932
273 nmdc:mga0rr50_921095_c1 3300050513 Bacteria 745
274 nmdc:mga08x19_1100694_c1 3300050514 Unclassified 564
275 nmdc:mga0a205_235161_c1 3300050515 Bacteria 1714
276 nmdc:mga0a205_372645_c1 3300050515 Bacteria 1293
277 Ga0495601_1056380 3300053077 Unclassified 509
278 Ga0495619_0553902 3300053085 Unclassified 789
279 Ga0207703_11057535
280 Ga0070683_100000032
281 Ga0070683_100172983
282 Ga0070683_100390952
283 Ga0070666_10470341
284 Ga0068868_100181326
285 Ga0070687_100238234
286 Ga0070669_100068806
287 Ga0070675_100329903
288 Ga0070671_100637987
289 Ga0070673_100864399
290 Ga0070673_101990895
291 Ga0070667_100772528
292 Ga0070667_101180794
293 Ga0070709_10629812
294 Ga0070713_101189099
295 Ga0070710_10988255
296 Ga0070711_100471076
297 Ga0070711_100693294
298 Ga0070708_100040086
299 Ga0070708_101629127
300 Ga0070681_10666680
301 Ga0070681_10979510
302 Ga0070681_11180875
303 Ga0068867_102375058
304 Ga0070685_10375303
305 Ga0070707_100951216
306 Ga0070699_100208289
307 Ga0070684_100000046
308 Ga0070684_100222181
309 Ga0070684_100389039
310 Ga0070684_100767991
311 Ga0068853_101285851
312 Ga0070686_101475382
313 Ga0068855_100293011
314 Ga0070664_100793259
315 Ga0068856_100344766
316 Ga0068852_100300895
317 Ga0068859_100722116
318 Ga0068859_101687300
319 Ga0068870_10929033
320 Ga0068858_101706985
321 Ga0068858_102055901
322 Ga0068858_102516143
323 Ga0068860_101148504
324 Ga0068860_102053853
325 Ga0068862_102645300
326 Ga0070717_10009011
327 Ga0070712_101068161
328 Ga0068871_100846440
329 Ga0068871_101950988
330 Ga0075433_10211953
331 Ga0075433_10243114
332 Ga0075434_100604160
333 Ga0075436_101237264
334 Ga0097620_101687419
335 Ga0075435_101089844
336 Ga0105240_10010976
337 Ga0105240_10026501
338 Ga0105240_10195606
339 Ga0105245_12803703
340 Ga0114129_10984353
341 Ga0105241_10651093
342 Ga0105242_11249462
343 Ga0105248_10076106
344 Ga0105248_10582481
345 Ga0105248_10840750
346 Ga0105237_10014769
347 Ga0105237_11130381
348 Ga0105238_10319538
349 Ga0105249_12624489
350 Ga0105239_10057320
351 Ga0157373_10507373
352 Ga0157369_10060400
353 Ga0157378_10442305
354 Ga0157378_11047624
355 Ga0157378_12544037
356 Ga0157372_10205730
357 Ga0157372_10658189
358 Ga0157375_10412477
359 Ga0157375_10648713
360 Ga0157375_10834055
361 Ga0157375_11106339
362 Ga0157375_11353339
363 Ga0163163_10224596
364 Ga0163163_11060919
365 Ga0157380_10863665
366 Ga0157377_11113584
367 Ga0157379_10695795
368 Ga0157379_12085674
369 Ga0157376_10098803
370 Ga0157376_10842516
371 Ga0157376_10952741
372 Ga0157376_11807181
373 Ga0213876_10207278
374 Ga0213875_10233740
375 Ga0207699_10525630
376 Ga0207684_11310835
377 Ga0207695_10007463
378 Ga0207695_10210203
379 Ga0207671_10009179
380 Ga0207662_10364995
381 Ga0207646_11343738
382 Ga0207681_10088827
383 Ga0207694_10504305
384 Ga0207694_10692607
385 Ga0207659_10357524
386 Ga0207700_11824909
387 Ga0207644_10365893
388 Ga0207686_11295384
389 Ga0207670_10368753
390 Ga0207711_10056585
391 Ga0207661_10000020
392 Ga0207661_10167020
393 Ga0207661_10470858
394 Ga0207679_10536495
395 Ga0207712_11673127
396 Ga0207658_10430661
397 Ga0207677_10965118
398 Ga0207639_11390619
399 Ga0207648_10577044
400 Ga0207648_10912823
401 Ga0207648_12169399
402 Ga0207676_10418852
403 Ga0207674_11221898
404 Ga0207674_11715071
405 Ga0207675_100849788
406 Ga0207675_101920608
407 Ga0207698_10364340
408 Ga0265334_10263021
409 Ga0265318_10087408
410 Ga0265323_10003126
411 Ga0265323_10126950
412 Ga0265323_10147428
413 Ga0265336_10055420
414 Ga0265338_10009908
415 Ga0265324_10020874
416 Ga0265330_10058060
417 Ga0265332_10015082
418 Ga0265328_10203162
419 Ga0265320_10000436
420 Ga0265325_10070093
421 Ga0265329_10013385
422 Ga0265340_10025208
423 Ga0265339_10009894
424 Ga0265331_10006306
425 Ga0265316_10000723
426 Ga0265316_10005757
427 Ga0265316_10016005
428 Ga0265316_10081046
429 Ga0265316_10085565
430 Ga0265316_10107186
431 Ga0265316_10486033
432 Ga0265316_11020262
433 Ga0265314_10034729
434 Ga0265314_10049662
435 Ga0265342_10067900
436 Ga0373934_0044988
437 Ga0373934_0109480
438 Ga0373923_0434038
439 Ga0373923_0553712
440 Ga0373954_0110789
441 Ga0373954_0120574
442 Ga0373924_0305905
443 Ga0373935_0333413
444 Ga0373935_1159736
445 Ga0373927_0029485
446 Ga0373933_0021575
447 Ga0373933_0449130
448 Ga0373947_0326775
449 Ga0373947_0473393
450 Ga0373947_0678364
451 Ga0373937_0021262
452 Ga0373937_0138295
453 Ga0373937_0318788
454 Ga0373937_0486816
455 Ga0373937_0513189
456 Ga0373937_0660442
457 Ga0265778_028703
458 Ga0373925_0202489
459 Ga0373925_0238548
460 Ga0373925_0946733
461 Ga0373925_1309030
462 Ga0436364_0102867
463 Ga0436364_0824221
464 Ga0436364_1198481
465 Ga0436365_0077127
466 Ga0436361_1197162
467 Ga0436362_0725328
468 Ga0451800_0335964
469 Ga0451839_0221721
470 Ga0451577_0695527
471 Ga0451577_1247601
472 Ga0453683_0487152
473 Ga0453683_0571655
474 Ga0453683_0634541
475 Ga0466963_0444148
476 Ga0451576_0232843
477 Ga0451576_0414825
478 Ga0451576_1256049
479 Ga0451576_2219383
480 Ga0451576_2690319
481 Ga0466967_2070243
482 Ga0495592_0116095
483 Ga0495629_0601543
484 Ga0495651_0055738
485 Ga0495651_0057915
486 Ga0495653_0123447
487 Ga0495653_0288604
488 Ga0495580_0000506
489 Ga0495580_0022945
490 Ga0495580_0127896
491 Ga0495582_0407448
492 Ga0495639_0419210
493 Ga0495639_0594307
494 Ga0495662_0075701
495 Ga0495664_0155493
496 Ga0495608_0213784
497 Ga0495608_0587034
498 Ga0495618_0268580
499 Ga0495628_0047311
500 Ga0495628_0759111
501 Ga0495630_0071009
502 Ga0495666_0373090
503 Ga0495652_0247314
504 Ga0495652_0958955
505 Ga0495665_0039689
506 Ga0495665_0256965
507 Ga0495665_0294338
508 Ga0495586_0552816
509 Ga0495586_0641737
510 Ga0495587_0104645
511 Ga0495587_0157063
512 Ga0495645_0041806
513 Ga0495645_0133483
514 Ga0495667_0010653
515 Ga0495667_0147289
516 Ga0495667_0644011
517 Ga0495634_0172843
518 Ga0495635_0140638
519 Ga0495635_0941229
520 Ga0495588_0598959
521 Ga0495599_0087859
522 Ga0495623_0079252
523 Ga0495623_0118116
524 Ga0495623_0390817
525 Ga0495647_0179449
526 Ga0495613_0139752
527 Ga0495613_0514196
528 Ga0495600_0349153
529 Ga0495600_0872347
530 Ga0495604_0025990
531 Ga0495674_0111957
532 Ga0495674_0180249
533 Ga0495674_1278078
534 Ga0495680_0096402
535 Ga0495680_0176392
536 Ga0495675_0300837
537 Ga0495675_0430940
538 Ga0495675_0464487
539 Ga0495684_0036818
540 Ga0495684_0395828
541 Ga0495602_0162914
542 Ga0495602_0164072
543 Ga0496100_1378137
544 Ga0501041_0561145
545 nmdc:mga05p37_1211100_c1
546 nmdc:mga0qj67_661335_c1
547 nmdc:mga06r32_1378568_c1
548 nmdc:mga06r32_1537707_c1
549 nmdc:mga0n895_198357_c1
550 nmdc:mga0n895_802082_c1
551 nmdc:mga0rr50_921095_c1
552 nmdc:mga08x19_1100694_c1
553 nmdc:mga0a205_235161_c1
554 nmdc:mga0a205_372645_c1
555 Ga0495601_1056380
556 Ga0495619_0553902

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11950

DUF3467

Protein of unknown function (DUF3467)

1

87

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7fik-assembly1.cif.gz_e the cryo-em structure of the cr subunit from x. laevis npc 0.7527 25 60
7wb4-assembly1.cif.gz_E cryo-em structure of the nr subunit from x. laevis npc 0.7516 25 60
7r5j-assembly1.cif.gz_R0 human nuclear pore complex (dilated) 0.7483 25 60
8k80-assembly1.cif.gz_B crystal structure of langya virus attachment (g) glycoprotein 0.7367 33 59
7fik-assembly1.cif.gz_E the cryo-em structure of the cr subunit from x. laevis npc 0.7342 25 60
ID Description Score Start End Superfamily
af_Q9Z0W3_28_543_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7571 25 60 2.130.10.10
af_D3ZBL6_28_424_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7492 25 60 2.130.10.10
af_Q8LAP6_254_409_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7073 27 60 2.40.128.20
af_E7F579_1551_1680_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7057 33 58 2.30.29.30
af_A0A0N7KS21_64_210_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.6811 27 60 2.40.128.20
ID Description Score Start End GO Terms
AF-A0A1F4F4Y7-F1-model_v4 DUF3467 domain-containing protein 0.9084 5 93
AF-A0A7Y8HZS5-F1-model_v4 DUF3467 domain-containing protein 0.9019 5 91
AF-A0A7Y9TV15-F1-model_v4 DUF3467 domain-containing protein 0.891 3 94
AF-A0A7V5YRL7-F1-model_v4 DUF3467 domain-containing protein 0.8773 7 97
AF-A0A7X2PT35-F1-model_v4 Uncharacterized protein 0.8702 7 89

Map